data_6XJK # _entry.id 6XJK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6XJK pdb_00006xjk 10.2210/pdb6xjk/pdb WWPDB D_1000250270 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6XJK _pdbx_database_status.recvd_initial_deposition_date 2020-06-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Puleo, D.E.' 1 ? 'Krimmer, S.G.' 2 ? 'Newton, A.S.' 3 ? 'Schlessinger, J.' 4 0000-0002-5085-5969 'Jorgensen, W.L.' 5 0000-0002-3993-9520 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Chem Theory Comput' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1549-9626 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 7184 _citation.page_last 7194 _citation.title 'Explicit Representation of Cation-pi Interactions in Force Fields with 1/r4 Nonbonded Terms.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jctc.0c00847 _citation.pdbx_database_id_PubMed 33048555 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Turupcu, A.' 1 ? primary 'Tirado-Rives, J.' 2 0000-0001-7330-189X primary 'Jorgensen, W.L.' 3 0000-0002-3993-9520 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 111.454 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6XJK _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.043 _cell.length_a_esd ? _cell.length_b 57.633 _cell.length_b_esd ? _cell.length_c 61.175 _cell.length_c_esd ? _cell.volume 147804.481 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6XJK _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase JAK2' 33120.961 1 2.7.10.2 'W659A, W777A, F794H' ? ? 2 non-polymer syn '4-({4-amino-6-[(1H-indol-5-yl)oxy]-1,3,5-triazin-2-yl}amino)benzene-1-sulfonamide' 397.411 1 ? ? ? ? 3 water nat water 18.015 62 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Janus kinase 2,JAK-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGV CVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFI KLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAP KAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDLVPRGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGV CVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFI KLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAP KAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDLVPRGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PHE n 1 3 HIS n 1 4 LYS n 1 5 ILE n 1 6 ARG n 1 7 ASN n 1 8 GLU n 1 9 ASP n 1 10 LEU n 1 11 ILE n 1 12 PHE n 1 13 ASN n 1 14 GLU n 1 15 SER n 1 16 LEU n 1 17 GLY n 1 18 GLN n 1 19 GLY n 1 20 THR n 1 21 PHE n 1 22 THR n 1 23 LYS n 1 24 ILE n 1 25 PHE n 1 26 LYS n 1 27 GLY n 1 28 VAL n 1 29 ARG n 1 30 ARG n 1 31 GLU n 1 32 VAL n 1 33 GLY n 1 34 ASP n 1 35 TYR n 1 36 GLY n 1 37 GLN n 1 38 LEU n 1 39 HIS n 1 40 GLU n 1 41 THR n 1 42 GLU n 1 43 VAL n 1 44 LEU n 1 45 LEU n 1 46 LYS n 1 47 VAL n 1 48 LEU n 1 49 ASP n 1 50 LYS n 1 51 ALA n 1 52 HIS n 1 53 ARG n 1 54 ASN n 1 55 TYR n 1 56 SER n 1 57 GLU n 1 58 SER n 1 59 PHE n 1 60 PHE n 1 61 GLU n 1 62 ALA n 1 63 ALA n 1 64 SER n 1 65 MET n 1 66 MET n 1 67 SER n 1 68 LYS n 1 69 LEU n 1 70 SER n 1 71 HIS n 1 72 LYS n 1 73 HIS n 1 74 LEU n 1 75 VAL n 1 76 LEU n 1 77 ASN n 1 78 TYR n 1 79 GLY n 1 80 VAL n 1 81 CYS n 1 82 VAL n 1 83 CYS n 1 84 GLY n 1 85 ASP n 1 86 GLU n 1 87 ASN n 1 88 ILE n 1 89 LEU n 1 90 VAL n 1 91 GLN n 1 92 GLU n 1 93 PHE n 1 94 VAL n 1 95 LYS n 1 96 PHE n 1 97 GLY n 1 98 SER n 1 99 LEU n 1 100 ASP n 1 101 THR n 1 102 TYR n 1 103 LEU n 1 104 LYS n 1 105 LYS n 1 106 ASN n 1 107 LYS n 1 108 ASN n 1 109 CYS n 1 110 ILE n 1 111 ASN n 1 112 ILE n 1 113 LEU n 1 114 TRP n 1 115 LYS n 1 116 LEU n 1 117 GLU n 1 118 VAL n 1 119 ALA n 1 120 LYS n 1 121 GLN n 1 122 LEU n 1 123 ALA n 1 124 ALA n 1 125 ALA n 1 126 MET n 1 127 HIS n 1 128 PHE n 1 129 LEU n 1 130 GLU n 1 131 GLU n 1 132 ASN n 1 133 THR n 1 134 LEU n 1 135 ILE n 1 136 HIS n 1 137 GLY n 1 138 ASN n 1 139 VAL n 1 140 CYS n 1 141 ALA n 1 142 LYS n 1 143 ASN n 1 144 ILE n 1 145 LEU n 1 146 LEU n 1 147 ILE n 1 148 ARG n 1 149 GLU n 1 150 GLU n 1 151 ASP n 1 152 ARG n 1 153 LYS n 1 154 THR n 1 155 GLY n 1 156 ASN n 1 157 PRO n 1 158 PRO n 1 159 PHE n 1 160 ILE n 1 161 LYS n 1 162 LEU n 1 163 SER n 1 164 ASP n 1 165 PRO n 1 166 GLY n 1 167 ILE n 1 168 SER n 1 169 ILE n 1 170 THR n 1 171 VAL n 1 172 LEU n 1 173 PRO n 1 174 LYS n 1 175 ASP n 1 176 ILE n 1 177 LEU n 1 178 GLN n 1 179 GLU n 1 180 ARG n 1 181 ILE n 1 182 PRO n 1 183 TRP n 1 184 VAL n 1 185 PRO n 1 186 PRO n 1 187 GLU n 1 188 CYS n 1 189 ILE n 1 190 GLU n 1 191 ASN n 1 192 PRO n 1 193 LYS n 1 194 ASN n 1 195 LEU n 1 196 ASN n 1 197 LEU n 1 198 ALA n 1 199 THR n 1 200 ASP n 1 201 LYS n 1 202 TRP n 1 203 