data_6XEH # _entry.id 6XEH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6XEH pdb_00006xeh 10.2210/pdb6xeh/pdb WWPDB D_1000250023 ? ? BMRB 30763 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Solution NMR Structure of DE NOVO DESIGNED Rossmann 2x3 Fold Protein r2x3_168, Northeast Structural Genomics Consortium (NESG) Target OR386 ; _pdbx_database_related.db_id 30763 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6XEH _pdbx_database_status.recvd_initial_deposition_date 2020-06-12 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, G.' 1 0000-0002-4343-0356 'Montelione, G.T.' 2 0000-0002-9440-3059 'Northeast Structural Genomics Consortium (NESG)' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Role of backbone strain in de novo design of complex alpha/beta protein structures Accurate de novo design of asymetric alpha/beta proteins with ten or more secondary structure elements requires consideration of backbone strain Design principle proposed from designed larger alpha/beta-proteins not folded as designed: Consistency between local, non-local, and global structures ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koga, N.' 1 ? primary 'Koga, R.' 2 ? primary 'Liu, G.' 3 ? primary 'Castellanos, J.' 4 ? primary 'Montelione, G.T.' 5 ? primary 'Baker, D.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DE NOVO DESIGNED OR386' _entity.formula_weight 14535.344 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGKVVFLSDDQEIIEEVSKKAEEEGYDIQTSNDKKEIIDRLKRRNIDMIIVKTEDKESISEIIKQVLDSGAKVLILSSDE NIIESIRKQYPKVETRRAQDKEEVKDAVEEFLKEGGSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGKVVFLSDDQEIIEEVSKKAEEEGYDIQTSNDKKEIIDRLKRRNIDMIIVKTEDKESISEIIKQVLDSGAKVLILSSDE NIIESIRKQYPKVETRRAQDKEEVKDAVEEFLKEGGSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LYS n 1 4 VAL n 1 5 VAL n 1 6 PHE n 1 7 LEU n 1 8 SER n 1 9 ASP n 1 10 ASP n 1 11 GLN n 1 12 GLU n 1 13 ILE n 1 14 ILE n 1 15 GLU n 1 16 GLU n 1 17 VAL n 1 18 SER n 1 19 LYS n 1 20 LYS n 1 21 ALA n 1 22 GLU n 1 23 GLU n 1 24 GLU n 1 25 GLY n 1 26 TYR n 1 27 ASP n 1 28 ILE n 1 29 GLN n 1 30 THR n 1 31 SER n 1 32 ASN n 1 33 ASP n 1 34 LYS n 1 35 LYS n 1 36 GLU n 1 37 ILE n 1 38 ILE n 1 39 ASP n 1 40 ARG n 1 41 LEU n 1 42 LYS n 1 43 ARG n 1 44 ARG n 1 45 ASN n 1 46 ILE n 1 47 ASP n 1 48 MET n 1 49 ILE n 1 50 ILE n 1 51 VAL n 1 52 LYS n 1 53 THR n 1 54 GLU n 1 55 ASP n 1 56 LYS n 1 57 GLU n 1 58 SER n 1 59 ILE n 1 60 SER n 1 61 GLU n 1 62 ILE n 1 63 ILE n 1 64 LYS n 1 65 GLN n 1 66 VAL n 1 67 LEU n 1 68 ASP n 1 69 SER n 1 70 GLY n 1 71 ALA n 1 72 LYS n 1 73 VAL n 1 74 LEU n 1 75 ILE n 1 76 LEU n 1 77 SER n 1 78 SER n 1 79 ASP n 1 80 GLU n 1 81 ASN n 1 82 ILE n 1 83 ILE n 1 84 GLU n 1 85 SER n 1 86 ILE n 1 87 ARG n 1 88 LYS n 1 89 GLN n 1 90 TYR n 1 91 PRO n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 ARG n 1 97 ARG n 1 98 ALA n 1 99 GLN n 1 100 ASP n 1 101 LYS n 1 102 GLU n 1 103 GLU n 1 104 VAL n 1 105 LYS n 1 106 ASP n 1 107 ALA n 1 108 VAL n 1 109 GLU n 1 110 GLU n 1 111 PHE n 1 112 LEU n 1 113 LYS n 1 114 GLU n 1 115 GLY n 1 116 GLY n 1 117 SER n 1 118 LEU n 1 119 GLU n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6XEH _struct_ref.pdbx_db_accession 6XEH _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6XEH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6XEH _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 1 isotropic 7 1 1 '3D HCCH-TOCSY' 1 isotropic 8 1 1 '3D SIMUTANEOUS 1H, 15N, 13C NOESY' 1 isotropic 9 1 2 '2D 1H-13C HSQC aliphatic' 1 isotropic 10 1 3 '2D 1H-15N HSQC' 2 anisotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.6 mM [U-13C; U-15N] OR386, 90% H2O/10% D2O' '90% H2O/10% D2O' NC solution ? 3 '0.6 mM [U-10% 13C; U-100% 15N] OR386, 90% H2O/10% D2O' '90% H2O/10% D2O' NC5_rdc solution 'RDC measurement' 2 '0.6 mM [U-10% 13C; U-100% 15N] OR386, 90% H2O/10% D2O' '90% H2O/10% D2O' NC5 solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 ? 