data_6XH9 # _entry.id 6XH9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6XH9 pdb_00006xh9 10.2210/pdb6xh9/pdb WWPDB D_1000250159 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6XH9 _pdbx_database_status.recvd_initial_deposition_date 2020-06-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, F.K.K.' 1 0000-0001-7318-9754 'Strynadka, N.C.J.' 2 0000-0002-4058-9425 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 213 _citation.language ? _citation.page_first 107733 _citation.page_last 107733 _citation.title ;Crystallographic analysis of TarI and TarJ, a cytidylyltransferase and reductase pair for CDP-ribitol synthesis in Staphylococcus aureus wall teichoic acid biogenesis. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2021.107733 _citation.pdbx_database_id_PubMed 33819634 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, F.K.K.' 1 ? primary 'Gale, R.T.' 2 ? primary 'Petrotchenko, E.V.' 3 ? primary 'Borchers, C.H.' 4 ? primary 'Brown, E.D.' 5 ? primary 'Strynadka, N.C.J.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6XH9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 99.483 _cell.length_a_esd ? _cell.length_b 99.483 _cell.length_b_esd ? _cell.length_c 268.428 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6XH9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribulose-5-phosphate reductase 1' _entity.formula_weight 38565.766 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 1.1.1.405 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TarJ, Ribulose-5-P reductase 1,Ribitol-5-phosphate dehydrogenase 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSI(CME)AADQRYYTGSRDENVLSQKLPMSLIHEGVGEVVFDSKG VFNKGTKVVMVPNTPTEKDDVIAENYLKSSYFRSSGHDGFMQDFVLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRF EKKSISNKNTFGIWGDGNLGYITAILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLTFDHAFECVGGRGSQ SAINQMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSRSGSKDFQDVVDLYIQYPDIVDKLALLKGQEFEIAT INDLTEAFEADLSTSWGKTVLKWIM ; _entity_poly.pdbx_seq_one_letter_code_can ;MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYYTGSRDENVLSQKLPMSLIHEGVGEVVFDSKGVFNK GTKVVMVPNTPTEKDDVIAENYLKSSYFRSSGHDGFMQDFVLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKS ISNKNTFGIWGDGNLGYITAILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLTFDHAFECVGGRGSQSAIN QMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSRSGSKDFQDVVDLYIQYPDIVDKLALLKGQEFEIATINDL TEAFEADLSTSWGKTVLKWIM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 ASN n 1 4 GLN n 1 5 VAL n 1 6 TYR n 1 7 GLN n 1 8 LEU n 1 9 VAL n 1 10 ALA n 1 11 PRO n 1 12 ARG n 1 13 GLN n 1 14 PHE n 1 15 GLU n 1 16 VAL n 1 17 THR n 1 18 TYR n 1 19 ASN n 1 20 ASN n 1 21 VAL n 1 22 ASP n 1 23 ILE n 1 24 TYR n 1 25 SER n 1 26 ASP n 1 27 TYR n 1 28 VAL n 1 29 ILE n 1 30 VAL n 1 31 ARG n 1 32 PRO n 1 33 LEU n 1 34 TYR n 1 35 MET n 1 36 SER n 1 37 ILE n 1 38 CME n 1 39 ALA n 1 40 ALA n 1 41 ASP n 1 42 GLN n 1 43 ARG n 1 44 TYR n 1 45 TYR n 1 46 THR n 1 47 GLY n 1 48 SER n 1 49 ARG n 1 50 ASP n 1 51 GLU n 1 52 ASN n 1 53 VAL n 1 54 LEU n 1 55 SER n 1 56 GLN n 1 57 LYS n 1 58 LEU n 1 59 PRO n 1 60 MET n 1 61 SER n 1 62 LEU n 1 63 ILE n 1 64 HIS n 1 65 GLU n 1 66 GLY n 1 67 VAL n 1 68 GLY n 1 69 GLU n 1 70 VAL n 1 71 VAL n 1 72 PHE n 1 73 ASP n 1 74 SER n 1 75 LYS n 1 76 GLY n 1 77 VAL n 1 78 PHE n 1 79 ASN n 1 80 LYS n 1 81 GLY n 1 82 THR n 1 83 LYS n 1 84 VAL n 1 85 VAL n 1 86 MET n 1 87 VAL n 1 88 PRO n 1 89 ASN n 1 90 THR n 1 91 PRO n 1 92 THR n 1 93 GLU n 1 94 LYS n 1 95 ASP n 1 96 ASP n 1 97 VAL n 1 98 ILE n 1 99 ALA n 1 100 GLU n 1 101 ASN n 1 102 TYR n 1 103 LEU n 1 104 LYS n 1 105 SER n 1 106 SER n 1 107 TYR n 1 108 PHE n 1 109 ARG n 1 110 SER n 1 111 SER n 1 112 GLY n 1 113 HIS n 1 114 ASP n 1 115 GLY n 1 116 PHE n 1 117 MET n 1 118 GLN n 1 119 ASP n 1 120 PHE n 1 121 VAL n 1 122 LEU n 1 123 LEU n 1 124 ASN n 1 125 HIS n 1 126 ASP n 1 127 ARG n 1 128 ALA n 1 129 VAL n 1 130 PRO n 1 131 LEU n 1 132 PRO n 1 133 ASP n 1 134 ASP n 1 135 ILE n 1 136 ASP n 1 137 LEU n 1 138 SER n 1 139 ILE n 1 140 ILE n 1 141 SER n 1 142 TYR n 1 143 THR n 1 144 GLU n 1 145 LEU n 1 146 VAL n 1 147 THR n 1 148 VAL n 1 149 SER n 1 150 LEU n 1 151 HIS n 1 152 ALA n 1 153 ILE n 1 154 ARG n 1 155 ARG n 1 156 PHE n 1 157 GLU n 1 158 LYS n 1 159 LYS n 1 160 SER n 1 161 ILE n 1 162 SER n 1 163 ASN n 1 164 LYS n 1 165 ASN n 1 166 THR n 1 167 PHE n 1 168 GLY n 1 169 ILE n 1 170 TRP n 1 171 GLY n 1 172 ASP n 1 173 GLY n 1 174 ASN n 1 175 LEU n 1 176 GLY n 1 177 TYR n 1 178 ILE n 1 179 THR n 1 180 ALA n 1 181 ILE n 1 182 LEU n 1 183 LEU n 1 184 ARG n 1 185 LYS n 1 186 LEU n 1 187 TYR n 1 188 PRO n 1 189 GLU n 1 190 SER n 1 191 LYS n 1 192 ILE n 1 193 TYR n 1 194 VAL n 1 195 PHE n 1 196 GLY n 1 197 LYS n 1 198 THR n 1 199 ASP n 1 200 TYR n 1 201 LYS n 1 202 LEU n 1 203 SER n 1 204 HIS n 1 205 PHE n 1 206 SER n 1 207 PHE n 1 208 VAL n 1 209 ASP n 1 210 ASP n 1 211 VAL n 1 212 PHE n 1 213 PHE n 1 214 ILE n 1 215 ASN n 1 216 LYS n 1 217 ILE n 1 218 PRO n 1 219 GLU n 1 220 GLY n 1 221 LEU n 1 222 THR n 1 223 PHE n 1 224 ASP n 1 225 HIS n 1 226 ALA n 1 227 PHE n 1 228 GLU n 1 229 CYS n 1 230 VAL n 1 231 GLY n 1 232 GLY n 1 233 ARG n 1 234 GLY n 1 235 SER n 1 236 GLN n 1 237 SER n 1 238 ALA n 1 239 ILE n 1 240 ASN n 1 241 GLN n 1 242 MET n 1 243 ILE n 1 244 ASP n 1 245 TYR n 1 246 ILE n 1 247 SER n 1 248 PRO n 1 249 GLU n 1 250 GLY n 1 251 SER n 1 252 ILE n 1 253 ALA n 1 254 LEU n 1 255 LEU n 1 256 GLY n 1 257 VAL n 1 258 SER n 1 259 GLU n 1 260 PHE n 1 261 PRO n 1 262 VAL n 1 263 GLU n 1 264 VAL n 1 265 ASN n 1 266 THR n 1 267 ARG n 1 268 LEU n 1 269 VAL n 1 270 LEU n 1 271 GLU n 1 272 LYS n 1 273 GLY n 1 274 LEU n 1 275 THR n 1 276 LEU n 1 277 ILE n 1 278 GLY n 1 279 SER n 1 280 SER n 1 281 ARG n 1 282 SER n 1 283 GLY n 1 284 SER n 1 285 LYS n 1 286 ASP n 1 287 PHE n 1 288 GLN n 1 289 ASP n 1 290 VAL n 1 291 VAL n 1 292 ASP n 1 293 LEU n 1 294 TYR n 1 295 ILE n 1 296 GLN n 1 297 TYR n 1 298 PRO n 1 299 ASP n 1 300 ILE n 1 301 VAL n 1 302 ASP n 1 303 LYS n 1 304 LEU n 1 305 ALA n 1 306 LEU n 1 307 LEU n 1 308 LYS n 1 309 GLY n 1 310 GLN n 1 311 GLU n 1 312 PHE n 1 313 GLU n 1 314 ILE n 1 315 ALA n 1 316 THR n 1 317 ILE n 1 318 ASN n 1 319 ASP n 1 320 LEU n 1 321 THR n 1 322 GLU n 1 323 ALA n 1 324 PHE n 1 325 GLU n 1 326 ALA n 1 327 ASP n 1 328 LEU n 1 329 SER n 1 330 THR n 1 331 SER n 1 332 TRP n 1 333 GLY n 1 334 LYS n 1 335 THR n 1 336 VAL n 1 337 LEU n 1 338 LYS n 1 339 TRP n 1 340 ILE n 1 341 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 341 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'tarJ, SAOUHSC_00226' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TARJ1_STAA8 _struct_ref.pdbx_db_accession Q2G1B9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYYTGSRDENVLSQKLPMSLIHEGVGEVVFDSKGVFNK GTKVVMVPNTPTEKDDVIAENYLKSSYFRSSGHDGFMQDFVLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKS ISNKNTFGIWGDGNLGYITAILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLTFDHAFECVGGRGSQSAIN QMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSRSGSKDFQDVVDLYIQYPDIVDKLALLKGQEFEIATINDL TEAFEADLSTSWGKTVLKWIM ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6XH9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 341 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2G1B9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 341 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 341 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6XH9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 75.