SER n 1 204 PHE n 1 205 GLY n 1 206 THR n 1 207 THR n 1 208 LEU n 1 209 TRP n 1 210 GLU n 1 211 ILE n 1 212 CYS n 1 213 SER n 1 214 GLY n 1 215 GLY n 1 216 ASP n 1 217 LYS n 1 218 PRO n 1 219 LEU n 1 220 SER n 1 221 ALA n 1 222 LEU n 1 223 ASP n 1 224 SER n 1 225 GLN n 1 226 ARG n 1 227 LYS n 1 228 LEU n 1 229 GLN n 1 230 PHE n 1 231 TYR n 1 232 GLU n 1 233 ASP n 1 234 ARG n 1 235 HIS n 1 236 GLN n 1 237 LEU n 1 238 PRO n 1 239 ALA n 1 240 PRO n 1 241 LYS n 1 242 ALA n 1 243 ALA n 1 244 GLU n 1 245 LEU n 1 246 ALA n 1 247 ASN n 1 248 LEU n 1 249 ILE n 1 250 ASN n 1 251 ASN n 1 252 CYS n 1 253 MET n 1 254 ASP n 1 255 TYR n 1 256 GLU n 1 257 PRO n 1 258 ASP n 1 259 HIS n 1 260 ARG n 1 261 PRO n 1 262 SER n 1 263 PHE n 1 264 ARG n 1 265 ALA n 1 266 ILE n 1 267 ILE n 1 268 ARG n 1 269 ASP n 1 270 LEU n 1 271 ASN n 1 272 SER n 1 273 LEU n 1 274 PHE n 1 275 THR n 1 276 PRO n 1 277 ASP n 1 278 LEU n 1 279 VAL n 1 280 PRO n 1 281 ARG n 1 282 GLY n 1 283 SER n 1 284 HIS n 1 285 HIS n 1 286 HIS n 1 287 HIS n 1 288 HIS n 1 289 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 289 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene JAK2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code JAK2_HUMAN _struct_ref.pdbx_db_accession O60674 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGV CVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFI KLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAP KWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPD ; _struct_ref.pdbx_align_begin 536 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6XJK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 277 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O60674 _struct_ref_seq.db_align_beg 536 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 812 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 536 _struct_ref_seq.pdbx_auth_seq_align_end 812 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6XJK ALA A 124 ? UNP O60674 TRP 659 'engineered mutation' 659 1 1 6XJK ALA A 242 ? UNP O60674 TRP 777 'engineered mutation' 777 2 1 6XJK HIS A 259 ? UNP O60674 PHE 794 'engineered mutation' 794 3 1 6XJK LEU A 278 ? UNP O60674 ? ? 'expression tag' 813 4 1 6XJK VAL A 279 ? UNP O60674 ? ? 'expression tag' 814 5 1 6XJK PRO A 280 ? UNP O60674 ? ? 'expression tag' 815 6 1 6XJK ARG A 281 ? UNP O60674 ? ? 'expression tag' 816 7 1 6XJK GLY A 282 ? UNP O60674 ? ? 'expression tag' 817 8 1 6XJK SER A 283 ? UNP O60674 ? ? 'expression tag' 818 9 1 6XJK HIS A 284 ? UNP O60674 ? ? 'expression tag' 819 10 1 6XJK HIS A 285 ? UNP O60674 ? ? 'expression tag' 820 11 1 6XJK HIS A 286 ? UNP O60674 ? ? 'expression tag' 821 12 1 6XJK HIS A 287 ? UNP O60674 ? ? 'expression tag' 822 13 1 6XJK HIS A 288 ? UNP O60674 ? ? 'expression tag' 823 14 1 6XJK HIS A 289 ? UNP O60674 ? ? 'expression tag' 824 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 V4D non-polymer . '4-({4-amino-6-[(1H-indol-5-yl)oxy]-1,3,5-triazin-2-yl}amino)benzene-1-sulfonamide' ? 'C17 H15 N7 O3 S' 397.411 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6XJK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M TRIS, PH 8.0 0.2M SODIUM ACETATE, 0.001 M TCEP, 12-24% PEG 4,000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 23.8164219343 _reflns.entry_id 6XJK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.02 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18548 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.9 _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.140 _reflns.pdbx_Rpim_I_all 0.079 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.9295 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.02 _reflns_shell.d_res_low 2.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.07 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 922 _reflns_shell.percent_possible_all 96.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.545 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.382 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.734 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 28.526027831 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6XJK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.02350796538 _refine.ls_d_res_low 40.5041093696 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18342 _refine.ls_number_reflns_R_free 923 _refine.ls_number_reflns_R_work 17419 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.660790654 _refine.ls_percent_reflns_R_free 5.03216661215 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.229481521976 _refine.ls_R_factor_R_free 0.272510925489 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22727044529 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33532374233 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5usz _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.0054300272 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.258905595545 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.02350796538 _refine_hist.d_res_low 40.5041093696 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 2074 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1984 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00711609176058 ? 