2 AVANCE ? Bruker 600 ? # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 6XEH 'simulated annealing' ? 1 6XEH 'torsion angle dynamics' ? 2 # _pdbx_nmr_ensemble.entry_id 6XEH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6XEH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 'structure calculation' ASDP ? 'Huang, Montelione' 3 'chemical shift assignment' AutoAssign ? 'Zimmerman, Moseley, Kulikowski and Montelione' 4 'peak picking' XEASY ? 'Bartels et al.' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6XEH _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6XEH _struct.title ;Solution NMR Structure of DE NOVO DESIGNED Rossmann 2x3 Fold Protein r2x3_168, Northeast Structural Genomics Consortium (NESG) Target OR386 ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6XEH _struct_keywords.text 'Rosemann 2x3 fold NMR, Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? GLY A 25 ? ASP A 10 GLY A 25 1 ? 16 HELX_P HELX_P2 AA2 ASP A 33 ? ARG A 43 ? ASP A 33 ARG A 43 1 ? 11 HELX_P HELX_P3 AA3 ASP A 55 ? GLY A 70 ? ASP A 55 GLY A 70 1 ? 16 HELX_P HELX_P4 AA4 ASP A 79 ? TYR A 90 ? ASP A 79 TYR A 90 1 ? 12 HELX_P HELX_P5 AA5 ASP A 100 ? GLU A 114 ? ASP A 100 GLU A 114 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 29 ? SER A 31 ? GLN A 29 SER A 31 AA1 2 VAL A 4 ? SER A 8 ? VAL A 4 SER A 8 AA1 3 MET A 48 ? LYS A 52 ? MET A 48 LYS A 52 AA1 4 LYS A 72 ? SER A 77 ? LYS A 72 SER A 77 AA1 5 GLU A 94 ? ARG A 97 ? GLU A 94 ARG A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 29 ? O GLN A 29 N PHE A 6 ? N PHE A 6 AA1 2 3 N LEU A 7 ? N LEU A 7 O LYS A 52 ? O LYS A 52 AA1 3 4 N VAL A 51 ? N VAL A 51 O LEU A 76 ? O LEU A 76 AA1 4 5 N VAL A 73 ? N VAL A 73 O GLU A 94 ? O GLU A 94 # _atom_sites.entry_id 6XEH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 HIS 125 125 125 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-05 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 OR386 0.6 ? mM '[U-13C; U-15N]' 3 OR386 0.6 ? mM '[U-10% 13C; U-100% 15N]' 2 OR386 0.6 ? mM '[U-10% 13C; U-100% 15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? -64.26 95.82 2 1 LEU A 118 ? ? -95.50 -62.69 3 1 HIS A 120 ? ? -165.60 113.72 4 1 HIS A 121 ? ? -77.28 -164.45 5 2 ASP A 55 ? ? -68.23 96.82 6 2 SER A 117 ? ? 62.08 175.70 7 2 LEU A 118 ? ? -122.88 -52.84 8 2 HIS A 123 ? ? -94.00 53.60 9 3 ASP A 27 ? ? -68.09 93.27 10 3 HIS A 121 ? ? -149.87 -50.37 11 4 HIS A 121 ? ? -64.14 89.11 12 5 ASP A 27 ? ? -100.15 74.61 13 5 HIS A 122 ? ? -49.38 93.75 14 6 ASP A 27 ? ? -69.80 92.91 15 6 LEU A 118 ? ? -81.15 -70.01 16 6 HIS A 120 ? ? -93.71 55.33 17 6 HIS A 122 ? ? -67.03 93.75 18 7 LYS A 3 ? ? 173.51 131.14 19 7 ASP A 27 ? ? -68.21 92.08 20 7 LEU A 118 ? ? -130.03 -62.31 21 7 HIS A 121 ? ? -123.37 -68.31 22 7 HIS A 122 ? ? -157.50 -48.38 23 7 HIS A 123 ? ? -137.80 -77.76 24 8 LYS A 3 ? ? -161.61 108.66 25 8 HIS A 122 ? ? -68.33 86.23 26 9 HIS A 121 ? ? 74.46 39.92 27 10 LEU A 118 ? ? -70.54 -78.01 28 10 GLU A 119 ? ? 167.03 124.32 29 10 HIS A 121 ? ? -63.76 88.50 30 11 LYS A 3 ? ? -65.69 97.58 31 11 LEU A 118 ? ? -127.56 -50.53 32 11 HIS A 121 ? ? -66.72 98.98 33 12 LYS A 3 ? ? -161.80 108.28 34 12 HIS A 123 ? ? -63.54 86.66 35 13 GLU A 54 ? ? -146.09 33.04 36 13 GLU A 119 ? ? -110.03 -161.77 37 13 HIS A 120 ? ? 71.95 -66.17 38 13 HIS A 124 ? ? -64.90 96.07 39 14 LYS A 3 ? ? -167.68 111.36 40 14 GLU A 119 ? ? -59.05 103.64 41 15 HIS A 121 ? ? -103.75 55.25 42 16 GLU A 119 ? ? -68.82 98.86 43 16 HIS A 122 ? ? -71.79 -156.92 44 16 HIS A 123 ? ? -52.34 90.04 45 16 HIS A 124 ? ? -142.78 15.28 46 17 ASP A 33 ? ? -68.63 86.07 47 17 HIS A 123 ? ? -176.74 101.89 48 18 ASP A 55 ? ? -69.65 93.35 49 18 GLU A 119 ? ? -84.52 30.47 50 19 LYS A 3 ? ? -173.45 89.41 51 19 GLU A 119 ? ? -68.72 81.14 52 19 HIS A 121 ? ? 40.04 77.85 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #