data_6XV2 # _entry.id 6XV2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6XV2 pdb_00006xv2 10.2210/pdb6xv2/pdb WWPDB D_1292106342 ? ? BMRB 27880 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6TY0 unspecified PDB . 6TY2 unspecified BMRB . 27880 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6XV2 _pdbx_database_status.recvd_initial_deposition_date 2020-01-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category RNA-Puzzles _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Poignavent, V.' 1 0000-0002-3957-1906 'Hoh, F.' 2 0000-0002-2905-7081 'Vignols, F.' 3 0000-0002-2031-0407 'Demene, H.' 4 0000-0002-7531-4309 'Yang, Y.' 5 0000-0002-4070-2969 'Gillet, F.X.' 6 0000-0001-7453-488X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 434 _citation.language ? _citation.page_first 167715 _citation.page_last 167715 _citation.title 'A Flexible and Original Architecture of Two Unrelated Zinc Fingers Underlies the Role of the Multitask P1 in RYMV Spread.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2022.167715 _citation.pdbx_database_id_PubMed 35798161 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Poignavent, V.' 1 ? primary 'Hoh, F.' 2 ? primary 'Terral, G.' 3 ? primary 'Yang, Y.' 4 ? primary 'Gillet, F.X.' 5 ? primary 'Kim, J.H.' 6 ? primary 'Allemand, F.' 7 ? primary 'Lacombe, E.' 8 ? primary 'Brugidou, C.' 9 ? primary 'Cianferani, S.' 10 ? primary 'Demene, H.' 11 ? primary 'Vignols, F.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man p1 17951.000 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTRLEVLIRPTEQTAAKANAVGYTHALTWVWHSQTWDVDSVRDPSLRADFNPEKVGWVSVSFACTQCTAHYYTSEQVKYF TNIPPVHFDVVCADCERSVQLDDEIDREHQERNAEISACNARALSEGRPASLVYLSRDACDIPEHSGRCRFVKYLNF ; _entity_poly.pdbx_seq_one_letter_code_can ;MTRLEVLIRPTEQTAAKANAVGYTHALTWVWHSQTWDVDSVRDPSLRADFNPEKVGWVSVSFACTQCTAHYYTSEQVKYF TNIPPVHFDVVCADCERSVQLDDEIDREHQERNAEISACNARALSEGRPASLVYLSRDACDIPEHSGRCRFVKYLNF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ARG n 1 4 LEU n 1 5 GLU n 1 6 VAL n 1 7 LEU n 1 8 ILE n 1 9 ARG n 1 10 PRO n 1 11 THR n 1 12 GLU n 1 13 GLN n 1 14 THR n 1 15 ALA n 1 16 ALA n 1 17 LYS n 1 18 ALA n 1 19 ASN n 1 20 ALA n 1 21 VAL n 1 22 GLY n 1 23 TYR n 1 24 THR n 1 25 HIS n 1 26 ALA n 1 27 LEU n 1 28 THR n 1 29 TRP n 1 30 VAL n 1 31 TRP n 1 32 HIS n 1 33 SER n 1 34 GLN n 1 35 THR n 1 36 TRP n 1 37 ASP n 1 38 VAL n 1 39 ASP n 1 40 SER n 1 41 VAL n 1 42 ARG n 1 43 ASP n 1 44 PRO n 1 45 SER n 1 46 LEU n 1 47 ARG n 1 48 ALA n 1 49 ASP n 1 50 PHE n 1 51 ASN n 1 52 PRO n 1 53 GLU n 1 54 LYS n 1 55 VAL n 1 56 GLY n 1 57 TRP n 1 58 VAL n 1 59 SER n 1 60 VAL n 1 61 SER n 1 62 PHE n 1 63 ALA n 1 64 CYS n 1 65 THR n 1 66 GLN n 1 67 CYS n 1 68 THR n 1 69 ALA n 1 70 HIS n 1 71 TYR n 1 72 TYR n 1 73 THR n 1 74 SER n 1 75 GLU n 1 76 GLN n 1 77 VAL n 1 78 LYS n 1 79 TYR n 1 80 PHE n 1 81 THR n 1 82 ASN n 1 83 ILE n 1 84 PRO n 1 85 PRO n 1 86 VAL n 1 87 HIS n 1 88 PHE n 1 89 ASP n 1 90 VAL n 1 91 VAL n 1 92 CYS n 1 93 ALA n 1 94 ASP n 1 95 CYS n 1 96 GLU n 1 97 ARG n 1 98 SER n 1 99 VAL n 1 100 GLN n 1 101 LEU n 1 102 ASP n 1 103 ASP n 1 104 GLU n 1 105 ILE n 1 106 ASP n 1 107 ARG n 1 108 GLU n 1 109 HIS n 1 110 GLN n 1 111 GLU n 1 112 ARG n 1 113 ASN n 1 114 ALA n 1 115 GLU n 1 116 ILE n 1 117 SER n 1 118 ALA n 1 119 CYS n 1 120 ASN n 1 121 ALA n 1 122 ARG n 1 123 ALA n 1 124 LEU n 1 125 SER n 1 126 GLU n 1 127 GLY n 1 128 ARG n 1 129 PRO n 1 130 ALA n 1 131 SER n 1 132 LEU n 1 133 VAL n 1 134 TYR n 1 135 LEU n 1 136 SER n 1 137 ARG n 1 138 ASP n 1 139 ALA n 1 140 CYS n 1 141 ASP n 1 142 ILE n 1 143 PRO n 1 144 GLU n 1 145 HIS n 1 146 SER n 1 147 GLY n 1 148 ARG n 1 149 CYS n 1 150 ARG n 1 151 PHE n 1 152 VAL n 1 153 LYS n 1 154 TYR n 1 155 LEU n 1 156 ASN n 1 157 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 157 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rice yellow mottle virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 31744 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q709H6_9VIRU _struct_ref.pdbx_db_accession Q709H6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTRLEVLIRPTEQTAAKANAVGYTHALTWVWHSQTWDVDSVRDPSLRADFNPEKVGWVSVSFACTQCTAHYYTSEQVKYF TNIPPVHFDVVCADCERSVQLDDEIDREHQERNAEISACNARALSEGRPASLVYLSRDACDIPEHSGRCRFVKYLNF ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6XV2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 157 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q709H6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 157 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 157 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D 1H-15N NOESY' 1 isotropic 3 1 3 '3D CBCA(CO)NH' 1 isotropic 4 1 3 '3D HNCA' 1 isotropic 5 1 3 '3D HNCO' 1 isotropic 6 1 3 '3D HNCACB' 1 isotropic 7 1 3 '3D HCCH-TOCSY' 1 isotropic 8 1 2 '2D TROSY' 2 anisotropic 9 1 1 '2D HSQC IPAP' 2 anisotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 220 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 10 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 15N _pdbx_nmr_exptl_sample_conditions.pH_err 0.01 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '300 uM [U-99% 15N] RYMV P1, 100 mM None NaCl, 1 mM None DTT, 60 mM None Na2SO4, 25 mM None TRIS, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N solution ? 2 '500 uM 15N RYMV P1, 7 mg/mL None Pf1 phage, 200 mM None NaCl, 25 mM None TRIS, 1 mM None DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N aligned' 'filamentous virus' ? 3 ;200 uM [U-99% 13C; U-99% 15N] RYMV P1, 100 mM None sodium chloride, 25 mM None TRIS, 1 mM None DTT, 60 mM None Na2SO4, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N,13C solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 'Cryprobe 15N, 13C, 1H' 2 'AVANCE III' ? Bruker 700 'Cryprobe 15N, 13C, 1H' # _pdbx_nmr_refine.entry_id 6XV2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'rigid body' _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 6XV2 _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 14 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6XV2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 2 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 processing Gifa ? Delsuc 5 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6XV2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6XV2 _struct.title 'Full structure of RYMV P1 protein, derived from crystallographic and NMR data.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6XV2 _struct_keywords.text 'putative RNA binding protein; silencing suppressor, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 14 ? VAL A 21 ? THR A 14 VAL A 21 1 ? 8 HELX_P HELX_P2 AA2 SER A 33 ? ASP A 37 ? SER A 33 ASP A 37 5 ? 5 HELX_P HELX_P3 AA3 ASP A 94 ? GLU A 126 ? ASP A 94 GLU A 126 1 ? 33 HELX_P HELX_P4 AA4 ILE A 142 ? SER A 146 ? ILE A 142 SER A 146 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 64 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 64 A ZN 201 1_555 ? ? ? ? ? ? ? 2.178 ? ? metalc2 metalc ? ? A CYS 67 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 67 A ZN 201 1_555 ? ? ? ? ? ? ? 2.182 ? ? metalc3 metalc ? ? A CYS 92 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 92 A ZN 201 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc4 metalc ? ? A CYS 95 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 95 A ZN 201 1_555 ? ? ? ? ? ? ? 2.439 ? ? metalc5 metalc ? ? A HIS 109 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 109 A ZN 202 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc6 metalc ? ? A CYS 140 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 140 A ZN 202 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc7 metalc ? ? A HIS 145 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 145 A ZN 202 1_555 ? ? ? ? ? ? ? 1.984 ? ? metalc8 metalc ? ? A CYS 149 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 149 A ZN 202 1_555 ? ? ? ? ? ? ? 2.286 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 26 ? HIS A 32 ? ALA A 26 HIS A 32 AA1 2 THR A 2 ? PRO A 10 ? THR A 2 PRO A 10 AA1 3 SER A 45 ? CYS A 64 ? SER A 45 CYS A 64 AA1 4 HIS A 70 ? THR A 81 ? HIS A 70 THR A 81 AA2 1 ALA A 26 ? HIS A 32 ? ALA A 26 HIS A 32 AA2 2 THR A 2 ? PRO A 10 ? THR A 2 PRO A 10 AA2 3 SER A 45 ? CYS A 64 ? SER A 45 CYS A 64 AA2 4 VAL A 86 ? VAL A 90 ? VAL A 86 VAL A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 30 ? O VAL A 30 N LEU A 4 ? N LEU A 4 AA1 2 3 N LEU A 7 ? N LEU A 7 O LEU A 46 ? O LEU A 46 AA1 3 4 N PHE A 62 ? N PHE A 62 O TYR A 71 ? O TYR A 71 AA2 1 2 O VAL A 30 ? O VAL A 30 N LEU A 4 ? N LEU A 4 AA2 2 3 N LEU A 7 ? N LEU A 7 O LEU A 46 ? O LEU A 46 AA2 3 4 N SER A 61 ? N SER A 61 O PHE A 88 ? O PHE A 88 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 4 'binding site for residue ZN A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 64 ? CYS A 64 . ? 1_555 ? 2 AC1 4 CYS A 67 ? CYS A 67 . ? 1_555 ? 3 AC1 4 CYS A 92 ? CYS A 92 . ? 1_555 ? 4 AC1 4 CYS A 95 ? CYS A 95 . ? 1_555 ? 5 AC2 4 HIS A 109 ? HIS A 109 . ? 1_555 ? 6 AC2 4 CYS A 140 ? CYS A 140 . ? 1_555 ? 7 AC2 4 HIS A 145 ? HIS A 145 . ? 1_555 ? 8 AC2 4 CYS A 149 ? CYS A 149 . ? 1_555 ? # _atom_sites.entry_id 6XV2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 CYS 92 92 92 CYS CYS A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 CYS 140 140 140 CYS CYS A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 CYS 149 149 149 CYS CYS A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 PHE 157 157 157 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 158 ZN ZN A . C 2 ZN 1 202 159 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10630 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 64 ? A CYS 64 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 111.1 ? 2 SG ? A CYS 64 ? A CYS 64 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 92 ? A CYS 92 ? 1_555 109.7 ? 3 SG ? A CYS 67 ? A CYS 67 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 92 ? A CYS 92 ? 1_555 112.8 ? 4 SG ? A CYS 64 ? A CYS 64 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 95 ? A CYS 95 ? 1_555 112.0 ? 5 SG ? A CYS 67 ? A CYS 67 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 95 ? A CYS 95 ? 1_555 106.3 ? 6 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 95 ? A CYS 95 ? 1_555 104.9 ? 7 NE2 ? A HIS 109 ? A HIS 109 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 140 ? A CYS 140 ? 1_555 109.3 ? 8 NE2 ? A HIS 109 ? A HIS 109 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 145 ? A HIS 145 ? 1_555 108.5 ? 9 SG ? A CYS 140 ? A CYS 140 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 145 ? A HIS 145 ? 1_555 104.1 ? 10 NE2 ? A HIS 109 ? A HIS 109 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 149 ? A CYS 149 ? 1_555 105.6 ? 11 SG ? A CYS 140 ? A CYS 140 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 149 ? A CYS 149 ? 1_555 117.3 ? 12 ND1 ? A HIS 145 ? A HIS 145 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 149 ? A CYS 149 ? 1_555 111.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-02-03 2 'Structure model' 1 1 2022-08-24 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_database_2.pdbx_DOI' 14 2 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 6XV2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'RYMV P1' 300 ? uM '[U-99% 15N]' 1 NaCl 100 ? mM None 1 DTT 1 ? mM None 1 Na2SO4 60 ? mM None 1 TRIS 25 ? mM None 2 'RYMV P1' 500 ? uM 15N 2 'Pf1 phage' 7 ? mg/mL None 2 NaCl 200 ? mM None 2 TRIS 25 ? mM None 2 DTT 1 ? mM None 3 'RYMV P1' 200 ? uM '[U-99% 13C; U-99% 15N]' 3 'sodium chloride' 100 ? mM None 3 TRIS 25 ? mM None 3 DTT 1 ? mM None 3 Na2SO4 60 ? mM None # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 139 ? ? -167.25 93.03 2 2 ALA A 139 ? ? -167.14 93.12 3 3 ALA A 139 ? ? -167.12 93.10 4 4 ALA A 139 ? ? -167.10 93.09 5 5 ALA A 139 ? ? -167.13 92.99 6 6 ALA A 139 ? ? -167.20 93.08 7 7 ALA A 139 ? ? -167.15 93.11 8 8 ALA A 139 ? ? -167.23 93.10 9 9 ALA A 139 ? ? -167.15 93.14 10 10 ALA A 139 ? ? -167.09 93.15 11 11 ALA A 139 ? ? -167.14 93.09 12 12 ALA A 139 ? ? -167.08 93.11 13 13 ALA A 139 ? ? -167.19 93.08 14 14 ALA A 139 ? ? -167.11 93.10 # _pdbx_audit_support.funding_organization 'French National Research Agency' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ANR-10-INBS-05 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #