data_6X4X # _entry.id 6X4X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6X4X pdb_00006x4x 10.2210/pdb6x4x/pdb WWPDB D_1000249582 ? ? BMRB 30755 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'B24Y DKP insulin' _pdbx_database_related.db_id 30755 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6X4X _pdbx_database_status.recvd_initial_deposition_date 2020-05-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Weiss, M.A.' 1 ? 'Yang, Y.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 29618 _citation.page_last 29628 _citation.title 'Evolution of insulin at the edge of foldability and its medical implications.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2010908117 _citation.pdbx_database_id_PubMed 33154160 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rege, N.K.' 1 ? primary 'Liu, M.' 2 ? primary 'Yang, Y.' 3 ? primary 'Dhayalan, B.' 4 ? primary 'Wickramasinghe, N.P.' 5 ? primary 'Chen, Y.S.' 6 ? primary 'Rahimi, L.' 7 ? primary 'Guo, H.' 8 ? primary 'Haataja, L.' 9 ? primary 'Sun, J.' 10 ? primary 'Ismail-Beigi, F.' 11 ? primary 'Phillips, N.B.' 12 ? primary 'Arvan, P.' 13 ? primary 'Weiss, M.A.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Insulin chain A' 2383.698 1 ? ? ? ? 2 polymer man Insulin 3426.894 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A ? 2 'polypeptide(L)' no no FVNQHLCGSDLVEALYLVCGERGYFYTKPT FVNQHLCGSDLVEALYLVCGERGYFYTKPT B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 ASP n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 TYR n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 LYS n 2 29 PRO n 2 30 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 21 Human ? INS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Komagataella pastoris' 4922 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 30 Human ? INS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Komagataella pastoris' 4922 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP INS_HUMAN P01308 ? 1 GIVEQCCTSICSLYQLENYCN 90 2 UNP INS_HUMAN P01308 ? 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6X4X A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 6X4X B 1 ? 30 ? P01308 25 ? 54 ? 22 51 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 6X4X ASP B 10 ? UNP P01308 HIS 34 variant 31 1 2 6X4X TYR B 24 ? UNP P01308 PHE 48 variant 45 2 2 6X4X LYS B 28 ? UNP P01308 PRO 52 variant 49 3 2 6X4X PRO B 29 ? UNP P01308 LYS 53 variant 50 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '4D NOESY' 1 isotropic 2 1 1 '3D 13C-EDITED NOESY' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '2D 1H-15N HSQC' 1 isotropic 5 1 1 '2D 1H-13C HSQC' 1 isotropic 6 2 2 '2D 1H-1H TOCSY' 1 isotropic 7 2 2 '2D 1H-1H NOESY' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 7.4 0.1 'A1-A21 AND B22-B43 13C, N15-LABELED, B24-B51 UNLABLED' ? mM '13C, 15N' ? pH ? ? K 2 303 atm 1 7.4 0.1 ? ? mM UNLABELED ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM 13C, 15N B24YDKP, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N, 13C_SAMPLE' solution 'B10D, B24Y, B28K, B29P INSULIN' 2 '0.5 mM B24DKP, 90% H2O/10% D2O' '90% H2O/10% D2O' UNLABELED solution 'B10D, B24Y, B28K, B29P INSULIN' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6X4X _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 6X4X _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6X4X _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'peak picking' PIPP ? Garrett 5 'data analysis' 'Insight II' ? 'Accelrys Software Inc.' 6 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6X4X _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6X4X _struct.title 'B24Y DKP insulin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6X4X _struct_keywords.text HORMONE _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? CYS A 7 ? GLY A 1 CYS A 7 1 ? 7 HELX_P HELX_P2 AA2 SER A 12 ? TYR A 19 ? SER A 12 TYR A 19 1 ? 