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.1 M ammonium phosphate monobasic, 0.1 M sodium citrate pH 5.6' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-10-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6XH9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.2 _reflns.d_resolution_low 48.9090 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13739 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.88 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.44 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.05771 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.2 _reflns_shell.d_res_low 3.315 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.46 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1340 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.5733 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.698 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 195.460 _refine.B_iso_mean 109.3954 _refine.B_iso_min 68.240 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6XH9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.2000 _refine.ls_d_res_low 48.9090 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13732 _refine.ls_number_reflns_R_free 687 _refine.ls_number_reflns_R_work 13045 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9300 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2091 _refine.ls_R_factor_R_free 0.2397 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2076 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ILK _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.7700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.2000 _refine_hist.d_res_low 48.9090 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2372 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 310 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2372 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.010 ? ? 2425 'X-RAY DIFFRACTION' ? f_angle_d 1.202 ? ? 3310 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 2.860 ? ? 1405 'X-RAY DIFFRACTION' ? f_chiral_restr 0.076 ? ? 387 'X-RAY DIFFRACTION' ? f_plane_restr 0.010 ? ? 424 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.2002 3.4473 . . 133 2529 100.0000 . . . 0.2956 0.0000 0.2824 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4473 3.7941 . . 133 2529 100.0000 . . . 0.2675 0.0000 0.2299 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7941 4.3428 . . 135 2573 100.0000 . . . 0.2422 0.0000 0.1886 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3428 5.4703 . . 138 2609 100.0000 . . . 0.1834 0.0000 0.1772 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.4703 48.9090 . . 148 2805 100.0000 . . . 0.2541 0.0000 0.2135 . . . . . . . . . . . # _struct.entry_id 6XH9 _struct.title 'Crystal structure of S. aureus TarJ' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6XH9 _struct_keywords.text 'alcohol dehydrogenase, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CME A 38 ? GLY A 47 ? CME A 38 GLY A 47 1 ? 10 HELX_P HELX_P2 AA2 ASN A 124 ? ASP A 126 ? ASN A 124 ASP A 126 5 ? 3 HELX_P HELX_P3 AA3 ASP A 136 ? SER A 141 ? ASP A 136 SER A 141 1 ? 6 HELX_P HELX_P4 AA4 TYR A 142 ? PHE A 156 ? TYR A 142 PHE A 156 1 ? 15 HELX_P HELX_P5 AA5 GLU A 157 ? ILE A 161 ? GLU A 157 ILE A 161 5 ? 5 HELX_P HELX_P6 AA6 GLY A 173 ? TYR A 187 ? GLY A 173 TYR A 187 1 ? 15 HELX_P HELX_P7 AA7 THR A 198 ? SER A 203 ? THR A 198 SER A 203 1 ? 6 HELX_P HELX_P8 AA8 ARG A 233 ? ILE A 246 ? ARG A 233 ILE A 246 1 ? 14 HELX_P HELX_P9 AA9 ASN A 265 ? GLY A 273 ? ASN A 265 GLY A 273 1 ? 9 HELX_P HELX_P10 AB1 GLY A 283 ? TYR A 297 ? GLY A 283 TYR A 297 1 ? 15 HELX_P HELX_P11 AB2 PRO A 298 ? LEU A 306 ? PRO A 298 LEU A 306 1 ? 9 HELX_P HELX_P12 AB3 THR A 316 ? THR A 330 ? THR A 316 THR A 330 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 37 C ? ? ? 1_555 A CME 38 N ? ? A ILE 37 A CME 38 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale2 covale both ? A CME 38 C ? ? ? 