2061 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.811580261873 ? 2817 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.050838195421 ? 323 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00500134976265 ? 393 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.1513387005 ? 1234 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.02350796538 2.1302 . . 153 2425 95.094061232 . . . 0.293952447335 . 0.263717288318 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1302 2.2636 . . 153 2510 97.4743777452 . . . 0.246894775624 . 0.227807856146 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2636 2.4384 . . 135 2508 97.3480662983 . . . 0.320374486804 . 0.229868146983 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4384 2.6837 . . 123 2525 96.8190127971 . . . 0.308779794023 . 0.264460412209 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6837 3.072 . . 107 2397 91.8899082569 . . . 0.325497165254 . 0.304214746326 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.072 3.8699 . . 137 2533 96.6690803765 . . . 0.267235529656 . 0.209925551081 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8699 40.5041093696 . . 115 2521 94.3450250537 . . . 0.236039394637 . 0.194219049784 . . . . . . . . . . . # _struct.entry_id 6XJK _struct.title 'JAK2 JH2 in complex with JAK067' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6XJK _struct_keywords.text 'PSEUDOKINASE DOMAIN, INHIBITOR, COMPLEX, TRANSFERASE, TRANSFERASE-INHIBITOR COMPLEX' _struct_keywords.pdbx_keywords TRANSFERASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 6 ? GLU A 8 ? ARG A 541 GLU A 543 5 ? 3 HELX_P HELX_P2 AA2 ASP A 34 ? GLY A 36 ? ASP A 569 GLY A 571 5 ? 3 HELX_P HELX_P3 AA3 LYS A 50 ? ASN A 54 ? LYS A 585 ASN A 589 5 ? 5 HELX_P HELX_P4 AA4 TYR A 55 ? LYS A 68 ? TYR A 590 LYS A 603 1 ? 14 HELX_P HELX_P5 AA5 SER A 98 ? ASN A 106 ? SER A 633 ASN A 641 1 ? 9 HELX_P HELX_P6 AA6 LYS A 107 ? ILE A 110 ? LYS A 642 ILE A 645 5 ? 4 HELX_P HELX_P7 AA7 ASN A 111 ? ASN A 132 ? ASN A 646 ASN A 667 1 ? 22 HELX_P HELX_P8 AA8 CYS A 140 ? LYS A 142 ? CYS A 675 LYS A 677 5 ? 3 HELX_P HELX_P9 AA9 SER A 168 ? LEU A 172 ? SER A 703 LEU A 707 5 ? 5 HELX_P HELX_P10 AB1 PRO A 173 ? ARG A 180 ? PRO A 708 ARG A 715 1 ? 8 HELX_P HELX_P11 AB2 PRO A 185 ? ASN A 191 ? PRO A 720 ASN A 726 1 ? 7 HELX_P HELX_P12 AB3 PRO A 192 ? LEU A 195 ? PRO A 727 LEU A 730 5 ? 4 HELX_P HELX_P13 AB4 ASN A 196 ? SER A 213 ? ASN A 731 SER A 748 1 ? 18 HELX_P HELX_P14 AB5 ASP A 223 ? ASP A 233 ? ASP A 758 ASP A 768 1 ? 11 HELX_P HELX_P15 AB6 LEU A 245 ? MET A 253 ? LEU A 780 MET A 788 1 ? 9 HELX_P HELX_P16 AB7 GLU A 256 ? ARG A 260 ? GLU A 791 ARG A 795 5 ? 5 HELX_P HELX_P17 AB8 SER A 262 ? ASN A 271 ? SER A 797 ASN A 806 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 81 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 83 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 616 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 618 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.023 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 181 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 716 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 182 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 717 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.75 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 10 ? GLY A 19 ? LEU A 545 GLY A 554 AA1 2 THR A 22 ? VAL A 32 ? THR A 557 VAL A 567 AA1 3 LEU A 38 ? LEU A 48 ? LEU A 573 LEU A 583 AA1 4 GLU A 86 ? GLU A 92 ? GLU A 621 GLU A 627 AA1 5 ASN A 77 ? CYS A 83 ? ASN A 612 CYS A 618 AA2 1 ILE A 144 ? ARG A 148 ? ILE A 679 ARG A 683 AA2 2 PHE A 159 ? LEU A 162 ? PHE A 694 LEU A 697 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 16 ? N LEU A 551 O ILE A 24 ? O ILE A 559 AA1 2 3 N GLU A 31 ? N GLU A 566 O HIS A 39 ? O HIS A 574 AA1 3 4 N LEU A 44 ? N LEU A 579 O GLN A 91 ? O GLN A 626 AA1 4 5 O VAL A 90 ? O VAL A 625 N GLY A 79 ? N GLY A 614 AA2 1 2 N LEU A 145 ? N LEU A 680 O LYS A 161 ? O LYS A 696 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id V4D _struct_site.pdbx_auth_seq_id 901 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'binding site for residue V4D A 901' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 LEU A 44 ? LEU A 579 . ? 1_555 ? 2 AC1 15 LYS A 46 ? LYS A 581 . ? 1_555 ? 3 AC1 15 GLN A 91 ? GLN A 626 . ? 1_555 ? 4 AC1 15 GLU A 92 ? GLU A 627 . ? 1_555 ? 5 AC1 15 PHE A 93 ? PHE A 628 . ? 1_555 ? 6 AC1 15 VAL A 94 ? VAL A 629 . ? 1_555 ? 7 AC1 15 LYS A 95 ? LYS A 630 . ? 1_555 ? 8 AC1 15 GLY A 97 ? GLY A 632 . ? 1_555 ? 9 AC1 15 SER A 98 ? SER A 633 . ? 1_555 ? 10 AC1 15 LYS A 142 ? LYS A 677 . ? 1_555 ? 11 AC1 15 ASN A 143 ? ASN A 678 . ? 1_555 ? 12 AC1 15 LEU A 145 ? LEU A 680 . ? 1_555 ? 13 AC1 15 HOH C . ? HOH A 1005 . ? 1_555 ? 14 AC1 15 HOH C . ? HOH A 1053 . ? 1_555 ? 15 AC1 15 HOH C . ? HOH A 1054 . ? 1_555 ? # _atom_sites.entry_id 6XJK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022201 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008725 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017351 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017563 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 536 ? ? ? A . n A 1 2 PHE 2 537 ? ? ? A . n A 1 3 HIS 3 538 ? ? ? A . n A 1 4 LYS 4 539 539 LYS LYS A . n A 1 5 ILE 5 540 540 ILE ILE A . n A 1 6 ARG 6 541 541 ARG ARG A . n A 1 7 ASN 7 542 542 ASN ASN A . n A 1 8 GLU 8 543 543 GLU GLU A . n A 1 9 ASP 9 544 544 ASP ASP A . n A 1 10 LEU 10 545 545 LEU LEU A . n A 1 11 ILE 11 546 546 ILE ILE A . n A 1 12 PHE 12 547 547 PHE PHE A . n A 1 13 ASN 13 548 548 ASN ASN A . n A 1 14 GLU 14 549 549 GLU GLU A . n A 1 15 SER 15 550 550 SER SER A . n A 1 16 LEU 16 551 551 LEU LEU A . n A 1 17 GLY 17 552 552 GLY GLY A . n A 1 18 GLN 18 553 553 GLN GLN A . n A 1 19 GLY 19 554 554 GLY GLY A . n A 1 20 THR 20 555 555 THR THR A . n A 1 21 PHE 21 556 556 PHE PHE A . n A 1 22 THR 22 557 557 THR THR A . n A 1 23 LYS 23 558 558 LYS LYS A . n A 1 24 ILE 24 559 559 ILE ILE A . n A 1 25 PHE 25 560 560 PHE PHE A . n A 1 26 LYS 26 561 561 LYS LYS A . n A 1 27 GLY 27 562 562 GLY GLY A . n A 1 28 VAL 28 563 563 VAL VAL A . n A 1 29 ARG 29 564 564 ARG ARG A . n A 1 30 ARG 30 565 565 ARG ARG A . n A 1 31 GLU 31 566 566 GLU GLU A . n A 1 32 VAL 32 567 567 VAL VAL A . n A 1 33 GLY 33 568 568 GLY GLY A . n A 1 34 ASP 34 569 569 ASP ASP A . n A 1 35 TYR 35 570 570 TYR TYR A . n A 1 36 GLY 36 571 571 GLY GLY A . n A 1 37 GLN 37 572 572 GLN GLN A . n A 1 38 LEU 38 573 573 LEU LEU A . n A 1 39 HIS 39 574 574 HIS HIS A . n A 1 40 GLU 40 575 575 GLU GLU A . n A 1 41 THR 41 576 576 THR THR A . n A 1 42 GLU 42 577 577 GLU GLU A . n A 1 43 VAL 43 578 578 VAL VAL A . n A 1 44 LEU 44 579 579 LEU LEU A . n A 1 45 LEU 45 580 580 LEU LEU A . n A 1 46 LYS 46 581 581 LYS LYS A . n A 1 47 VAL 47 582 582 VAL VAL A . n A 1 48 LEU 48 583 583 LEU LEU A . n A 1 49 ASP 49 584 584 ASP ASP A . n A 1 50 LYS 50 585 585 LYS LYS A . n A 1 51 ALA 51 586 586 ALA ALA A . n A 1 52 HIS 52 587 587 HIS HIS A . n A 1 53 ARG 53 588 588 ARG ARG A . n A 1 54 ASN 54 589 589 ASN ASN A . n A 1 55 TYR 55 590 590 TYR TYR A . n A 1 56 SER 56 591 591 SER SER A . n A 1 57 GLU 57 592 592 GLU GLU A . n A 1 58 SER 58 593 593 SER SER A . n A 1 59 PHE 59 594 594 PHE PHE A . n A 1 60 PHE 60 595 595 PHE PHE A . n A 1 61 GLU 61 596 596 GLU GLU A . n A 1 62 ALA 62 597 597 ALA ALA A . n A 1 63 ALA 63 598 598 ALA ALA A . n A 1 64 SER 64 599 599 SER SER A . n A 1 65 MET 65 600 600 MET MET A . n A 1 66 MET 66 601 601 MET MET A . n A 1 67 SER 67 602 602 SER SER A . n A 1 68 LYS 68 603 603 LYS LYS A . n A 1 69 LEU 69 604 604 LEU LEU A . n A 1 70 SER 70 605 605 SER SER A . n A 1 71 HIS 71 606 606 HIS HIS A . n A 1 72 LYS 72 607 607 LYS LYS A . n A 1 73 HIS 73 608 608 HIS HIS A . n A 1 74 LEU 74 609 609 LEU LEU A . n A 1 75 VAL 75 610 610 VAL VAL A . n A 1 76 LEU 76 611 611 LEU LEU A . n A 1 77 ASN 77 612 612 ASN ASN A . n A 1 78 TYR 78 613 613 TYR TYR A . n A 1 79 GLY 79 614 614 GLY GLY A . n A 1 80 VAL 80 615 615 VAL VAL A . n A 1 81 CYS 81 616 616 CYS CYS A . n A 1 82 VAL 82 617 617 VAL VAL A . n A 1 83 CYS 83 618 618 CYS CYS A . n A 1 84 GLY 84 619 619 GLY GLY A . n A 1 85 ASP 85 620 620 ASP ASP A . n A 1 86 GLU 86 621 621 GLU GLU A . n A 1 87 ASN 87 622 622 ASN ASN A . n A 1 88 ILE 88 623 623 ILE ILE A . n A 1 89 LEU 89 624 624 LEU LEU A . n A 1 90 VAL 90 625 625 VAL VAL A . n A 1 91 GLN 91 626 626 GLN GLN A . n A 1 92 GLU 92 627 627 GLU GLU A . n A 1 93 PHE 93 628 628 PHE PHE A . n A 1 94 VAL 94 629 629 VAL VAL A . n A 1 95 LYS 95 630 630 LYS LYS A . n A 1 96 PHE 96 631 631 PHE PHE A . n A 1 97 GLY 97 632 632 GLY GLY A . n A 1 98 SER 98 633 633 SER SER A . n A 1 99 LEU 99 634 634 LEU LEU A . n A 1 100 ASP 100 635 635 ASP ASP A . n A 1 101 THR 101 636 636 THR THR A . n A 1 102 TYR 102 637 637 TYR TYR A . n A 1 103 LEU 103 638 638 LEU LEU A . n A 1 104 LYS 104 639 639 LYS LYS A . n A 1 105 LYS 105 640 640 LYS LYS A . n A 1 106 ASN 106 641 641 ASN ASN A . n A 1 107 LYS 107 642 642 LYS LYS A . n A 1 108 ASN 108 643 643 ASN ASN A . n A 1 109 CYS 109 644 644 CYS CYS A . n A 1 110 ILE 110 645 645 ILE ILE A . n A 1 111 ASN 111 646 646 ASN ASN A . n A 1 112 ILE 112 647 647 ILE ILE A . n A 1 113 LEU 113 648 648 LEU LEU A . n A 1 114 TRP 114 649 649 TRP TRP A . n A 1 115 LYS 115 650 650 LYS LYS A . n A 1 116 LEU 116 651 651 LEU LEU A . n A 1 117 GLU 117 652 652 GLU GLU A . n A 1 118 VAL 118 653 653 VAL VAL A . n A 1 119 ALA 119 654 654 ALA ALA A . n A 1 120 LYS 120 655 655 LYS LYS A . n A 1 121 GLN 121 656 656 GLN GLN A . n A 1 122 LEU 122 657 657 LEU LEU A . n A 1 123 ALA 123 658 658 ALA ALA A . n A 1 124 ALA 124 659 659 ALA ALA A . n A 1 125 ALA 125 660 660 ALA ALA A . n A 1 126 MET 126 661 661 MET MET A . n A 1 127 HIS 127 662 662 HIS HIS A . n A 1 128 PHE 128 663 663 PHE PHE A . n A 1 129 LEU 129 664 664 LEU LEU A . n A 1 130 GLU 130 665 665 GLU GLU A . n A 1 131 GLU 131 666 666 GLU GLU A . n A 1 132 ASN 132 667 667 ASN ASN A . n A 1 133 THR 133 668 668 THR THR A . n A 1 134 LEU 134 669 669 LEU LEU A . n A 1 135 ILE 135 670 670 ILE ILE A . n A 1 136 HIS 136 671 671 HIS HIS A . n A 1 137 GLY 137 672 672 GLY GLY A . n A 1 138 ASN 138 673 673 ASN ASN A . n A 1 139 VAL 139 674 674 VAL VAL A . n A 1 140 CYS 140 675 675 CYS CYS A . n A 1 141 ALA 141 676 676 ALA ALA A . n A 1 142 LYS 142 677 677 LYS LYS A . n A 1 143 ASN 143 678 678 ASN ASN A . n A 1 144 ILE 144 679 679 ILE ILE A . n A 1 145 LEU 145 680 680 LEU LEU A . n A 1 146 LEU 146 681 681 LEU LEU A . n A 1 147 ILE 147 682 682 ILE ILE A . n A 1 148 ARG 148 683 683 ARG ARG A . n A 1 149 GLU 149 684 684 GLU GLU A . n A 1 150 GLU 150 685 685 GLU GLU A . n A 1 151 ASP 151 686 686 ASP ASP A . n A 1 152 ARG 152 687 ? ? ? A . n A 1 153 LYS 153 688 ? ? ? A . n A 1 154 THR 154 689 ? ? ? A . n A 1 155 GLY 155 690 ? ? ? A . n A 1 156 ASN 156 691 691 ASN ASN A . n A 1 157 PRO 157 692 692 PRO PRO A . n A 1 158 PRO 158 693 693 PRO PRO A . n A 1 159 PHE 159 694 694 PHE PHE A . n A 1 160 ILE 160 695 695 ILE ILE A . n A 1 161 LYS 161 696 696 LYS LYS A . n A 1 162 LEU 162 697 697 LEU LEU A . n A 1 163 SER 163 698 698 SER SER A . n A 1 164 ASP 164 699 699 ASP ASP A . n A 1 165 PRO 165 700 700 PRO PRO A . n A 1 166 GLY 166 701 701 GLY GLY A . n A 1 167 ILE 167 702 702 ILE ILE A . n A 1 168 SER 168 703 703 SER SER A . n A 1 169 ILE 169 704 704 ILE ILE A . n A 1 170 THR 170 705 705 THR THR A . n A 1 171 VAL 171 706 706 VAL VAL A . n A 1 172 LEU 172 707 707 LEU LEU A . n A 1 173 PRO 173 708 708 PRO PRO A . n A 1 174 LYS 174 709 709 LYS LYS A . n A 1 175 ASP 175 710 710 ASP ASP A . n A 1 176 ILE 176 711 711 ILE ILE A . n A 1 177 LEU 177 712 712 LEU LEU A . n A 1 178 GLN 178 713 713 GLN GLN A . n A 1 179 GLU 179 714 714 GLU GLU A . n A 1 180 ARG 180 715 715 ARG ARG A . n A 1 181 ILE 181 716 716 ILE ILE A . n A 1 182 PRO 182 717 717 PRO PRO A . n A 1 183 TRP 183 718 718 TRP TRP A . n A 1 184 VAL 184 719 719 VAL VAL A . n A 1 185 PRO 185 720 720 PRO PRO A . n A 1 186 PRO 186 721 721 PRO PRO A . n A 1 187 GLU 187 722 722 GLU GLU A . n A 1 188 CYS 188 723 723 CYS CYS A . n A 1 189 ILE 189 724 724 ILE ILE A . n A 1 190 GLU 190 725 725 GLU GLU A . n A 1 191 ASN 191 726 726 ASN ASN A . n A 1 192 PRO 192 727 727 PRO PRO A . n A 1 193 LYS 193 728 728 LYS LYS A . n A 1 194 ASN 194 729 729 ASN ASN A . n A 1 195 LEU 195 730 730 LEU LEU A . n A 1 196 ASN 196 731 731 ASN ASN A . n A 1 197 LEU 197 732 732 LEU LEU A . n A 1 198 ALA 198 733 733 ALA ALA A . n A 1 199 THR 199 734 734 THR THR A . n A 1 200 ASP 200 735 735 ASP ASP A . n A 1 201 LYS 201 736 736 LYS LYS A . n A 1 202 TRP 202 737 737 TRP TRP A . n A 1 203 SER 203 738 738 SER SER A . n A 1 204 PHE 204 739 739 PHE PHE A . n A 1 205 GLY 205 740 740 GLY GLY A . n A 1 206 THR 206 741 741 THR THR A . n A 1 207 THR 207 742 742 THR THR A . n A 1 208 LEU 208 743 743 LEU LEU A . n A 1 209 TRP 209 744 744 TRP TRP A . n A 1 210 GLU 210 745 745 GLU GLU A . n A 1 211 ILE 211 746 746 ILE ILE A . n A 1 212 CYS 212 747 747 CYS CYS A . n A 1 213 SER 213 748 748 SER SER A . n A 1 214 GLY 214 749 749 GLY GLY A . n A 1 215 GLY 215 750 750 GLY GLY A . n A 1 216 ASP 216 751 751 ASP ASP A . n A 1 217 LYS 217 752 752 LYS LYS A . n A 1 218 PRO 218 753 753 PRO PRO A . n A 1 219 LEU 219 754 754 LEU LEU A . n A 1 220 SER 220 755 755 SER SER A . n A 1 221 ALA 221 756 756 ALA ALA A . n A 1 222 LEU 222 757 757 LEU LEU A . n A 1 223 ASP 223 758 758 ASP ASP A . n A 1 224 SER 224 759 759 SER SER A . n A 1 225 GLN 225 760 760 GLN GLN A . n A 1 226 ARG 226 761 761 ARG ARG A . n A 1 227 LYS 227 762 762 LYS LYS A . n A 1 228 LEU 228 763 763 LEU LEU A . n A 1 229 GLN 229 764 764 GLN GLN A . n A 1 230 PHE 230 765 765 PHE PHE A . n A 1 231 TYR 231 766 766 TYR TYR A . n A 1 232 GLU 232 767 767 GLU GLU A . n A 1 233 ASP 233 768 768 ASP ASP A . n A 1 234 ARG 234 769 769 ARG ARG A . n A 1 235 HIS 235 770 770 HIS HIS A . n A 1 236 GLN 236 771 771 GLN GLN A . n A 1 237 LEU 237 772 772 LEU LEU A . n A 1 238 PRO 238 773 773 PRO PRO A . n A 1 239 ALA 239 774 774 ALA ALA A . n A 1 240 PRO 240 775 775 PRO PRO A . n A 1 241 LYS 241 776 776 LYS LYS A . n A 1 242 ALA 242 777 777 ALA ALA A . n A 1 243 ALA 243 778 778 ALA ALA A . n A 1 244 GLU 244 779 779 GLU GLU A . n A 1 245 LEU 245 780 780 LEU LEU A . n A 1 246 ALA 246 781 781 ALA ALA A . n A 1 247 ASN 247 782 782 ASN ASN A . n A 1 248 LEU 248 783 783 LEU LEU A . n A 1 249 ILE 249 784 784 ILE ILE A . n A 1 250 ASN 250 785 785 ASN ASN A . n A 1 251 ASN 251 786 786 ASN ASN A . n A 1 252 CYS 252 787 787 CYS CYS A . n A 1 253 MET 253 788 788 MET MET A . n A 1 254 ASP 254 789 789 ASP ASP A . n A 1 255 TYR 255 790 790 TYR TYR A . n A 1 256 GLU 256 791 791 GLU GLU A . n A 1 257 PRO 257 792 792 PRO PRO A . n A 1 258 ASP 258 793 793 ASP ASP A . n A 1 259 HIS 259 794 794 HIS HIS A . n A 1 260 ARG 260 795 795 ARG ARG A . n A 1 261 PRO 261 796 796 PRO PRO A . n A 1 262 SER 262 797 797 SER SER A . n A 1 263 PHE 263 798 798 PHE PHE A . n A 1 264 ARG 264 799 799 ARG ARG A . n A 1 265 ALA 265 800 800 ALA ALA A . n A 1 266 ILE 266 801 801 ILE ILE A . n A 1 267 ILE 267 802 802 ILE ILE A . n A 1 268 ARG 268 803 803 ARG ARG A . n A 1 269 ASP 269 804 804 ASP ASP A . n A 1 270 LEU 270 805 805 LEU LEU A . n A 1 271 ASN 271 806 806 ASN ASN A . n A 1 272 SER 272 807 807 SER SER A . n A 1 273 LEU 273 808 ? ? ? A . n A 1 274 PHE 274 809 ? ? ? A . n A 1 275 THR 275 810 ? ? ? A . n A 1 276 PRO 276 811 ? ? ? A . n A 1 277 ASP 277 812 ? ? ? A . n A 1 278 LEU 278 813 ? ? ? A . n A 1 279 VAL 279 814 ? ? ? A . n A 1 280 PRO 280 815 ? ? ? A . n A 1 281 ARG 281 816 ? ? ? A . n A 1 282 GLY 282 817 ? ? ? A . n A 1 283 SER 283 818 ? ? ? A . n A 1 284 HIS 284 819 ? ? ? A . n A 1 285 HIS 285 820 ? ? ? A . n A 1 286 HIS 286 821 ? ? ? A . n A 1 287 HIS 287 822 ? ? ? A . n A 1 288 HIS 288 823 ? ? ? A . n A 1 289 HIS 289 824 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 V4D 1 901 901 V4D XXX A . C 3 HOH 1 1001 30 HOH HOH A . C 3 HOH 2 1002 78 HOH HOH A . C 3 HOH 3 1003 45 HOH HOH A . C 3 HOH 4 1004 42 HOH HOH A . C 3 HOH 5 1005 38 HOH HOH A . C 3 HOH 6 1006 31 HOH HOH A . C 3 HOH 7 1007 36 HOH HOH A . C 3 HOH 8 1008 49 HOH HOH A . C 3 HOH 9 1009 28 HOH HOH A . C 3 HOH 10 1010 41 HOH HOH A . C 3 HOH 11 1011 22 HOH HOH A . C 3 HOH 12 1012 27 HOH HOH A . C 3 HOH 13 1013 34 HOH HOH A . C 3 HOH 14 1014 54 HOH HOH A . C 3 HOH 15 1015 92 HOH HOH A . C 3 HOH 16 1016 91 HOH HOH A . C 3 HOH 17 1017 37 HOH HOH A . C 3 HOH 18 1018 18 HOH HOH A . C 3 HOH 19 1019 1 HOH HOH A . C 3 HOH 20 1020 29 HOH HOH A . C 3 HOH 21 1021 61 HOH HOH A . C 3 HOH 22 1022 35 HOH HOH A . C 3 HOH 23 1023 80 HOH HOH A . C 3 HOH 24 1024 50 HOH HOH A . C 3 HOH 25 1025 20 HOH HOH A . C 3 HOH 26 1026 8 HOH HOH A . C 3 HOH 27 1027 70 HOH HOH A . C 3 HOH 28 1028 4 HOH HOH A . C 3 HOH 29 1029 23 HOH HOH A . C 3 HOH 30 1030 17 HOH HOH A . C 3 HOH 31 1031 73 HOH HOH A . C 3 HOH 32 1032 39 HOH HOH A . C 3 HOH 33 1033 89 HOH HOH A . C 3 HOH 34 1034 69 HOH HOH A . C 3 HOH 35 1035 16 HOH HOH A . C 3 HOH 36 1036 11 HOH HOH A . C 3 HOH 37 1037 56 HOH HOH A . C 3 HOH 38 1038 15 HOH HOH A . C 3 HOH 39 1039 21 HOH HOH A . C 3 HOH 40 1040 2 HOH HOH A . C 3 HOH 41 1041 32 HOH HOH A . C 3 HOH 42 1042 10 HOH HOH A . C 3 HOH 43 1043 3 HOH HOH A . C 3 HOH 44 1044 13 HOH HOH A . C 3 HOH 45 1045 77 HOH HOH A . C 3 HOH 46 1046 63 HOH HOH A . C 3 HOH 47 1047 74 HOH HOH A . C 3 HOH 48 1048 47 HOH HOH A . C 3 HOH 49 1049 81 HOH HOH A . C 3 HOH 50 1050 44 HOH HOH A . C 3 HOH 51 1051 19 HOH HOH A . C 3 HOH 52 1052 7 HOH HOH A . C 3 HOH 53 1053 71 HOH HOH A . C 3 HOH 54 1054 6 HOH HOH A . C 3 HOH 55 1055 9 HOH HOH A . C 3 HOH 56 1056 87 HOH HOH A . C 3 HOH 57 1057 93 HOH HOH A . C 3 HOH 58 1058 64 HOH HOH A . C 3 HOH 59 1059 88 HOH HOH A . C 3 HOH 60 1060 90 HOH HOH A . C 3 HOH 61 1061 75 HOH HOH A . C 3 HOH 62 1062 33 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-25 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6XJK _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 548 ? ? -117.21 -135.74 2 1 ASN A 673 ? ? -149.95 55.29 3 1 ASN A 726 ? ? -160.18 109.53 4 1 LYS A 728 ? ? -67.76 2.02 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 539 ? CG ? A LYS 4 CG 2 1 Y 1 A LYS 539 ? CD ? A LYS 4 CD 3 1 Y 1 A LYS 539 ? CE ? A LYS 4 CE 4 1 Y 1 A LYS 539 ? NZ ? A LYS 4 NZ 5 1 Y 1 A ARG 541 ? CG ? A ARG 6 CG 6 1 Y 1 A ARG 541 ? CD ? A ARG 6 CD 7 1 Y 1 A ARG 541 ? NE ? A ARG 6 NE 8 1 Y 1 A ARG 541 ? CZ ? A ARG 6 CZ 9 1 Y 1 A ARG 541 ? NH1 ? A ARG 6 NH1 10 1 Y 1 A ARG 541 ? NH2 ? A ARG 6 NH2 11 1 Y 1 A GLU 543 ? CG ? A GLU 8 CG 12 1 Y 1 A GLU 543 ? CD ? A GLU 8 CD 13 1 Y 1 A GLU 543 ? OE1 ? A GLU 8 OE1 14 1 Y 1 A GLU 543 ? OE2 ? A GLU 8 OE2 15 1 Y 1 A LYS 558 ? CD ? A LYS 23 CD 16 1 Y 1 A LYS 558 ? CE ? A LYS 23 CE 17 1 Y 1 A LYS 558 ? NZ ? A LYS 23 NZ 18 1 Y 1 A ARG 565 ? CG ? A ARG 30 CG 19 1 Y 1 A ARG 565 ? CD ? A ARG 30 CD 20 1 Y 1 A ARG 565 ? NE ? A ARG 30 NE 21 1 Y 1 A ARG 565 ? CZ ? A ARG 30 CZ 22 1 Y 1 A ARG 565 ? NH1 ? A ARG 30 NH1 23 1 Y 1 A ARG 565 ? NH2 ? A ARG 30 NH2 24 1 Y 1 A GLN 572 ? CG ? A GLN 37 CG 25 1 Y 1 A GLN 572 ? CD ? A GLN 37 CD 26 1 Y 1 A GLN 572 ? OE1 ? A GLN 37 OE1 27 1 Y 1 A GLN 572 ? NE2 ? A GLN 37 NE2 28 1 Y 1 A LYS 585 ? CG ? A LYS 50 CG 29 1 Y 1 A LYS 585 ? CD ? A LYS 50 CD 30 1 Y 1 A LYS 585 ? CE ? A LYS 50 CE 31 1 Y 1 A LYS 585 ? NZ ? A LYS 50 NZ 32 1 Y 1 A ARG 588 ? CG ? A ARG 53 CG 33 1 Y 1 A ARG 588 ? CD ? A ARG 53 CD 34 1 Y 1 A ARG 588 ? NE ? A ARG 53 NE 35 1 Y 1 A ARG 588 ? CZ ? A ARG 53 CZ 36 1 Y 1 A ARG 588 ? NH1 ? A ARG 53 NH1 37 1 Y 1 A ARG 588 ? NH2 ? A ARG 53 NH2 38 1 Y 1 A ASN 589 ? CG ? A ASN 54 CG 39 1 Y 1 A ASN 589 ? OD1 ? A ASN 54 OD1 40 1 Y 1 A ASN 589 ? ND2 ? A ASN 54 ND2 41 1 Y 1 A SER 591 ? OG ? A SER 56 OG 42 1 Y 1 A GLU 592 ? CG ? A GLU 57 CG 43 1 Y 1 A GLU 592 ? CD ? A GLU 57 CD 44 1 Y 1 A GLU 592 ? OE1 ? A GLU 57 OE1 45 1 Y 1 A GLU 592 ? OE2 ? A GLU 57 OE2 46 1 Y 1 A GLU 596 ? CG ? A GLU 61 CG 47 1 Y 1 A GLU 596 ? CD ? A GLU 61 CD 48 1 Y 1 A GLU 596 ? OE1 ? A GLU 61 OE1 49 1 Y 1 A GLU 596 ? OE2 ? A GLU 61 OE2 50 1 Y 1 A MET 600 ? CG ? A MET 65 CG 51 1 Y 1 A MET 600 ? SD ? A MET 65 SD 52 1 Y 1 A MET 600 ? CE ? A MET 65 CE 53 1 Y 1 A LYS 603 ? CG ? A LYS 68 CG 54 1 Y 1 A LYS 603 ? CD ? A LYS 68 CD 55 1 Y 1 A LYS 603 ? CE ? A LYS 68 CE 56 1 Y 1 A LYS 603 ? NZ ? A LYS 68 NZ 57 1 Y 1 A VAL 617 ? CG1 ? A VAL 82 CG1 58 1 Y 1 A VAL 617 ? CG2 ? A VAL 82 CG2 59 1 Y 1 A GLU 621 ? CG ? A GLU 86 CG 60 1 Y 1 A GLU 621 ? CD ? A GLU 86 CD 61 1 Y 1 A GLU 621 ? OE1 ? A GLU 86 OE1 62 1 Y 1 A GLU 621 ? OE2 ? A GLU 86 OE2 63 1 Y 1 A ASN 622 ? CG ? A ASN 87 CG 64 1 Y 1 A ASN 622 ? OD1 ? A ASN 87 OD1 65 1 Y 1 A ASN 622 ? ND2 ? A ASN 87 ND2 66 1 Y 1 A LYS 630 ? CD ? A LYS 95 CD 67 1 Y 1 A LYS 630 ? CE ? A LYS 95 CE 68 1 Y 1 A LYS 630 ? NZ ? A LYS 95 NZ 69 1 Y 1 A LYS 639 ? CD ? A LYS 104 CD 70 1 Y 1 A LYS 639 ? CE ? A LYS 104 CE 71 1 Y 1 A LYS 639 ? NZ ? A LYS 104 NZ 72 1 Y 1 A LYS 640 ? CD ? A LYS 105 CD 73 1 Y 1 A LYS 640 ? CE ? A LYS 105 CE 74 1 Y 1 A LYS 640 ? NZ ? A LYS 105 NZ 75 1 Y 1 A LYS 642 ? CG ? A LYS 107 CG 76 1 Y 1 A LYS 642 ? CD ? A LYS 107 CD 77 1 Y 1 A LYS 642 ? CE ? A LYS 107 CE 78 1 Y 1 A LYS 642 ? NZ ? A LYS 107 NZ 79 1 Y 1 A ASN 643 ? CG ? A ASN 108 CG 80 1 Y 1 A ASN 643 ? OD1 ? A ASN 108 OD1 81 1 Y 1 A ASN 643 ? ND2 ? A ASN 108 ND2 82 1 Y 1 A CYS 644 ? SG ? A CYS 109 SG 83 1 Y 1 A LEU 648 ? CG ? A LEU 113 CG 84 1 Y 1 A LEU 648 ? CD1 ? A LEU 113 CD1 85 1 Y 1 A LEU 648 ? CD2 ? A LEU 113 CD2 86 1 Y 1 A LYS 650 ? CE ? A LYS 115 CE 87 1 Y 1 A LYS 650 ? NZ ? A LYS 115 NZ 88 1 Y 1 A LEU 651 ? CG ? A LEU 116 CG 89 1 Y 1 A LEU 651 ? CD1 ? A LEU 116 CD1 90 1 Y 1 A LEU 651 ? CD2 ? A LEU 116 CD2 91 1 Y 1 A LYS 655 ? CE ? A LYS 120 CE 92 1 Y 1 A LYS 655 ? NZ ? A LYS 120 NZ 93 1 Y 1 A LYS 677 ? CG ? A LYS 142 CG 94 1 Y 1 A LYS 677 ? CD ? A LYS 142 CD 95 1 Y 1 A LYS 677 ? CE ? A LYS 142 CE 96 1 Y 1 A LYS 677 ? NZ ? A LYS 142 NZ 97 1 Y 1 A ASN 691 ? CG ? A ASN 156 CG 98 1 Y 1 A ASN 691 ? OD1 ? A ASN 156 OD1 99 1 Y 1 A ASN 691 ? ND2 ? A ASN 156 ND2 100 1 Y 1 A LYS 709 ? CG ? A LYS 174 CG 101 1 Y 1 A LYS 709 ? CD ? A LYS 174 CD 102 1 Y 1 A LYS 709 ? CE ? A LYS 174 CE 103 1 Y 1 A LYS 709 ? NZ ? A LYS 174 NZ 104 1 Y 1 A GLU 714 ? CG ? A GLU 179 CG 105 1 Y 1 A GLU 714 ? CD ? A GLU 179 CD 106 1 Y 1 A GLU 714 ? OE1 ? A GLU 179 OE1 107 1 Y 1 A GLU 714 ? OE2 ? A GLU 179 OE2 108 1 Y 1 A GLU 725 ? CG ? A GLU 190 CG 109 1 Y 1 A GLU 725 ? CD ? A GLU 190 CD 110 1 Y 1 A GLU 725 ? OE1 ? A GLU 190 OE1 111 1 Y 1 A GLU 725 ? OE2 ? A GLU 190 OE2 112 1 Y 1 A LYS 728 ? CG ? A LYS 193 CG 113 1 Y 1 A LYS 728 ? CD ? A LYS 193 CD 114 1 Y 1 A LYS 728 ? CE ? A LYS 193 CE 115 1 Y 1 A LYS 728 ? NZ ? A LYS 193 NZ 116 1 Y 1 A ASN 731 ? CG ? A ASN 196 CG 117 1 Y 1 A ASN 731 ? OD1 ? A ASN 196 OD1 118 1 Y 1 A ASN 731 ? ND2 ? A ASN 196 ND2 119 1 Y 1 A GLN 760 ? CG ? A GLN 225 CG 120 1 Y 1 A GLN 760 ? CD ? A GLN 225 CD 121 1 Y 1 A GLN 760 ? OE1 ? A GLN 225 OE1 122 1 Y 1 A GLN 760 ? NE2 ? A GLN 225 NE2 123 1 Y 1 A GLU 767 ? CD ? A GLU 232 CD 124 1 Y 1 A GLU 767 ? OE1 ? A GLU 232 OE1 125 1 Y 1 A GLU 767 ? OE2 ? A GLU 232 OE2 126 1 Y 1 A ARG 769 ? NE ? A ARG 234 NE 127 1 Y 1 A ARG 769 ? CZ ? A ARG 234 CZ 128 1 Y 1 A ARG 769 ? NH1 ? A ARG 234 NH1 129 1 Y 1 A ARG 769 ? NH2 ? A ARG 234 NH2 130 1 Y 1 A LYS 776 ? CG ? A LYS 241 CG 131 1 Y 1 A LYS 776 ? CD ? A LYS 241 CD 132 1 Y 1 A LYS 776 ? CE ? A LYS 241 CE 133 1 Y 1 A LYS 776 ? NZ ? A LYS 241 NZ 134 1 Y 1 A ARG 799 ? NE ? A ARG 264 NE 135 1 Y 1 A ARG 799 ? CZ ? A ARG 264 CZ 136 1 Y 1 A ARG 799 ? NH1 ? A ARG 264 NH1 137 1 Y 1 A ARG 799 ? NH2 ? A ARG 264 NH2 138 1 Y 1 A ARG 803 ? CG ? A ARG 268 CG 139 1 Y 1 A ARG 803 ? CD ? A ARG 268 CD 140 1 Y 1 A ARG 803 ? NE ? A ARG 268 NE 141 1 Y 1 A ARG 803 ? CZ ? A ARG 268 CZ 142 1 Y 1 A ARG 803 ? NH1 ? A ARG 268 NH1 143 1 Y 1 A ARG 803 ? NH2 ? A ARG 268 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 536 ? A VAL 1 2 1 Y 1 A PHE 537 ? A PHE 2 3 1 Y 1 A HIS 538 ? A HIS 3 4 1 Y 1 A ARG 687 ? A ARG 152 5 1 Y 1 A LYS 688 ? A LYS 153 6 1 Y 1 A THR 689 ? A THR 154 7 1 Y 1 A GLY 690 ? A GLY 155 8 1 Y 1 A LEU 808 ? A LEU 273 9 1 Y 1 A PHE 809 ? A PHE 274 10 1 Y 1 A THR 810 ? A THR 275 11 1 Y 1 A PRO 811 ? A PRO 276 12 1 Y 1 A ASP 812 ? A ASP 277 13 1 Y 1 A LEU 813 ? A LEU 278 14 1 Y 1 A VAL 814 ? A VAL 279 15 1 Y 1 A PRO 815 ? A PRO 280 16 1 Y 1 A ARG 816 ? A ARG 281 17 1 Y 1 A GLY 817 ? A GLY 282 18 1 Y 1 A SER 818 ? A SER 283 19 1 Y 1 A HIS 819 ? A HIS 284 20 1 Y 1 A HIS 820 ? A HIS 285 21 1 Y 1 A HIS 821 ? A HIS 286 22 1 Y 1 A HIS 822 ? A HIS 287 23 1 Y 1 A HIS 823 ? A HIS 288 24 1 Y 1 A HIS 824 ? A HIS 289 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 V4D C4 C Y N 372 V4D C5 C Y N 373 V4D C6 C Y N 374 V4D N1 N Y N 375 V4D C7 C Y N 376 V4D C8 C Y N 377 V4D N2 N N N 378 V4D C9 C Y N 379 V4D C10 C Y N 380 V4D C11 C Y N 381 V4D C12 C Y N 382 V4D N3 N N N 383 V4D C13 C Y N 384 V4D C14 C Y N 385 V4D C15 C Y N 386 V4D N4 N Y N 387 V4D N N N N 388 V4D C C Y N 389 V4D O O N N 390 V4D C1 C Y N 391 V4D C16 C Y N 392 V4D C2 C Y N 393 V4D C3 C Y N 394 V4D N5 N Y N 395 V4D N6 N Y N 396 V4D O1 O N N 397 V4D O2 O N N 398 V4D S S N N 399 V4D H1 H N N 400 V4D H2 H N N 401 V4D H3 H N N 402 V4D H4 H N N 403 V4D H5 H N N 404 V4D H6 H N N 405 V4D H7 H N N 406 V4D H8 H N N 407 V4D H9 H N N 408 V4D H10 H N N 409 V4D H11 H N N 410 V4D H12 H N N 411 V4D H13 H N N 412 V4D H14 H N N 413 V4D H15 H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 V4D N C sing N N 358 V4D C N1 doub Y N 359 V4D C N6 sing Y N 360 V4D N1 C1 sing Y N 361 V4D C11 C10 doub Y N 362 V4D C11 C12 sing Y N 363 V4D N6 C8 doub Y N 364 V4D C10 C9 sing Y N 365 V4D N2 C1 sing N N 366 V4D N2 C2 sing N N 367 V4D C1 N4 doub Y N 368 V4D C7 C2 doub Y N 369 V4D C7 C6 sing Y N 370 V4D C8 N4 sing Y N 371 V4D C8 O2 sing N N 372 V4D C2 C3 sing Y N 373 V4D C6 C5 doub Y N 374 V4D C12 N5 sing Y N 375 V4D C12 C15 doub Y N 376 V4D C9 O2 sing N N 377 V4D C9 C16 doub Y N 378 V4D N5 C13 sing Y N 379 V4D C3 C4 doub Y N 380 V4D C5 C4 sing Y N 381 V4D C5 S sing N N 382 V4D N3 S sing N N 383 V4D O1 S doub N N 384 V4D C15 C16 sing Y N 385 V4D C15 C14 sing Y N 386 V4D S O doub N N 387 V4D C13 C14 doub Y N 388 V4D C4 H1 sing N N 389 V4D C6 H2 sing N N 390 V4D C7 H3 sing N N 391 V4D N2 H4 sing N N 392 V4D C10 H5 sing N N 393 V4D C11 H6 sing N N 394 V4D N3 H7 sing N N 395 V4D N3 H8 sing N N 396 V4D C13 H9 sing N N 397 V4D C14 H10 sing N N 398 V4D N H11 sing N N 399 V4D N H12 sing N N 400 V4D C16 H13 sing N N 401 V4D C3 H14 sing N N 402 V4D N5 H15 sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GMO32136 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id V4D _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id V4D _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-({4-amino-6-[(1H-indol-5-yl)oxy]-1,3,5-triazin-2-yl}amino)benzene-1-sulfonamide' V4D 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5USZ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 #