8 HELX_P HELX_P3 AA3 CYS B 7 ? CYS B 19 ? CYS B 28 CYS B 40 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 28 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 40 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6X4X _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 22 22 PHE PHE B . n B 2 2 VAL 2 23 23 VAL VAL B . n B 2 3 ASN 3 24 24 ASN ASN B . n B 2 4 GLN 4 25 25 GLN GLN B . n B 2 5 HIS 5 26 26 HIS HIS B . n B 2 6 LEU 6 27 27 LEU LEU B . n B 2 7 CYS 7 28 28 CYS CYS B . n B 2 8 GLY 8 29 29 GLY GLY B . n B 2 9 SER 9 30 30 SER SER B . n B 2 10 ASP 10 31 31 ASP ASP B . n B 2 11 LEU 11 32 32 LEU LEU B . n B 2 12 VAL 12 33 33 VAL VAL B . n B 2 13 GLU 13 34 34 GLU GLU B . n B 2 14 ALA 14 35 35 ALA ALA B . n B 2 15 LEU 15 36 36 LEU LEU B . n B 2 16 TYR 16 37 37 TYR TYR B . n B 2 17 LEU 17 38 38 LEU LEU B . n B 2 18 VAL 18 39 39 VAL VAL B . n B 2 19 CYS 19 40 40 CYS CYS B . n B 2 20 GLY 20 41 41 GLY GLY B . n B 2 21 GLU 21 42 42 GLU GLU B . n B 2 22 ARG 22 43 43 ARG ARG B . n B 2 23 GLY 23 44 44 GLY GLY B . n B 2 24 TYR 24 45 45 TYR TYR B . n B 2 25 PHE 25 46 46 PHE PHE B . n B 2 26 TYR 26 47 47 TYR TYR B . n B 2 27 THR 27 48 48 THR THR B . n B 2 28 LYS 28 49 49 LYS LYS B . n B 2 29 PRO 29 50 50 PRO PRO B . n B 2 30 THR 30 51 51 THR THR B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1470 ? 1 MORE -17 ? 1 'SSA (A^2)' 3620 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-05 2 'Structure model' 1 1 2020-11-25 3 'Structure model' 1 2 2020-12-09 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' 16 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 B24YDKP 0.5 ? mM '13C, 15N' 2 B24DKP 0.5 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR B 48 ? ? -175.74 -129.51 2 1 PRO B 50 ? ? -28.62 112.59 3 2 CYS A 7 ? ? -90.49 -62.38 4 2 THR A 8 ? ? -56.38 -9.75 5 2 SER A 9 ? ? -160.11 -147.18 6 2 THR B 48 ? ? -177.95 -122.75 7 2 PRO B 50 ? ? -28.50 147.82 8 3 SER A 9 ? ? -163.12 -144.28 9 3 VAL B 23 ? ? -47.99 159.03 10 3 THR B 48 ? ? 169.59 -116.32 11 3 PRO B 50 ? ? -28.27 91.01 12 4 CYS A 7 ? ? -92.58 -60.53 13 4 SER A 9 ? ? -157.85 -147.99 14 4 THR B 48 ? ? -150.62 48.22 15 4 PRO B 50 ? ? -25.03 -48.23 16 5 CYS A 7 ? ? -100.33 -63.04 17 5 THR B 48 ? ? 177.30 -78.41 18 6 CYS A 7 ? ? -97.44 -67.97 19 6 THR B 48 ? ? -168.90 -114.68 20 6 PRO B 50 ? ? -27.57 100.97 21 7 CYS A 7 ? ? -93.45 -62.75 22 7 SER A 9 ? ? -161.46 -150.50 23 7 THR B 48 ? ? 175.54 120.95 24 7 LYS B 49 ? ? 38.49 50.09 25 7 PRO B 50 ? ? -26.85 -69.92 26 8 THR B 48 ? ? 179.05 65.52 27 8 LYS B 49 ? ? 34.05 49.36 28 8 PRO B 50 ? ? -26.20 -67.53 29 9 SER A 9 ? ? -154.91 -138.73 30 9 THR B 48 ? ? -178.93 -85.27 31 10 THR B 48 ? ? -169.30 62.98 32 10 LYS B 49 ? ? -152.36 55.73 33 10 PRO B 50 ? ? -30.26 -31.19 34 11 THR B 48 ? ? 173.92 -107.20 35 11 PRO B 50 ? ? -27.47 83.92 36 12 PRO B 50 ? ? -28.17 -39.31 37 13 CYS A 7 ? ? -92.83 -63.33 38 13 SER A 9 ? ? -161.07 -148.92 39 13 THR B 48 ? ? 174.06 85.12 40 13 LYS B 49 ? ? -145.23 52.95 41 13 PRO B 50 ? ? -28.34 109.78 42 14 CYS A 7 ? ? -93.65 -63.78 43 14 THR B 48 ? ? 173.45 -175.99 44 14 PRO B 50 ? ? -30.08 152.24 45 15 CYS A 7 ? ? -92.91 -66.72 46 15 THR B 48 ? ? 166.63 84.56 47 15 LYS B 49 ? ? -160.23 50.88 48 15 PRO B 50 ? ? -29.06 109.88 49 16 CYS A 7 ? ? -94.57 -63.74 50 16 THR A 8 ? ? -57.68 -7.42 51 16 SER A 9 ? ? -156.65 -148.89 52 16 THR B 48 ? ? 167.43 75.30 53 16 LYS B 49 ? ? -142.95 50.64 54 16 PRO B 50 ? ? -29.21 100.18 55 17 CYS A 7 ? ? -98.51 -66.13 56 17 THR A 8 ? ? -57.63 -9.30 57 17 VAL B 23 ? ? -47.77 158.62 58 17 THR B 48 ? ? -175.18 56.13 59 17 PRO B 50 ? ? -26.28 -47.16 60 18 CYS A 7 ? ? -94.91 -66.65 61 18 THR A 8 ? ? -57.77 -8.84 62 18 SER A 9 ? ? -160.84 -159.07 63 18 THR B 48 ? ? 174.68 179.87 64 18 PRO B 50 ? ? -27.46 -62.95 65 19 CYS A 7 ? ? -96.43 -66.32 66 19 THR B 48 ? ? -173.32 -128.10 67 19 PRO B 50 ? ? -28.78 103.15 68 20 CYS A 7 ? ? -92.96 -64.14 69 20 SER A 9 ? ? -159.74 -145.84 70 20 LYS B 49 ? ? -144.06 46.82 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? #