1_555 A ALA 39 N ? ? A CME 38 A ALA 39 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? parallel AA4 1 2 ? parallel AA4 2 3 ? parallel AA4 3 4 ? parallel AA4 4 5 ? parallel AA4 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 2 ? ALA A 10 ? ILE A 2 ALA A 10 AA1 2 GLN A 13 ? ASN A 20 ? GLN A 13 ASN A 20 AA2 1 VAL A 121 ? LEU A 123 ? VAL A 121 LEU A 123 AA2 2 VAL A 28 ? SER A 36 ? VAL A 28 SER A 36 AA2 3 GLU A 65 ? PHE A 72 ? GLU A 65 PHE A 72 AA2 4 LYS A 83 ? MET A 86 ? LYS A 83 MET A 86 AA2 5 ALA A 128 ? PRO A 130 ? ALA A 128 PRO A 130 AA3 1 VAL A 121 ? LEU A 123 ? VAL A 121 LEU A 123 AA3 2 VAL A 28 ? SER A 36 ? VAL A 28 SER A 36 AA3 3 LYS A 334 ? TRP A 339 ? LYS A 334 TRP A 339 AA3 4 LYS A 308 ? ILE A 314 ? LYS A 308 ILE A 314 AA4 1 ASP A 210 ? PHE A 213 ? ASP A 210 PHE A 213 AA4 2 LYS A 191 ? GLY A 196 ? LYS A 191 GLY A 196 AA4 3 THR A 166 ? TRP A 170 ? THR A 166 TRP A 170 AA4 4 HIS A 225 ? GLU A 228 ? HIS A 225 GLU A 228 AA4 5 SER A 251 ? LEU A 254 ? SER A 251 LEU A 254 AA4 6 THR A 275 ? GLY A 278 ? THR A 275 GLY A 278 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 3 ? N ASN A 3 O ASN A 19 ? O ASN A 19 AA2 1 2 O VAL A 121 ? O VAL A 121 N VAL A 30 ? N VAL A 30 AA2 2 3 N ARG A 31 ? N ARG A 31 O GLU A 69 ? O GLU A 69 AA2 3 4 N GLY A 68 ? N GLY A 68 O VAL A 84 ? O VAL A 84 AA2 4 5 N VAL A 85 ? N VAL A 85 O VAL A 129 ? O VAL A 129 AA3 1 2 O VAL A 121 ? O VAL A 121 N VAL A 30 ? N VAL A 30 AA3 2 3 N MET A 35 ? N MET A 35 O LEU A 337 ? O LEU A 337 AA3 3 4 O LYS A 338 ? O LYS A 338 N PHE A 312 ? N PHE A 312 AA4 1 2 O PHE A 212 ? O PHE A 212 N VAL A 194 ? N VAL A 194 AA4 2 3 O PHE A 195 ? O PHE A 195 N ILE A 169 ? N ILE A 169 AA4 3 4 N TRP A 170 ? N TRP A 170 O PHE A 227 ? O PHE A 227 AA4 4 5 N GLU A 228 ? N GLU A 228 O ALA A 253 ? O ALA A 253 AA4 5 6 N ILE A 252 ? N ILE A 252 O ILE A 277 ? O ILE A 277 # _atom_sites.entry_id 6XH9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010052 _atom_sites.fract_transf_matrix[1][2] 0.005804 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011607 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003725 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 CME 38 38 38 CME CME A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 SER 48 48 ? ? ? A . n A 1 49 ARG 49 49 ? ? ? A . n A 1 50 ASP 50 50 ? ? ? A . n A 1 51 GLU 51 51 ? ? ? A . n A 1 52 ASN 52 52 ? ? ? A . n A 1 53 VAL 53 53 ? ? ? A . n A 1 54 LEU 54 54 ? ? ? A . n A 1 55 SER 55 55 ? ? ? A . n A 1 56 GLN 56 56 ? ? ? A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 THR 92 92 ? ? ? A . n A 1 93 GLU 93 93 ? ? ? A . n A 1 94 LYS 94 94 ? ? ? A . n A 1 95 ASP 95 95 ? ? ? A . n A 1 96 ASP 96 96 ? ? ? A . n A 1 97 VAL 97 97 ? ? ? A . n A 1 98 ILE 98 98 ? ? ? A . n A 1 99 ALA 99 99 ? ? ? A . n A 1 100 GLU 100 100 ? ? ? A . n A 1 101 ASN 101 101 ? ? ? A . n A 1 102 TYR 102 102 ? ? ? A . n A 1 103 LEU 103 103 ? ? ? A . n A 1 104 LYS 104 104 ? ? ? A . n A 1 105 SER 105 105 ? ? ? A . n A 1 106 SER 106 106 ? ? ? A . n A 1 107 TYR 107 107 ? ? ? A . n A 1 108 PHE 108 108 ? ? ? A . n A 1 109 ARG 109 109 ? ? ? A . n A 1 110 SER 110 110 ? ? ? A . n A 1 111 SER 111 111 ? ? ? A . n A 1 112 GLY 112 112 ? ? ? A . n A 1 113 HIS 113 113 ? ? ? A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 TYR 187 187 187 TYR TYR A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 PHE 205 205 205 PHE PHE A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 PHE 207 207 207 PHE PHE A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 ASN 215 215 215 ASN ASN A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 HIS 225 225 225 HIS HIS A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 PHE 227 227 227 PHE PHE A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 CYS 229 229 229 CYS CYS A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 ARG 233 233 233 ARG ARG A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 ASN 240 240 240 ASN ASN A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 MET 242 242 242 MET MET A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 TYR 245 245 245 TYR TYR A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 GLU 249 249 249 GLU GLU A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 PHE 260 260 260 PHE PHE A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 VAL 264 264 264 VAL VAL A . n A 1 265 ASN 265 265 265 ASN ASN A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 ARG 267 267 267 ARG ARG A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 VAL 269 269 269 VAL VAL A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 LYS 272 272 272 LYS LYS A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 THR 275 275 275 THR THR A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 SER 280 280 280 SER SER A . n A 1 281 ARG 281 281 281 ARG ARG A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 LYS 285 285 285 LYS LYS A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 PHE 287 287 287 PHE PHE A . n A 1 288 GLN 288 288 288 GLN GLN A . n A 1 289 ASP 289 289 289 ASP ASP A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 VAL 291 291 291 VAL VAL A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 TYR 294 294 294 TYR TYR A . n A 1 295 ILE 295 295 295 ILE ILE A . n A 1 296 GLN 296 296 296 GLN GLN A . n A 1 297 TYR 297 297 297 TYR TYR A . n A 1 298 PRO 298 298 298 PRO PRO A . n A 1 299 ASP 299 299 299 ASP ASP A . n A 1 300 ILE 300 300 300 ILE ILE A . n A 1 301 VAL 301 301 301 VAL VAL A . n A 1 302 ASP 302 302 302 ASP ASP A . n A 1 303 LYS 303 303 303 LYS LYS A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 ALA 305 305 305 ALA ALA A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 LEU 307 307 307 LEU LEU A . n A 1 308 LYS 308 308 308 LYS LYS A . n A 1 309 GLY 309 309 309 GLY GLY A . n A 1 310 GLN 310 310 310 GLN GLN A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 PHE 312 312 312 PHE PHE A . n A 1 313 GLU 313 313 313 GLU GLU A . n A 1 314 ILE 314 314 314 ILE ILE A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 THR 316 316 316 THR THR A . n A 1 317 ILE 317 317 317 ILE ILE A . n A 1 318 ASN 318 318 318 ASN ASN A . n A 1 319 ASP 319 319 319 ASP ASP A . n A 1 320 LEU 320 320 320 LEU LEU A . n A 1 321 THR 321 321 321 THR THR A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 ALA 323 323 323 ALA ALA A . n A 1 324 PHE 324 324 324 PHE PHE A . n A 1 325 GLU 325 325 325 GLU GLU A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 ASP 327 327 327 ASP ASP A . n A 1 328 LEU 328 328 328 LEU LEU A . n A 1 329 SER 329 329 329 SER SER A . n A 1 330 THR 330 330 330 THR THR A . n A 1 331 SER 331 331 331 SER SER A . n A 1 332 TRP 332 332 332 TRP TRP A . n A 1 333 GLY 333 333 333 GLY GLY A . n A 1 334 LYS 334 334 334 LYS LYS A . n A 1 335 THR 335 335 335 THR THR A . n A 1 336 VAL 336 336 336 VAL VAL A . n A 1 337 LEU 337 337 337 LEU LEU A . n A 1 338 LYS 338 338 338 LYS LYS A . n A 1 339 TRP 339 339 339 TRP TRP A . n A 1 340 ILE 340 340 340 ILE ILE A . n A 1 341 MET 341 341 341 MET MET A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CME _pdbx_struct_mod_residue.label_seq_id 38 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CME _pdbx_struct_mod_residue.auth_seq_id 38 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1980 ? 1 MORE -11 ? 1 'SSA (A^2)' 26110 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_555 x,x-y,-z+1/3 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 89.4760000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-21 2 'Structure model' 1 1 2021-05-05 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 35.8093 6.3788 11.3867 0.9880 ? 0.1416 ? -0.1260 ? 0.6495 ? -0.1456 ? 0.8240 ? 3.9918 ? 1.4594 ? -1.3583 ? 5.4528 ? -0.1808 ? 3.2375 ? -0.1552 ? -0.2852 ? -0.0953 ? -0.0523 ? -0.1804 ? -0.5321 ? -0.3796 ? -0.4874 ? 0.3115 ? 2 'X-RAY DIFFRACTION' ? refined 25.1121 26.1935 32.5481 1.1976 ? 0.4236 ? 0.0089 ? 0.6866 ? -0.0557 ? 0.8082 ? 4.3067 ? -1.3645 ? 0.8322 ? 4.1219 ? 0.4395 ? 3.3494 ? 0.0750 ? 0.1099 ? 0.0865 ? 0.1321 ? 0.0351 ? 0.0652 ? -0.4987 ? -0.4974 ? -0.1380 ? 3 'X-RAY DIFFRACTION' ? refined 29.7594 19.6036 19.1810 1.3508 ? 0.4499 ? -0.0187 ? 0.7385 ? -0.0440 ? 0.9454 ? 0.6433 ? -0.5124 ? -1.3642 ? 1.2029 ? 2.0983 ? 5.1589 ? 0.2229 ? 0.3930 ? 0.2866 ? -0.2837 ? 0.1537 ? -0.3947 ? -1.4144 ? -0.5749 ? -0.2997 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? ? A 136 ? ? ;chain 'A' and (resid 1 through 136 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 137 ? ? ? A 265 ? ? ;chain 'A' and (resid 137 through 265 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 266 ? ? ? A 341 ? ? ;chain 'A' and (resid 266 through 341 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6XH9 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OH _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 TYR _pdbx_validate_symm_contact.auth_seq_id_1 18 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OH _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 TYR _pdbx_validate_symm_contact.auth_seq_id_2 18 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 11_655 _pdbx_validate_symm_contact.dist 1.99 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 13 ? ? -160.19 113.91 2 1 TYR A 142 ? ? -98.02 57.83 3 1 ASP A 172 ? ? -96.24 33.75 4 1 SER A 280 ? ? -129.91 -110.42 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 12 ? CG ? A ARG 12 CG 2 1 Y 1 A ARG 12 ? CD ? A ARG 12 CD 3 1 Y 1 A ARG 12 ? NE ? A ARG 12 NE 4 1 Y 1 A ARG 12 ? CZ ? A ARG 12 CZ 5 1 Y 1 A ARG 12 ? NH1 ? A ARG 12 NH1 6 1 Y 1 A ARG 12 ? NH2 ? A ARG 12 NH2 7 1 Y 1 A ARG 43 ? CG ? A ARG 43 CG 8 1 Y 1 A ARG 43 ? CD ? A ARG 43 CD 9 1 Y 1 A ARG 43 ? NE ? A ARG 43 NE 10 1 Y 1 A ARG 43 ? CZ ? A ARG 43 CZ 11 1 Y 1 A ARG 43 ? NH1 ? A ARG 43 NH1 12 1 Y 1 A ARG 43 ? NH2 ? A ARG 43 NH2 13 1 Y 1 A LYS 57 ? CG ? A LYS 57 CG 14 1 Y 1 A LYS 57 ? CD ? A LYS 57 CD 15 1 Y 1 A LYS 57 ? CE ? A LYS 57 CE 16 1 Y 1 A LYS 57 ? NZ ? A LYS 57 NZ 17 1 Y 1 A LEU 58 ? CG ? A LEU 58 CG 18 1 Y 1 A LEU 58 ? CD1 ? A LEU 58 CD1 19 1 Y 1 A LEU 58 ? CD2 ? A LEU 58 CD2 20 1 Y 1 A LYS 75 ? CG ? A LYS 75 CG 21 1 Y 1 A LYS 75 ? CD ? A LYS 75 CD 22 1 Y 1 A LYS 75 ? CE ? A LYS 75 CE 23 1 Y 1 A LYS 75 ? NZ ? A LYS 75 NZ 24 1 Y 1 A LYS 83 ? CG ? A LYS 83 CG 25 1 Y 1 A LYS 83 ? CD ? A LYS 83 CD 26 1 Y 1 A LYS 83 ? CE ? A LYS 83 CE 27 1 Y 1 A LYS 83 ? NZ ? A LYS 83 NZ 28 1 Y 1 A ARG 127 ? CG ? A ARG 127 CG 29 1 Y 1 A ARG 127 ? CD ? A ARG 127 CD 30 1 Y 1 A ARG 127 ? NE ? A ARG 127 NE 31 1 Y 1 A ARG 127 ? CZ ? A ARG 127 CZ 32 1 Y 1 A ARG 127 ? NH1 ? A ARG 127 NH1 33 1 Y 1 A ARG 127 ? NH2 ? A ARG 127 NH2 34 1 Y 1 A LYS 158 ? CG ? A LYS 158 CG 35 1 Y 1 A LYS 158 ? CD ? A LYS 158 CD 36 1 Y 1 A LYS 158 ? CE ? A LYS 158 CE 37 1 Y 1 A LYS 158 ? NZ ? A LYS 158 NZ 38 1 Y 1 A LYS 159 ? CG ? A LYS 159 CG 39 1 Y 1 A LYS 159 ? CD ? A LYS 159 CD 40 1 Y 1 A LYS 159 ? CE ? A LYS 159 CE 41 1 Y 1 A LYS 159 ? NZ ? A LYS 159 NZ 42 1 Y 1 A ASN 163 ? CG ? A ASN 163 CG 43 1 Y 1 A ASN 163 ? OD1 ? A ASN 163 OD1 44 1 Y 1 A ASN 163 ? ND2 ? A ASN 163 ND2 45 1 Y 1 A LYS 164 ? CG ? A LYS 164 CG 46 1 Y 1 A LYS 164 ? CD ? A LYS 164 CD 47 1 Y 1 A LYS 164 ? CE ? A LYS 164 CE 48 1 Y 1 A LYS 164 ? NZ ? A LYS 164 NZ 49 1 Y 1 A LYS 185 ? CG ? A LYS 185 CG 50 1 Y 1 A LYS 185 ? CD ? A LYS 185 CD 51 1 Y 1 A LYS 185 ? CE ? A LYS 185 CE 52 1 Y 1 A LYS 185 ? NZ ? A LYS 185 NZ 53 1 Y 1 A GLU 189 ? CG ? A GLU 189 CG 54 1 Y 1 A GLU 189 ? CD ? A GLU 189 CD 55 1 Y 1 A GLU 189 ? OE1 ? A GLU 189 OE1 56 1 Y 1 A GLU 189 ? OE2 ? A GLU 189 OE2 57 1 Y 1 A LYS 191 ? CG ? A LYS 191 CG 58 1 Y 1 A LYS 191 ? CD ? A LYS 191 CD 59 1 Y 1 A LYS 191 ? CE ? A LYS 191 CE 60 1 Y 1 A LYS 191 ? NZ ? A LYS 191 NZ 61 1 Y 1 A LYS 197 ? CG ? A LYS 197 CG 62 1 Y 1 A LYS 197 ? CD ? A LYS 197 CD 63 1 Y 1 A LYS 197 ? CE ? A LYS 197 CE 64 1 Y 1 A LYS 197 ? NZ ? A LYS 197 NZ 65 1 Y 1 A ARG 233 ? CG ? A ARG 233 CG 66 1 Y 1 A ARG 233 ? CD ? A ARG 233 CD 67 1 Y 1 A ARG 233 ? NE ? A ARG 233 NE 68 1 Y 1 A ARG 233 ? CZ ? A ARG 233 CZ 69 1 Y 1 A ARG 233 ? NH1 ? A ARG 233 NH1 70 1 Y 1 A ARG 233 ? NH2 ? A ARG 233 NH2 71 1 Y 1 A ARG 267 ? CG ? A ARG 267 CG 72 1 Y 1 A ARG 267 ? CD ? A ARG 267 CD 73 1 Y 1 A ARG 267 ? NE ? A ARG 267 NE 74 1 Y 1 A ARG 267 ? CZ ? A ARG 267 CZ 75 1 Y 1 A ARG 267 ? NH1 ? A ARG 267 NH1 76 1 Y 1 A ARG 267 ? NH2 ? A ARG 267 NH2 77 1 Y 1 A ARG 281 ? CG ? A ARG 281 CG 78 1 Y 1 A ARG 281 ? CD ? A ARG 281 CD 79 1 Y 1 A ARG 281 ? NE ? A ARG 281 NE 80 1 Y 1 A ARG 281 ? CZ ? A ARG 281 CZ 81 1 Y 1 A ARG 281 ? NH1 ? A ARG 281 NH1 82 1 Y 1 A ARG 281 ? NH2 ? A ARG 281 NH2 83 1 Y 1 A LYS 285 ? CG ? A LYS 285 CG 84 1 Y 1 A LYS 285 ? CD ? A LYS 285 CD 85 1 Y 1 A LYS 285 ? CE ? A LYS 285 CE 86 1 Y 1 A LYS 285 ? NZ ? A LYS 285 NZ 87 1 Y 1 A LYS 303 ? CG ? A LYS 303 CG 88 1 Y 1 A LYS 303 ? CD ? A LYS 303 CD 89 1 Y 1 A LYS 303 ? CE ? A LYS 303 CE 90 1 Y 1 A LYS 303 ? NZ ? A LYS 303 NZ 91 1 Y 1 A LYS 308 ? CG ? A LYS 308 CG 92 1 Y 1 A LYS 308 ? CD ? A LYS 308 CD 93 1 Y 1 A LYS 308 ? CE ? A LYS 308 CE 94 1 Y 1 A LYS 308 ? NZ ? A LYS 308 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 48 ? A SER 48 2 1 Y 1 A ARG 49 ? A ARG 49 3 1 Y 1 A ASP 50 ? A ASP 50 4 1 Y 1 A GLU 51 ? A GLU 51 5 1 Y 1 A ASN 52 ? A ASN 52 6 1 Y 1 A VAL 53 ? A VAL 53 7 1 Y 1 A LEU 54 ? A LEU 54 8 1 Y 1 A SER 55 ? A SER 55 9 1 Y 1 A GLN 56 ? A GLN 56 10 1 Y 1 A THR 92 ? A THR 92 11 1 Y 1 A GLU 93 ? A GLU 93 12 1 Y 1 A LYS 94 ? A LYS 94 13 1 Y 1 A ASP 95 ? A ASP 95 14 1 Y 1 A ASP 96 ? A ASP 96 15 1 Y 1 A VAL 97 ? A VAL 97 16 1 Y 1 A ILE 98 ? A ILE 98 17 1 Y 1 A ALA 99 ? A ALA 99 18 1 Y 1 A GLU 100 ? A GLU 100 19 1 Y 1 A ASN 101 ? A ASN 101 20 1 Y 1 A TYR 102 ? A TYR 102 21 1 Y 1 A LEU 103 ? A LEU 103 22 1 Y 1 A LYS 104 ? A LYS 104 23 1 Y 1 A SER 105 ? A SER 105 24 1 Y 1 A SER 106 ? A SER 106 25 1 Y 1 A TYR 107 ? A TYR 107 26 1 Y 1 A PHE 108 ? A PHE 108 27 1 Y 1 A ARG 109 ? A ARG 109 28 1 Y 1 A SER 110 ? A SER 110 29 1 Y 1 A SER 111 ? A SER 111 30 1 Y 1 A GLY 112 ? A GLY 112 31 1 Y 1 A HIS 113 ? A HIS 113 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CME N N N N 74 CME CA C N R 75 CME CB C N N 76 CME SG S N N 77 CME SD S N N 78 CME CE C N N 79 CME CZ C N N 80 CME OH O N N 81 CME C C N N 82 CME O O N N 83 CME OXT O N N 84 CME H H N N 85 CME H2 H N N 86 CME HA H N N 87 CME HB2 H N N 88 CME HB3 H N N 89 CME HE2 H N N 90 CME HE3 H N N 91 CME HZ2 H N N 92 CME HZ3 H N N 93 CME HH H N N 94 CME HXT H N N 95 CYS N N N N 96 CYS CA C N R 97 CYS C C N N 98 CYS O O N N 99 CYS CB C N N 100 CYS SG S N N 101 CYS OXT O N N 102 CYS H H N N 103 CYS H2 H N N 104 CYS HA H N N 105 CYS HB2 H N N 106 CYS HB3 H N N 107 CYS HG H N N 108 CYS HXT H N N 109 GLN N N N N 110 GLN CA C N S 111 GLN C C N N 112 GLN O O N N 113 GLN CB C N N 114 GLN CG C N N 115 GLN CD C N N 116 GLN OE1 O N N 117 GLN NE2 N N N 118 GLN OXT O N N 119 GLN H H N N 120 GLN H2 H N N 121 GLN HA H N N 122 GLN HB2 H N N 123 GLN HB3 H N N 124 GLN HG2 H N N 125 GLN HG3 H N N 126 GLN HE21 H N N 127 GLN HE22 H N N 128 GLN HXT H N N 129 GLU N N N N 130 GLU CA C N S 131 GLU C C N N 132 GLU O O N N 133 GLU CB C N N 134 GLU CG C N N 135 GLU CD C N N 136 GLU OE1 O N N 137 GLU OE2 O N N 138 GLU OXT O N N 139 GLU H H N N 140 GLU H2 H N N 141 GLU HA H N N 142 GLU HB2 H N N 143 GLU HB3 H N N 144 GLU HG2 H N N 145 GLU HG3 H N N 146 GLU HE2 H N N 147 GLU HXT H N N 148 GLY N N N N 149 GLY CA C N N 150 GLY C C N N 151 GLY O O N N 152 GLY OXT O N N 153 GLY H H N N 154 GLY H2 H N N 155 GLY HA2 H N N 156 GLY HA3 H N N 157 GLY HXT H N N 158 HIS N N N N 159 HIS CA C N S 160 HIS C C N N 161 HIS O O N N 162 HIS CB C N N 163 HIS CG C Y N 164 HIS ND1 N Y N 165 HIS CD2 C Y N 166 HIS CE1 C Y N 167 HIS NE2 N Y N 168 HIS OXT O N N 169 HIS H H N N 170 HIS H2 H N N 171 HIS HA H N N 172 HIS HB2 H N N 173 HIS HB3 H N N 174 HIS HD1 H N N 175 HIS HD2 H N N 176 HIS HE1 H N N 177 HIS HE2 H N N 178 HIS HXT H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CME N CA sing N N 70 CME N H sing N N 71 CME N H2 sing N N 72 CME CA CB sing N N 73 CME CA C sing N N 74 CME CA HA sing N N 75 CME CB SG sing N N 76 CME CB HB2 sing N N 77 CME CB HB3 sing N N 78 CME SG SD sing N N 79 CME SD CE sing N N 80 CME CE CZ sing N N 81 CME CE HE2 sing N N 82 CME CE HE3 sing N N 83 CME CZ OH sing N N 84 CME CZ HZ2 sing N N 85 CME CZ HZ3 sing N N 86 CME OH HH sing N N 87 CME C O doub N N 88 CME C OXT sing N N 89 CME OXT HXT sing N N 90 CYS N CA sing N N 91 CYS N H sing N N 92 CYS N H2 sing N N 93 CYS CA C sing N N 94 CYS CA CB sing N N 95 CYS CA HA sing N N 96 CYS C O doub N N 97 CYS C OXT sing N N 98 CYS CB SG sing N N 99 CYS CB HB2 sing N N 100 CYS CB HB3 sing N N 101 CYS SG HG sing N N 102 CYS OXT HXT sing N N 103 GLN N CA sing N N 104 GLN N H sing N N 105 GLN N H2 sing N N 106 GLN CA C sing N N 107 GLN CA CB sing N N 108 GLN CA HA sing N N 109 GLN C O doub N N 110 GLN C OXT sing N N 111 GLN CB CG sing N N 112 GLN CB HB2 sing N N 113 GLN CB HB3 sing N N 114 GLN CG CD sing N N 115 GLN CG HG2 sing N N 116 GLN CG HG3 sing N N 117 GLN CD OE1 doub N N 118 GLN CD NE2 sing N N 119 GLN NE2 HE21 sing N N 120 GLN NE2 HE22 sing N N 121 GLN OXT HXT sing N N 122 GLU N CA sing N N 123 GLU N H sing N N 124 GLU N H2 sing N N 125 GLU CA C sing N N 126 GLU CA CB sing N N 127 GLU CA HA sing N N 128 GLU C O doub N N 129 GLU C OXT sing N N 130 GLU CB CG sing N N 131 GLU CB HB2 sing N N 132 GLU CB HB3 sing N N 133 GLU CG CD sing N N 134 GLU CG HG2 sing N N 135 GLU CG HG3 sing N N 136 GLU CD OE1 doub N N 137 GLU CD OE2 sing N N 138 GLU OE2 HE2 sing N N 139 GLU OXT HXT sing N N 140 GLY N CA sing N N 141 GLY N H sing N N 142 GLY N H2 sing N N 143 GLY CA C sing N N 144 GLY CA HA2 sing N N 145 GLY CA HA3 sing N N 146 GLY C O doub N N 147 GLY C OXT sing N N 148 GLY OXT HXT sing N N 149 HIS N CA sing N N 150 HIS N H sing N N 151 HIS N H2 sing N N 152 HIS CA C sing N N 153 HIS CA CB sing N N 154 HIS CA HA sing N N 155 HIS C O doub N N 156 HIS C OXT sing N N 157 HIS CB CG sing N N 158 HIS CB HB2 sing N N 159 HIS CB HB3 sing N N 160 HIS CG ND1 sing Y N 161 HIS CG CD2 doub Y N 162 HIS ND1 CE1 doub Y N 163 HIS ND1 HD1 sing N N 164 HIS CD2 NE2 sing Y N 165 HIS CD2 HD2 sing N N 166 HIS CE1 NE2 sing Y N 167 HIS CE1 HE1 sing N N 168 HIS NE2 HE2 sing N N 169 HIS OXT HXT sing N N 170 ILE N CA sing N N 171 ILE N H sing N N 172 ILE N H2 sing N N 173 ILE CA C sing N N 174 ILE CA CB sing N N 175 ILE CA HA sing N N 176 ILE C O doub N N 177 ILE C OXT sing N N 178 ILE CB CG1 sing N N 179 ILE CB CG2 sing N N 180 ILE CB HB sing N N 181 ILE CG1 CD1 sing N N 182 ILE CG1 HG12 sing N N 183 ILE CG1 HG13 sing N N 184 ILE CG2 HG21 sing N N 185 ILE CG2 HG22 sing N N 186 ILE CG2 HG23 sing N N 187 ILE CD1 HD11 sing N N 188 ILE CD1 HD12 sing N N 189 ILE CD1 HD13 sing N N 190 ILE OXT HXT sing N N 191 LEU N CA sing N N 192 LEU N H sing N N 193 LEU N H2 sing N N 194 LEU CA C sing N N 195 LEU CA CB sing N N 196 LEU CA HA sing N N 197 LEU C O doub N N 198 LEU C OXT sing N N 199 LEU CB CG sing N N 200 LEU CB HB2 sing N N 201 LEU CB HB3 sing N N 202 LEU CG CD1 sing N N 203 LEU CG CD2 sing N N 204 LEU CG HG sing N N 205 LEU CD1 HD11 sing N N 206 LEU CD1 HD12 sing N N 207 LEU CD1 HD13 sing N N 208 LEU CD2 HD21 sing N N 209 LEU CD2 HD22 sing N N 210 LEU CD2 HD23 sing N N 211 LEU OXT HXT sing N N 212 LYS N CA sing N N 213 LYS N H sing N N 214 LYS N H2 sing N N 215 LYS CA C sing N N 216 LYS CA CB sing N N 217 LYS CA HA sing N N 218 LYS C O doub N N 219 LYS C OXT sing N N 220 LYS CB CG sing N N 221 LYS CB HB2 sing N N 222 LYS CB HB3 sing N N 223 LYS CG CD sing N N 224 LYS CG HG2 sing N N 225 LYS CG HG3 sing N N 226 LYS CD CE sing N N 227 LYS CD HD2 sing N N 228 LYS CD HD3 sing N N 229 LYS CE NZ sing N N 230 LYS CE HE2 sing N N 231 LYS CE HE3 sing N N 232 LYS NZ HZ1 sing N N 233 LYS NZ HZ2 sing N N 234 LYS NZ HZ3 sing N N 235 LYS OXT HXT sing N N 236 MET N CA sing N N 237 MET N H sing N N 238 MET N H2 sing N N 239 MET CA C sing N N 240 MET CA CB sing N N 241 MET CA HA sing N N 242 MET C O doub N N 243 MET C OXT sing N N 244 MET CB CG sing N N 245 MET CB HB2 sing N N 246 MET CB HB3 sing N N 247 MET CG SD sing N N 248 MET CG HG2 sing N N 249 MET CG HG3 sing N N 250 MET SD CE sing N N 251 MET CE HE1 sing N N 252 MET CE HE2 sing N N 253 MET CE HE3 sing N N 254 MET OXT HXT sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Canadian Institutes of Health Research (CIHR)' Canada ? 1 'Howard Hughes Medical Institute (HHMI)' Canada ? 2 'Natural Sciences and Engineering Research Council (NSERC, Canada)' Canada ? 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ILK _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #