data_6XNE # _entry.id 6XNE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6XNE pdb_00006xne 10.2210/pdb6xne/pdb WWPDB D_1000250436 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6XNE _pdbx_database_status.recvd_initial_deposition_date 2020-07-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rowe Hartje, R.K.' 1 0000-0003-3490-0413 'Czarny, R.S.' 2 0000-0001-5039-5221 'Ho, A.' 3 0000-0001-7031-5313 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Engineering Specific Protein-Protein Interactions Through Halogen and Hydrogen Bonds' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rowe Hartje, R.K.' 1 0000-0003-3490-0413 primary 'Ferrero, M.' 2 ? primary 'Cavallo, G.' 3 0000-0001-6387-9014 primary 'Metrangolo, P.' 4 0000-0002-7945-099X primary 'Ho, A.' 5 0000-0001-7031-5313 primary 'Czarny, R.' 6 0000-0001-5039-5221 primary 'Ho, P.S.' 7 0000-0002-8082-4311 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 100.628 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6XNE _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.138 _cell.length_a_esd ? _cell.length_b 34.891 _cell.length_b_esd ? _cell.length_c 47.041 _cell.length_c_esd ? _cell.volume 97011.702 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6XNE _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'GCN4-p1 Peptide with me-F16' 3709.403 1 ? me-F16 ? ? 2 polymer syn 'GCN4-p1 Peptide with A16' 3619.280 2 ? N16A ? ? 3 non-polymer syn 'SODIUM ION' 22.990 6 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 71 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Amino acid biosynthesis regulatory protein' 2 'Amino acid biosynthesis regulatory protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes 'RMKQLEDKVEELLSK(4PH)YHLENEVARLKKLV' RMKQLEDKVEELLSKFYHLENEVARLKKLV A ? 2 'polypeptide(L)' no no RMKQLEDKVEELLSKAYHLENEVARLKKLV RMKQLEDKVEELLSKAYHLENEVARLKKLV B,C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 MET n 1 3 LYS n 1 4 GLN n 1 5 LEU n 1 6 GLU n 1 7 ASP n 1 8 LYS n 1 9 VAL n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 LEU n 1 14 SER n 1 15 LYS n 1 16 4PH n 1 17 TYR n 1 18 HIS n 1 19 LEU n 1 20 GLU n 1 21 ASN n 1 22 GLU n 1 23 VAL n 1 24 ALA n 1 25 ARG n 1 26 LEU n 1 27 LYS n 1 28 LYS n 1 29 LEU n 1 30 VAL n 2 1 ARG n 2 2 MET n 2 3 LYS n 2 4 GLN n 2 5 LEU n 2 6 GLU n 2 7 ASP n 2 8 LYS n 2 9 VAL n 2 10 GLU n 2 11 GLU n 2 12 LEU n 2 13 LEU n 2 14 SER n 2 15 LYS n 2 16 ALA n 2 17 TYR n 2 18 HIS n 2 19 LEU n 2 20 GLU n 2 21 ASN n 2 22 GLU n 2 23 VAL n 2 24 ALA n 2 25 ARG n 2 26 LEU n 2 27 LYS n 2 28 LYS n 2 29 LEU n 2 30 VAL n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 30 'Saccharomyces cerevisiae' ;Baker's yeast ; 4932 ? 2 1 sample 1 30 'Saccharomyces cerevisiae' ;Baker's yeast ; 4932 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GCN4_YEAST P03069 ? 1 RMKQLEDKVEELLSKNYHLENEVARLKKLV 249 2 UNP GCN4_YEAST P03069 ? 2 RMKQLEDKVEELLSKNYHLENEVARLKKLV 249 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6XNE A 1 ? 30 ? P03069 249 ? 278 ? 1 30 2 2 6XNE B 1 ? 30 ? P03069 249 ? 278 ? 1 30 3 2 6XNE C 1 ? 30 ? P03069 249 ? 278 ? 1 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6XNE 4PH A 16 ? UNP P03069 ASN 264 'engineered mutation' 16 1 2 6XNE ALA B 16 ? UNP P03069 ASN 264 'engineered mutation' 16 2 3 6XNE ALA C 16 ? UNP P03069 ASN 264 'engineered mutation' 16 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4PH 'L-peptide linking' n 4-methyl-L-phenylalanine ? 'C10 H13 N O2' 179.216 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6XNE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystallization drops were prepared by mixing 2 uL of stock peptide solution with 2 uL of mother liquor and allowed to equilibrate at 298 K over a well containing 500 uL of mother liquor. The stock peptide solution (total concentration 1.5 mM) was prepared by mixing 2:1 ratios of the A16 peptide with me-F16 in 10 mM potassium phosphate, 100 mM potassium chloride pH 7.0. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-003' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6XNE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.96 _reflns.d_resolution_low 20.10 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13582 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.53 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_Rmerge_I_obs 0.05091 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.02 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.072 _reflns.pdbx_Rpim_I_all 0.05091 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.966 _reflns_shell.d_res_low 2.037 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.26 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1201 _reflns_shell.percent_possible_all 97.68 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.3288 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.4649 _reflns_shell.pdbx_Rpim_I_all 0.3288 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.623 _reflns_shell.pdbx_CC_star 0.876 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 30.44 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6XNE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.96 _refine.ls_d_res_low 20.10 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13022 _refine.ls_number_reflns_R_free 1959 _refine.ls_number_reflns_R_work 11063 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.24 _refine.ls_percent_reflns_R_free 15.04 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2247 _refine.ls_R_factor_R_free 0.3086 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2099 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1SWI _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.2160 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3618 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.96 _refine_hist.d_res_low 20.10 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 841 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 763 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0080 ? 816 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8929 ? 1086 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0305 ? 123 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0037 ? 133 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 3.5817 ? 669 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.96 2.01 . . 118 667 83.16 . . . 0.3834 . 0.3117 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.01 2.07 . . 130 747 92.22 . . . 0.3804 . 0.3151 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.07 2.13 . . 134 770 94.66 . . . 0.3528 . 0.2794 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.13 2.20 . . 142 788 95.38 . . . 0.3770 . 0.2628 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.20 2.28 . . 140 788 98.62 . . . 0.3574 . 0.2363 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.28 2.37 . . 140 823 99.48 . . . 0.3639 . 0.2429 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.37 2.47 . . 146 816 99.90 . . . 0.3321 . 0.2416 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.47 2.60 . . 141 803 100.00 . . . 0.3030 . 0.2349 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.60 2.77 . . 143 805 100.00 . . . 0.3337 . 0.2241 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.77 2.98 . . 150 834 100.00 . . . 0.3270 . 0.2082 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.98 3.28 . . 138 796 100.00 . . . 0.2820 . 0.1927 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.28 3.75 . . 148 812 100.00 . . . 0.2652 . 0.1745 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.75 4.72 . . 141 807 99.68 . . . 0.2721 . 0.1583 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.72 20.10 . . 148 807 98.05 . . . 0.2876 . 0.1911 . . . . . . . . . . . # _struct.entry_id 6XNE _struct.title 'GCN4-p1 Peptide Trimer with p-methylphenylalanine residue at position 16 (me-F16)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6XNE _struct_keywords.text 'Coil-coil, p-methylphenylalanine modified phenylalanine, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 4 ? K N N 5 ? L N N 5 ? M N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 1 ? VAL A 30 ? ARG A 1 VAL A 30 1 ? 30 HELX_P HELX_P2 AA2 MET B 2 ? VAL B 30 ? MET B 2 VAL B 30 1 ? 29 HELX_P HELX_P3 AA3 MET C 2 ? VAL C 30 ? MET C 2 VAL C 30 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LYS 15 C ? ? ? 1_555 A 4PH 16 N ? ? A LYS 15 A 4PH 16 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale both ? A 4PH 16 C ? ? ? 1_555 A TYR 17 N ? ? A 4PH 16 A TYR 17 1_555 ? ? ? ? ? ? ? 1.333 ? ? metalc1 metalc ? ? D NA . NA ? ? ? 1_555 M HOH . O ? ? A NA 101 C HOH 206 4_446 ? ? ? ? ? ? ? 3.100 ? ? metalc2 metalc ? ? K HOH . O ? ? ? 4_455 I NA . NA ? ? A HOH 204 C NA 102 1_555 ? ? ? ? ? ? ? 2.524 ? ? metalc3 metalc ? ? B LYS 28 O ? ? ? 1_555 H NA . NA ? ? B LYS 28 C NA 101 4_445 ? ? ? ? ? ? ? 2.675 ? ? metalc4 metalc ? ? G NA . NA ? ? ? 1_555 L HOH . O ? ? B NA 101 B HOH 212 1_555 ? ? ? ? ? ? ? 2.692 ? ? metalc5 metalc ? ? C GLN 4 O ? ? ? 1_555 J MG . MG ? ? C GLN 4 C MG 103 1_555 ? ? ? ? ? ? ? 2.987 ? ? metalc6 metalc ? ? J MG . MG ? ? ? 1_555 M HOH . O ? ? C MG 103 C HOH 215 1_555 ? ? ? ? ? ? ? 2.721 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NA 101 ? 4 'binding site for residue NA A 101' AC2 Software A NA 102 ? 2 'binding site for residue NA A 102' AC3 Software B NA 101 ? 2 'binding site for residue NA B 101' AC4 Software C NA 101 ? 4 'binding site for residue NA C 101' AC5 Software C NA 102 ? 5 'binding site for residue NA C 102' AC6 Software C MG 103 ? 4 'binding site for residue MG C 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 1 ? ARG A 1 . ? 1_555 ? 2 AC1 4 MET A 2 ? MET A 2 . ? 1_555 ? 3 AC1 4 LYS C 28 ? LYS C 28 . ? 4_446 ? 4 AC1 4 HOH M . ? HOH C 206 . ? 4_446 ? 5 AC2 2 LEU A 13 ? LEU A 13 . ? 1_555 ? 6 AC2 2 LEU A 13 ? LEU A 13 . ? 2_556 ? 7 AC3 2 GLN B 4 ? GLN B 4 . ? 1_555 ? 8 AC3 2 HOH L . ? HOH B 212 . ? 1_555 ? 9 AC4 4 ARG A 1 ? ARG A 1 . ? 4_456 ? 10 AC4 4 LYS B 28 ? LYS B 28 . ? 4_455 ? 11 AC4 4 VAL B 30 ? VAL B 30 . ? 4_455 ? 12 AC4 4 NA I . ? NA C 102 . ? 1_555 ? 13 AC5 5 ARG A 1 ? ARG A 1 . ? 4_456 ? 14 AC5 5 HOH K . ? HOH A 204 . ? 4_455 ? 15 AC5 5 ARG C 25 ? ARG C 25 . ? 1_555 ? 16 AC5 5 LEU C 29 ? LEU C 29 . ? 1_555 ? 17 AC5 5 NA H . ? NA C 101 . ? 1_555 ? 18 AC6 4 GLN C 4 ? GLN C 4 . ? 1_555 ? 19 AC6 4 ASP C 7 ? ASP C 7 . ? 1_555 ? 20 AC6 4 LYS C 8 ? LYS C 8 . ? 1_555 ? 21 AC6 4 HOH M . ? HOH C 215 . ? 1_555 ? # _atom_sites.entry_id 6XNE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016628 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003120 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028661 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021629 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? 9.38062 1.54875 ? ? 3.38349 72.32734 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 4PH 16 16 16 4PH PMF A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n B 2 1 ARG 1 1 1 ARG ARG B . n B 2 2 MET 2 2 2 MET MET B . n B 2 3 LYS 3 3 3 LYS LYS B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 LEU 5 5 5 LEU LEU B . n B 2 6 GLU 6 6 6 GLU GLU B . n B 2 7 ASP 7 7 7 ASP ASP B . n B 2 8 LYS 8 8 8 LYS LYS B . n B 2 9 VAL 9 9 9 VAL VAL B . n B 2 10 GLU 10 10 10 GLU GLU B . n B 2 11 GLU 11 11 11 GLU GLU B . n B 2 12 LEU 12 12 12 LEU LEU B . n B 2 13 LEU 13 13 13 LEU LEU B . n B 2 14 SER 14 14 14 SER SER B . n B 2 15 LYS 15 15 15 LYS LYS B . n B 2 16 ALA 16 16 16 ALA ALA B . n B 2 17 TYR 17 17 17 TYR TYR B . n B 2 18 HIS 18 18 18 HIS HIS B . n B 2 19 LEU 19 19 19 LEU LEU B . n B 2 20 GLU 20 20 20 GLU GLU B . n B 2 21 ASN 21 21 21 ASN ASN B . n B 2 22 GLU 22 22 22 GLU GLU B . n B 2 23 VAL 23 23 23 VAL VAL B . n B 2 24 ALA 24 24 24 ALA ALA B . n B 2 25 ARG 25 25 25 ARG ARG B . n B 2 26 LEU 26 26 26 LEU LEU B . n B 2 27 LYS 27 27 27 LYS LYS B . n B 2 28 LYS 28 28 28 LYS LYS B . n B 2 29 LEU 29 29 29 LEU LEU B . n B 2 30 VAL 30 30 30 VAL VAL B . n C 2 1 ARG 1 1 1 ARG ARG C . n C 2 2 MET 2 2 2 MET MET C . n C 2 3 LYS 3 3 3 LYS LYS C . n C 2 4 GLN 4 4 4 GLN GLN C . n C 2 5 LEU 5 5 5 LEU LEU C . n C 2 6 GLU 6 6 6 GLU GLU C . n C 2 7 ASP 7 7 7 ASP ASP C . n C 2 8 LYS 8 8 8 LYS LYS C . n C 2 9 VAL 9 9 9 VAL VAL C . n C 2 10 GLU 10 10 10 GLU GLU C . n C 2 11 GLU 11 11 11 GLU GLU C . n C 2 12 LEU 12 12 12 LEU LEU C . n C 2 13 LEU 13 13 13 LEU LEU C . n C 2 14 SER 14 14 14 SER SER C . n C 2 15 LYS 15 15 15 LYS LYS C . n C 2 16 ALA 16 16 16 ALA ALA C . n C 2 17 TYR 17 17 17 TYR TYR C . n C 2 18 HIS 18 18 18 HIS HIS C . n C 2 19 LEU 19 19 19 LEU LEU C . n C 2 20 GLU 20 20 20 GLU GLU C . n C 2 21 ASN 21 21 21 ASN ASN C . n C 2 22 GLU 22 22 22 GLU GLU C . n C 2 23 VAL 23 23 23 VAL VAL C . n C 2 24 ALA 24 24 24 ALA ALA C . n C 2 25 ARG 25 25 25 ARG ARG C . n C 2 26 LEU 26 26 26 LEU LEU C . n C 2 27 LYS 27 27 27 LYS LYS C . n C 2 28 LYS 28 28 28 LYS LYS C . n C 2 29 LEU 29 29 29 LEU LEU C . n C 2 30 VAL 30 30 30 VAL VAL C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 NA 1 101 1 NA NA A . E 3 NA 1 102 4 NA NA A . F 3 NA 1 103 6 NA NA A . G 3 NA 1 101 5 NA NA B . H 3 NA 1 101 2 NA NA C . I 3 NA 1 102 3 NA NA C . J 4 MG 1 103 1 MG MG C . K 5 HOH 1 201 30 HOH HOH A . K 5 HOH 2 202 54 HOH HOH A . K 5 HOH 3 203 24 HOH HOH A . K 5 HOH 4 204 39 HOH HOH A . K 5 HOH 5 205 33 HOH HOH A . K 5 HOH 6 206 17 HOH HOH A . K 5 HOH 7 207 55 HOH HOH A . K 5 HOH 8 208 3 HOH HOH A . K 5 HOH 9 209 35 HOH HOH A . K 5 HOH 10 210 72 HOH HOH A . K 5 HOH 11 211 41 HOH HOH A . K 5 HOH 12 212 11 HOH HOH A . K 5 HOH 13 213 12 HOH HOH A . K 5 HOH 14 214 26 HOH HOH A . K 5 HOH 15 215 68 HOH HOH A . K 5 HOH 16 216 10 HOH HOH A . K 5 HOH 17 217 20 HOH HOH A . K 5 HOH 18 218 2 HOH HOH A . K 5 HOH 19 219 61 HOH HOH A . K 5 HOH 20 220 43 HOH HOH A . K 5 HOH 21 221 14 HOH HOH A . K 5 HOH 22 222 22 HOH HOH A . K 5 HOH 23 223 18 HOH HOH A . K 5 HOH 24 224 32 HOH HOH A . K 5 HOH 25 225 47 HOH HOH A . K 5 HOH 26 226 52 HOH HOH A . K 5 HOH 27 227 15 HOH HOH A . K 5 HOH 28 228 31 HOH HOH A . K 5 HOH 29 229 59 HOH HOH A . K 5 HOH 30 230 73 HOH HOH A . K 5 HOH 31 231 71 HOH HOH A . K 5 HOH 32 232 58 HOH HOH A . L 5 HOH 1 201 13 HOH HOH B . L 5 HOH 2 202 5 HOH HOH B . L 5 HOH 3 203 8 HOH HOH B . L 5 HOH 4 204 46 HOH HOH B . L 5 HOH 5 205 9 HOH HOH B . L 5 HOH 6 206 36 HOH HOH B . L 5 HOH 7 207 4 HOH HOH B . L 5 HOH 8 208 50 HOH HOH B . L 5 HOH 9 209 45 HOH HOH B . L 5 HOH 10 210 62 HOH HOH B . L 5 HOH 11 211 7 HOH HOH B . L 5 HOH 12 212 57 HOH HOH B . L 5 HOH 13 213 66 HOH HOH B . L 5 HOH 14 214 19 HOH HOH B . L 5 HOH 15 215 29 HOH HOH B . L 5 HOH 16 216 23 HOH HOH B . L 5 HOH 17 217 51 HOH HOH B . L 5 HOH 18 218 25 HOH HOH B . L 5 HOH 19 219 56 HOH HOH B . M 5 HOH 1 201 64 HOH HOH C . M 5 HOH 2 202 42 HOH HOH C . M 5 HOH 3 203 1 HOH HOH C . M 5 HOH 4 204 38 HOH HOH C . M 5 HOH 5 205 34 HOH HOH C . M 5 HOH 6 206 44 HOH HOH C . M 5 HOH 7 207 53 HOH HOH C . M 5 HOH 8 208 69 HOH HOH C . M 5 HOH 9 209 27 HOH HOH C . M 5 HOH 10 210 6 HOH HOH C . M 5 HOH 11 211 49 HOH HOH C . M 5 HOH 12 212 48 HOH HOH C . M 5 HOH 13 213 16 HOH HOH C . M 5 HOH 14 214 37 HOH HOH C . M 5 HOH 15 215 60 HOH HOH C . M 5 HOH 16 216 21 HOH HOH C . M 5 HOH 17 217 40 HOH HOH C . M 5 HOH 18 218 28 HOH HOH C . M 5 HOH 19 219 63 HOH HOH C . M 5 HOH 20 220 70 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4520 ? 1 MORE -85 ? 1 'SSA (A^2)' 6280 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id NA _pdbx_struct_special_symmetry.auth_seq_id 102 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id NA _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id C _pdbx_struct_conn_angle.ptnr1_label_comp_id GLN _pdbx_struct_conn_angle.ptnr1_label_seq_id 4 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id C _pdbx_struct_conn_angle.ptnr1_auth_comp_id GLN _pdbx_struct_conn_angle.ptnr1_auth_seq_id 4 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id MG _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id J _pdbx_struct_conn_angle.ptnr2_label_comp_id MG _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id C _pdbx_struct_conn_angle.ptnr2_auth_comp_id MG _pdbx_struct_conn_angle.ptnr2_auth_seq_id 103 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id M _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id C _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 215 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 105.7 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-07 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -9.57888561735 -7.02828621151 19.4710058711 0.20039794885 ? -0.0586659290271 ? -0.0327493033458 ? 0.158300330551 ? 0.0112714677134 ? 0.214613497607 ? 1.24754210982 ? 0.135668021467 ? -1.46527164352 ? 2.11237742094 ? -2.45014998075 ? 7.10077978618 ? 0.185391907064 ? -0.071062364106 ? 0.115012330115 ? 0.0938069869599 ? -0.228939427929 ? -0.211077083066 ? -0.669849463227 ? 0.428096583358 ? 0.0364089925299 ? 2 'X-RAY DIFFRACTION' ? refined -19.0757432862 -7.0968966587 19.7250621409 0.21621440615 ? -0.0247866893307 ? -0.021993377421 ? 0.169401207787 ? 0.0103895862854 ? 0.17296883571 ? 0.746006401384 ? -0.369053317468 ? -0.285148667102 ? 1.87903236924 ? 3.1395250622 ? 8.78361867322 ? 0.327970128882 ? 0.0517777912643 ? 0.087964438643 ? 0.0122390252309 ? 0.195497964487 ? -0.109497231777 ? 0.239110908744 ? 0.32699071286 ? -0.452755536666 ? 3 'X-RAY DIFFRACTION' ? refined -14.6368980272 1.25924745043 19.8864231745 0.221873700469 ? -0.0360706319981 ? 0.013178675346 ? 0.173307499646 ? -0.0107514901404 ? 0.250352076031 ? 3.08181948845 ? -0.523294754822 ? 2.96488104073 ? 2.43979683942 ? -1.7170881857 ? 4.3033051159 ? -0.204320190222 ? 0.0300973336528 ? -0.372022282962 ? -0.0344666728889 ? 0.0323080503877 ? -0.383193799014 ? -0.587941371677 ? -0.241877298311 ? 0.195275591823 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 30 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 1 through 30 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 1 through 30 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 6XNE _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 4PH CA C N S 1 4PH CB C N N 2 4PH CG C Y N 3 4PH CD2 C Y N 4 4PH CD1 C Y N 5 4PH CE2 C Y N 6 4PH CE1 C Y N 7 4PH CZ C Y N 8 4PH C C N N 9 4PH C33 C N N 10 4PH O O N N 11 4PH N N N N 12 4PH OXT O N N 13 4PH HA H N N 14 4PH HB2 H N N 15 4PH HB3 H N N 16 4PH HD2 H N N 17 4PH HD1 H N N 18 4PH HE2 H N N 19 4PH HE1 H N N 20 4PH H33 H N N 21 4PH H33A H N N 22 4PH H33B H N N 23 4PH H H N N 24 4PH H2 H N N 25 4PH HXT H N N 26 ALA N N N N 27 ALA CA C N S 28 ALA C C N N 29 ALA O O N N 30 ALA CB C N N 31 ALA OXT O N N 32 ALA H H N N 33 ALA H2 H N N 34 ALA HA H N N 35 ALA HB1 H N N 36 ALA HB2 H N N 37 ALA HB3 H N N 38 ALA HXT H N N 39 ARG N N N N 40 ARG CA C N S 41 ARG C C N N 42 ARG O O N N 43 ARG CB C N N 44 ARG CG C N N 45 ARG CD C N N 46 ARG NE N N N 47 ARG CZ C N N 48 ARG NH1 N N N 49 ARG NH2 N N N 50 ARG OXT O N N 51 ARG H H N N 52 ARG H2 H N N 53 ARG HA H N N 54 ARG HB2 H N N 55 ARG HB3 H N N 56 ARG HG2 H N N 57 ARG HG3 H N N 58 ARG HD2 H N N 59 ARG HD3 H N N 60 ARG HE H N N 61 ARG HH11 H N N 62 ARG HH12 H N N 63 ARG HH21 H N N 64 ARG HH22 H N N 65 ARG HXT H N N 66 ASN N N N N 67 ASN CA C N S 68 ASN C C N N 69 ASN O O N N 70 ASN CB C N N 71 ASN CG C N N 72 ASN OD1 O N N 73 ASN ND2 N N N 74 ASN OXT O N N 75 ASN H H N N 76 ASN H2 H N N 77 ASN HA H N N 78 ASN HB2 H N N 79 ASN HB3 H N N 80 ASN HD21 H N N 81 ASN HD22 H N N 82 ASN HXT H N N 83 ASP N N N N 84 ASP CA C N S 85 ASP C C N N 86 ASP O O N N 87 ASP CB C N N 88 ASP CG C N N 89 ASP OD1 O N N 90 ASP OD2 O N N 91 ASP OXT O N N 92 ASP H H N N 93 ASP H2 H N N 94 ASP HA H N N 95 ASP HB2 H N N 96 ASP HB3 H N N 97 ASP HD2 H N N 98 ASP HXT H N N 99 GLN N N N N 100 GLN CA C N S 101 GLN C C N N 102 GLN O O N N 103 GLN CB C N N 104 GLN CG C N N 105 GLN CD C N N 106 GLN OE1 O N N 107 GLN NE2 N N N 108 GLN OXT O N N 109 GLN H H N N 110 GLN H2 H N N 111 GLN HA H N N 112 GLN HB2 H N N 113 GLN HB3 H N N 114 GLN HG2 H N N 115 GLN HG3 H N N 116 GLN HE21 H N N 117 GLN HE22 H N N 118 GLN HXT H N N 119 GLU N N N N 120 GLU CA C N S 121 GLU C C N N 122 GLU O O N N 123 GLU CB C N N 124 GLU CG C N N 125 GLU CD C N N 126 GLU OE1 O N N 127 GLU OE2 O N N 128 GLU OXT O N N 129 GLU H H N N 130 GLU H2 H N N 131 GLU HA H N N 132 GLU HB2 H N N 133 GLU HB3 H N N 134 GLU HG2 H N N 135 GLU HG3 H N N 136 GLU HE2 H N N 137 GLU HXT H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 HOH O O N N 160 HOH H1 H N N 161 HOH H2 H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 MG MG MG N N 230 NA NA NA N N 231 SER N N N N 232 SER CA C N S 233 SER C C N N 234 SER O O N N 235 SER CB C N N 236 SER OG O N N 237 SER OXT O N N 238 SER H H N N 239 SER H2 H N N 240 SER HA H N N 241 SER HB2 H N N 242 SER HB3 H N N 243 SER HG H N N 244 SER HXT H N N 245 TYR N N N N 246 TYR CA C N S 247 TYR C C N N 248 TYR O O N N 249 TYR CB C N N 250 TYR CG C Y N 251 TYR CD1 C Y N 252 TYR CD2 C Y N 253 TYR CE1 C Y N 254 TYR CE2 C Y N 255 TYR CZ C Y N 256 TYR OH O N N 257 TYR OXT O N N 258 TYR H H N N 259 TYR H2 H N N 260 TYR HA H N N 261 TYR HB2 H N N 262 TYR HB3 H N N 263 TYR HD1 H N N 264 TYR HD2 H N N 265 TYR HE1 H N N 266 TYR HE2 H N N 267 TYR HH H N N 268 TYR HXT H N N 269 VAL N N N N 270 VAL CA C N S 271 VAL C C N N 272 VAL O O N N 273 VAL CB C N N 274 VAL CG1 C N N 275 VAL CG2 C N N 276 VAL OXT O N N 277 VAL H H N N 278 VAL H2 H N N 279 VAL HA H N N 280 VAL HB H N N 281 VAL HG11 H N N 282 VAL HG12 H N N 283 VAL HG13 H N N 284 VAL HG21 H N N 285 VAL HG22 H N N 286 VAL HG23 H N N 287 VAL HXT H N N 288 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 4PH CB CA sing N N 1 4PH N CA sing N N 2 4PH CA C sing N N 3 4PH CA HA sing N N 4 4PH CB CG sing N N 5 4PH CB HB2 sing N N 6 4PH CB HB3 sing N N 7 4PH CD2 CG doub Y N 8 4PH CG CD1 sing Y N 9 4PH CD2 CE2 sing Y N 10 4PH CD2 HD2 sing N N 11 4PH CD1 CE1 doub Y N 12 4PH CD1 HD1 sing N N 13 4PH CE2 CZ doub Y N 14 4PH CE2 HE2 sing N N 15 4PH CZ CE1 sing Y N 16 4PH CE1 HE1 sing N N 17 4PH CZ C33 sing N N 18 4PH O C doub N N 19 4PH C OXT sing N N 20 4PH C33 H33 sing N N 21 4PH C33 H33A sing N N 22 4PH C33 H33B sing N N 23 4PH N H sing N N 24 4PH N H2 sing N N 25 4PH OXT HXT sing N N 26 ALA N CA sing N N 27 ALA N H sing N N 28 ALA N H2 sing N N 29 ALA CA C sing N N 30 ALA CA CB sing N N 31 ALA CA HA sing N N 32 ALA C O doub N N 33 ALA C OXT sing N N 34 ALA CB HB1 sing N N 35 ALA CB HB2 sing N N 36 ALA CB HB3 sing N N 37 ALA OXT HXT sing N N 38 ARG N CA sing N N 39 ARG N H sing N N 40 ARG N H2 sing N N 41 ARG CA C sing N N 42 ARG CA CB sing N N 43 ARG CA HA sing N N 44 ARG C O doub N N 45 ARG C OXT sing N N 46 ARG CB CG sing N N 47 ARG CB HB2 sing N N 48 ARG CB HB3 sing N N 49 ARG CG CD sing N N 50 ARG CG HG2 sing N N 51 ARG CG HG3 sing N N 52 ARG CD NE sing N N 53 ARG CD HD2 sing N N 54 ARG CD HD3 sing N N 55 ARG NE CZ sing N N 56 ARG NE HE sing N N 57 ARG CZ NH1 sing N N 58 ARG CZ NH2 doub N N 59 ARG NH1 HH11 sing N N 60 ARG NH1 HH12 sing N N 61 ARG NH2 HH21 sing N N 62 ARG NH2 HH22 sing N N 63 ARG OXT HXT sing N N 64 ASN N CA sing N N 65 ASN N H sing N N 66 ASN N H2 sing N N 67 ASN CA C sing N N 68 ASN CA CB sing N N 69 ASN CA HA sing N N 70 ASN C O doub N N 71 ASN C OXT sing N N 72 ASN CB CG sing N N 73 ASN CB HB2 sing N N 74 ASN CB HB3 sing N N 75 ASN CG OD1 doub N N 76 ASN CG ND2 sing N N 77 ASN ND2 HD21 sing N N 78 ASN ND2 HD22 sing N N 79 ASN OXT HXT sing N N 80 ASP N CA sing N N 81 ASP N H sing N N 82 ASP N H2 sing N N 83 ASP CA C sing N N 84 ASP CA CB sing N N 85 ASP CA HA sing N N 86 ASP C O doub N N 87 ASP C OXT sing N N 88 ASP CB CG sing N N 89 ASP CB HB2 sing N N 90 ASP CB HB3 sing N N 91 ASP CG OD1 doub N N 92 ASP CG OD2 sing N N 93 ASP OD2 HD2 sing N N 94 ASP OXT HXT sing N N 95 GLN N CA sing N N 96 GLN N H sing N N 97 GLN N H2 sing N N 98 GLN CA C sing N N 99 GLN CA CB sing N N 100 GLN CA HA sing N N 101 GLN C O doub N N 102 GLN C OXT sing N N 103 GLN CB CG sing N N 104 GLN CB HB2 sing N N 105 GLN CB HB3 sing N N 106 GLN CG CD sing N N 107 GLN CG HG2 sing N N 108 GLN CG HG3 sing N N 109 GLN CD OE1 doub N N 110 GLN CD NE2 sing N N 111 GLN NE2 HE21 sing N N 112 GLN NE2 HE22 sing N N 113 GLN OXT HXT sing N N 114 GLU N CA sing N N 115 GLU N H sing N N 116 GLU N H2 sing N N 117 GLU CA C sing N N 118 GLU CA CB sing N N 119 GLU CA HA sing N N 120 GLU C O doub N N 121 GLU C OXT sing N N 122 GLU CB CG sing N N 123 GLU CB HB2 sing N N 124 GLU CB HB3 sing N N 125 GLU CG CD sing N N 126 GLU CG HG2 sing N N 127 GLU CG HG3 sing N N 128 GLU CD OE1 doub N N 129 GLU CD OE2 sing N N 130 GLU OE2 HE2 sing N N 131 GLU OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 LEU N CA sing N N 156 LEU N H sing N N 157 LEU N H2 sing N N 158 LEU CA C sing N N 159 LEU CA CB sing N N 160 LEU CA HA sing N N 161 LEU C O doub N N 162 LEU C OXT sing N N 163 LEU CB CG sing N N 164 LEU CB HB2 sing N N 165 LEU CB HB3 sing N N 166 LEU CG CD1 sing N N 167 LEU CG CD2 sing N N 168 LEU CG HG sing N N 169 LEU CD1 HD11 sing N N 170 LEU CD1 HD12 sing N N 171 LEU CD1 HD13 sing N N 172 LEU CD2 HD21 sing N N 173 LEU CD2 HD22 sing N N 174 LEU CD2 HD23 sing N N 175 LEU OXT HXT sing N N 176 LYS N CA sing N N 177 LYS N H sing N N 178 LYS N H2 sing N N 179 LYS CA C sing N N 180 LYS CA CB sing N N 181 LYS CA HA sing N N 182 LYS C O doub N N 183 LYS C OXT sing N N 184 LYS CB CG sing N N 185 LYS CB HB2 sing N N 186 LYS CB HB3 sing N N 187 LYS CG CD sing N N 188 LYS CG HG2 sing N N 189 LYS CG HG3 sing N N 190 LYS CD CE sing N N 191 LYS CD HD2 sing N N 192 LYS CD HD3 sing N N 193 LYS CE NZ sing N N 194 LYS CE HE2 sing N N 195 LYS CE HE3 sing N N 196 LYS NZ HZ1 sing N N 197 LYS NZ HZ2 sing N N 198 LYS NZ HZ3 sing N N 199 LYS OXT HXT sing N N 200 MET N CA sing N N 201 MET N H sing N N 202 MET N H2 sing N N 203 MET CA C sing N N 204 MET CA CB sing N N 205 MET CA HA sing N N 206 MET C O doub N N 207 MET C OXT sing N N 208 MET CB CG sing N N 209 MET CB HB2 sing N N 210 MET CB HB3 sing N N 211 MET CG SD sing N N 212 MET CG HG2 sing N N 213 MET CG HG3 sing N N 214 MET SD CE sing N N 215 MET CE HE1 sing N N 216 MET CE HE2 sing N N 217 MET CE HE3 sing N N 218 MET OXT HXT sing N N 219 SER N CA sing N N 220 SER N H sing N N 221 SER N H2 sing N N 222 SER CA C sing N N 223 SER CA CB sing N N 224 SER CA HA sing N N 225 SER C O doub N N 226 SER C OXT sing N N 227 SER CB OG sing N N 228 SER CB HB2 sing N N 229 SER CB HB3 sing N N 230 SER OG HG sing N N 231 SER OXT HXT sing N N 232 TYR N CA sing N N 233 TYR N H sing N N 234 TYR N H2 sing N N 235 TYR CA C sing N N 236 TYR CA CB sing N N 237 TYR CA HA sing N N 238 TYR C O doub N N 239 TYR C OXT sing N N 240 TYR CB CG sing N N 241 TYR CB HB2 sing N N 242 TYR CB HB3 sing N N 243 TYR CG CD1 doub Y N 244 TYR CG CD2 sing Y N 245 TYR CD1 CE1 sing Y N 246 TYR CD1 HD1 sing N N 247 TYR CD2 CE2 doub Y N 248 TYR CD2 HD2 sing N N 249 TYR CE1 CZ doub Y N 250 TYR CE1 HE1 sing N N 251 TYR CE2 CZ sing Y N 252 TYR CE2 HE2 sing N N 253 TYR CZ OH sing N N 254 TYR OH HH sing N N 255 TYR OXT HXT sing N N 256 VAL N CA sing N N 257 VAL N H sing N N 258 VAL N H2 sing N N 259 VAL CA C sing N N 260 VAL CA CB sing N N 261 VAL CA HA sing N N 262 VAL C O doub N N 263 VAL C OXT sing N N 264 VAL CB CG1 sing N N 265 VAL CB CG2 sing N N 266 VAL CB HB sing N N 267 VAL CG1 HG11 sing N N 268 VAL CG1 HG12 sing N N 269 VAL CG1 HG13 sing N N 270 VAL CG2 HG21 sing N N 271 VAL CG2 HG22 sing N N 272 VAL CG2 HG23 sing N N 273 VAL OXT HXT sing N N 274 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' 1608146 1 'National Science Foundation (NSF, United States)' 'United States' 1905328 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 4PH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 4PH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SODIUM ION' NA 4 'MAGNESIUM ION' MG 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1SWI _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 #