data_6Y3I # _entry.id 6Y3I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6Y3I WWPDB D_1292106599 BMRB 27961 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27961 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6Y3I _pdbx_database_status.recvd_initial_deposition_date 2020-02-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fuehrer, S.' 1 ? 'Kamenik, A.S.' 2 ? 'Zeindl, R.' 3 ? 'Nothegger, B.' 4 ? 'Hofer, F.' 5 ? 'Reider, N.' 6 ? 'Liedl, K.R.' 7 ? 'Tollinger, M.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 4173 _citation.page_last 4173 _citation.title 'Inverse relation between structural flexibility and IgE reactivity of Cor a 1 hazelnut allergens.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-021-83705-z _citation.pdbx_database_id_PubMed 33603065 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fuhrer, S.' 1 ? primary 'Kamenik, A.S.' 2 ? primary 'Zeindl, R.' 3 ? primary 'Nothegger, B.' 4 ? primary 'Hofer, F.' 5 ? primary 'Reider, N.' 6 ? primary 'Liedl, K.R.' 7 ? primary 'Tollinger, M.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major allergen variant Cor a 1.0402' _entity.formula_weight 17404.762 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFK YCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC ; _entity_poly.pdbx_seq_one_letter_code_can ;GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFK YCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 PHE n 1 4 SER n 1 5 TYR n 1 6 GLU n 1 7 ASP n 1 8 GLU n 1 9 ALA n 1 10 THR n 1 11 SER n 1 12 VAL n 1 13 ILE n 1 14 PRO n 1 15 PRO n 1 16 ALA n 1 17 ARG n 1 18 LEU n 1 19 PHE n 1 20 LYS n 1 21 SER n 1 22 PHE n 1 23 VAL n 1 24 LEU n 1 25 ASP n 1 26 ALA n 1 27 ASP n 1 28 ASN n 1 29 LEU n 1 30 ILE n 1 31 PRO n 1 32 LYS n 1 33 VAL n 1 34 ALA n 1 35 PRO n 1 36 GLN n 1 37 HIS n 1 38 PHE n 1 39 THR n 1 40 GLY n 1 41 ALA n 1 42 GLU n 1 43 ASN n 1 44 LEU n 1 45 GLU n 1 46 GLY n 1 47 ASN n 1 48 GLY n 1 49 GLY n 1 50 PRO n 1 51 GLY n 1 52 THR n 1 53 ILE n 1 54 LYS n 1 55 LYS n 1 56 ILE n 1 57 THR n 1 58 PHE n 1 59 ALA n 1 60 GLU n 1 61 GLY n 1 62 SER n 1 63 GLU n 1 64 PHE n 1 65 LYS n 1 66 TYR n 1 67 MET n 1 68 LYS n 1 69 HIS n 1 70 LYS n 1 71 VAL n 1 72 GLU n 1 73 GLU n 1 74 ILE n 1 75 ASP n 1 76 HIS n 1 77 ALA n 1 78 ASN n 1 79 PHE n 1 80 LYS n 1 81 TYR n 1 82 CYS n 1 83 TYR n 1 84 SER n 1 85 ILE n 1 86 ILE n 1 87 GLU n 1 88 GLY n 1 89 GLY n 1 90 PRO n 1 91 LEU n 1 92 GLY n 1 93 HIS n 1 94 THR n 1 95 LEU n 1 96 GLU n 1 97 LYS n 1 98 ILE n 1 99 SER n 1 100 TYR n 1 101 GLU n 1 102 ILE n 1 103 LYS n 1 104 MET n 1 105 ALA n 1 106 ALA n 1 107 ALA n 1 108 PRO n 1 109 HIS n 1 110 GLY n 1 111 GLY n 1 112 GLY n 1 113 SER n 1 114 ILE n 1 115 LEU n 1 116 LYS n 1 117 ILE n 1 118 THR n 1 119 SER n 1 120 LYS n 1 121 TYR n 1 122 HIS n 1 123 THR n 1 124 LYS n 1 125 GLY n 1 126 ASN n 1 127 ALA n 1 128 SER n 1 129 ILE n 1 130 SER n 1 131 GLU n 1 132 GLU n 1 133 GLU n 1 134 ILE n 1 135 LYS n 1 136 ALA n 1 137 GLY n 1 138 LYS n 1 139 GLU n 1 140 LYS n 1 141 ALA n 1 142 ALA n 1 143 GLY n 1 144 LEU n 1 145 PHE n 1 146 LYS n 1 147 ALA n 1 148 VAL n 1 149 GLU n 1 150 ALA n 1 151 TYR n 1 152 LEU n 1 153 LEU n 1 154 ALA n 1 155 HIS n 1 156 PRO n 1 157 ASP n 1 158 THR n 1 159 TYR n 1 160 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 160 _entity_src_gen.gene_src_common_name 'European hazel' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Corylus avellana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 13451 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant star _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'pET28b (+)' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9FPK4_CORAV _struct_ref.pdbx_db_accession Q9FPK4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFK YCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Y3I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 160 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9FPK4 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 160 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '2D 1H-15N HSQC NH2 only' 1 isotropic 3 1 1 '2D 1H-13C HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HN(CA)CO' 1 isotropic 7 1 1 '3D HNCACB' 1 isotropic 8 1 1 '3D CBCA(CO)NH' 1 isotropic 9 1 1 '3D HCCH-TOCSY' 1 isotropic 10 1 2 '3D 1H-15N TOCSY' 1 isotropic 11 1 1 '3D (H)CC(CO)NH-TOCSY' 1 isotropic 12 1 2 '3D 1H-15N NOESY' 1 isotropic 13 1 1 '3D 1H-13C NOESY' 1 isotropic 14 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength . _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label Conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-99% 13C; U-99% 15N] Cor a 1.0402, 20 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N-13C-Cor a 1.0402' solution ? 2 '0.5 mM [U-99% 15N] Cor a 1.0402, 20 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N-Cor a 1.0402' solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'Direct Drive' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6Y3I _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 6Y3I _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6Y3I _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 3 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 4 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Y3I _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6Y3I _struct.title 'NMR solution structure of the hazelnut allergen Cor a 1.0402' _struct.pdbx_descriptor 'Major allergen variant Cor a 1.0402' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Y3I _struct_keywords.text 'PR-10 related protein, hazelnut allergen, ALLERGEN' _struct_keywords.pdbx_keywords ALLERGEN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 15 ? LEU A 24 ? PRO A 15 LEU A 24 1 ? 10 HELX_P HELX_P2 AA2 ALA A 26 ? ALA A 34 ? ALA A 26 ALA A 34 1 ? 9 HELX_P HELX_P3 AA3 GLU A 131 ? HIS A 155 ? GLU A 131 HIS A 155 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 2 ? SER A 11 ? VAL A 2 SER A 11 AA1 2 GLY A 112 ? THR A 123 ? GLY A 112 THR A 123 AA1 3 GLU A 96 ? ALA A 106 ? GLU A 96 ALA A 106 AA1 4 PHE A 79 ? GLU A 87 ? PHE A 79 GLU A 87 AA1 5 PHE A 64 ? ASP A 75 ? PHE A 64 ASP A 75 AA1 6 GLY A 51 ? ALA A 59 ? GLY A 51 ALA A 59 AA1 7 THR A 39 ? GLU A 45 ? THR A 39 GLU A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 9 ? N ALA A 9 O LEU A 115 ? O LEU A 115 AA1 2 3 O THR A 118 ? O THR A 118 N GLU A 101 ? N GLU A 101 AA1 3 4 O TYR A 100 ? O TYR A 100 N TYR A 83 ? N TYR A 83 AA1 4 5 N SER A 84 ? N SER A 84 O LYS A 70 ? O LYS A 70 AA1 5 6 O HIS A 69 ? O HIS A 69 N LYS A 54 ? N LYS A 54 AA1 6 7 O LYS A 55 ? O LYS A 55 N GLU A 42 ? N GLU A 42 # _atom_sites.entry_id 6Y3I _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 CYS 160 160 160 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8830 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-02-17 2 'Structure model' 1 1 2021-03-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.name' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Cor a 1.0402' 0.5 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 DTT 2 ? mM 'natural abundance' 2 'Cor a 1.0402' 0.5 ? mM '[U-99% 15N]' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 DTT 2 ? mM 'natural abundance' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.72 120.30 3.42 0.50 N 2 2 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.86 120.30 3.56 0.50 N 3 3 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 124.05 120.30 3.75 0.50 N 4 4 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.35 120.30 3.05 0.50 N 5 5 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 124.26 120.30 3.96 0.50 N 6 7 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.59 120.30 3.29 0.50 N 7 8 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.85 120.30 3.55 0.50 N 8 8 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 117.17 120.30 -3.13 0.50 N 9 9 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.72 120.30 3.42 0.50 N 10 10 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.78 120.30 3.48 0.50 N 11 12 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.51 120.30 3.21 0.50 N 12 14 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.85 120.30 3.55 0.50 N 13 17 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.66 120.30 3.36 0.50 N 14 18 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 124.48 120.30 4.18 0.50 N 15 20 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.35 120.30 3.05 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 59 ? ? -148.10 -40.36 2 1 GLU A 60 ? ? 30.36 68.73 3 2 ALA A 59 ? ? -143.86 -35.16 4 2 GLU A 60 ? ? 29.65 72.48 5 3 ALA A 59 ? ? -153.67 33.19 6 4 ALA A 59 ? ? -142.76 -39.26 7 4 SER A 62 ? ? 62.83 -5.21 8 5 ALA A 59 ? ? -144.80 40.90 9 5 GLU A 60 ? ? -65.91 85.12 10 5 SER A 62 ? ? 63.02 -8.80 11 5 HIS A 109 ? ? -69.92 0.59 12 6 ALA A 34 ? ? -145.43 57.78 13 6 ALA A 59 ? ? -139.81 -58.07 14 6 SER A 62 ? ? 59.28 -28.39 15 6 GLU A 63 ? ? -63.36 89.45 16 6 THR A 94 ? ? -138.70 -35.44 17 7 ALA A 59 ? ? -145.96 -36.50 18 7 GLU A 60 ? ? 32.96 70.38 19 7 SER A 62 ? ? 59.19 12.91 20 8 ALA A 59 ? ? -135.93 -67.67 21 8 SER A 62 ? ? 62.78 -31.73 22 9 ALA A 59 ? ? -149.35 -40.90 23 9 SER A 62 ? ? 59.37 -52.00 24 10 ALA A 59 ? ? -137.55 -35.90 25 11 ALA A 59 ? ? -143.95 -32.27 26 11 GLU A 60 ? ? 38.91 58.18 27 11 PRO A 156 ? ? -59.46 -5.34 28 12 ALA A 59 ? ? -152.75 -36.29 29 13 ALA A 59 ? ? -132.97 -34.23 30 13 SER A 62 ? ? 60.59 -8.40 31 14 ALA A 59 ? ? -144.98 -41.63 32 15 SER A 62 ? ? 58.89 -4.00 33 16 ALA A 59 ? ? -149.79 -40.34 34 16 SER A 62 ? ? 66.06 -34.10 35 16 GLU A 63 ? ? -68.95 94.49 36 17 ALA A 34 ? ? -140.02 54.82 37 17 SER A 62 ? ? 61.04 -39.64 38 17 GLU A 63 ? ? -69.03 70.42 39 18 ALA A 34 ? ? -141.73 58.21 40 18 ALA A 59 ? ? -156.09 40.36 41 18 SER A 62 ? ? 64.35 -22.41 42 20 ALA A 59 ? ? -149.13 34.73 43 20 SER A 62 ? ? 61.10 -28.07 44 20 ILE A 85 ? ? -59.90 104.87 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 SER A 84 ? ? ILE A 85 ? ? 148.90 2 1 ILE A 85 ? ? ILE A 86 ? ? 140.86 3 1 THR A 94 ? ? LEU A 95 ? ? 143.55 4 2 SER A 84 ? ? ILE A 85 ? ? 146.34 5 3 ILE A 85 ? ? ILE A 86 ? ? 148.68 6 4 SER A 84 ? ? ILE A 85 ? ? 141.40 7 4 THR A 94 ? ? LEU A 95 ? ? 147.52 8 5 SER A 84 ? ? ILE A 85 ? ? 149.32 9 5 ILE A 85 ? ? ILE A 86 ? ? 147.91 10 6 SER A 84 ? ? ILE A 85 ? ? 145.83 11 6 ILE A 85 ? ? ILE A 86 ? ? 149.78 12 6 THR A 94 ? ? LEU A 95 ? ? 139.64 13 7 SER A 84 ? ? ILE A 85 ? ? 145.22 14 8 SER A 84 ? ? ILE A 85 ? ? 144.08 15 8 ILE A 85 ? ? ILE A 86 ? ? 147.35 16 8 THR A 94 ? ? LEU A 95 ? ? 146.44 17 9 SER A 84 ? ? ILE A 85 ? ? 146.56 18 10 SER A 84 ? ? ILE A 85 ? ? 144.54 19 11 SER A 84 ? ? ILE A 85 ? ? 141.21 20 11 ILE A 85 ? ? ILE A 86 ? ? 143.38 21 12 SER A 84 ? ? ILE A 85 ? ? 146.37 22 13 ILE A 85 ? ? ILE A 86 ? ? 148.75 23 14 ILE A 85 ? ? ILE A 86 ? ? 148.72 24 14 MET A 104 ? ? ALA A 105 ? ? 149.68 25 15 SER A 84 ? ? ILE A 85 ? ? 149.85 26 15 ILE A 85 ? ? ILE A 86 ? ? 145.77 27 16 SER A 84 ? ? ILE A 85 ? ? 140.33 28 17 SER A 84 ? ? ILE A 85 ? ? 142.14 29 17 THR A 94 ? ? LEU A 95 ? ? 142.07 30 17 MET A 104 ? ? ALA A 105 ? ? 149.43 31 18 SER A 84 ? ? ILE A 85 ? ? 144.98 32 18 THR A 94 ? ? LEU A 95 ? ? 144.50 33 19 ILE A 85 ? ? ILE A 86 ? ? 146.98 34 20 SER A 84 ? ? ILE A 85 ? ? 141.02 35 20 ILE A 85 ? ? ILE A 86 ? ? 148.88 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 81 ? ? 0.094 'SIDE CHAIN' 2 2 TYR A 81 ? ? 0.101 'SIDE CHAIN' 3 4 TYR A 81 ? ? 0.108 'SIDE CHAIN' 4 5 TYR A 81 ? ? 0.105 'SIDE CHAIN' 5 6 TYR A 81 ? ? 0.097 'SIDE CHAIN' 6 7 TYR A 81 ? ? 0.106 'SIDE CHAIN' 7 8 TYR A 81 ? ? 0.101 'SIDE CHAIN' 8 9 TYR A 81 ? ? 0.110 'SIDE CHAIN' 9 10 TYR A 81 ? ? 0.092 'SIDE CHAIN' 10 11 TYR A 81 ? ? 0.117 'SIDE CHAIN' 11 12 TYR A 81 ? ? 0.107 'SIDE CHAIN' 12 13 TYR A 81 ? ? 0.106 'SIDE CHAIN' 13 15 TYR A 81 ? ? 0.104 'SIDE CHAIN' 14 15 TYR A 159 ? ? 0.071 'SIDE CHAIN' 15 16 TYR A 81 ? ? 0.103 'SIDE CHAIN' 16 17 TYR A 81 ? ? 0.113 'SIDE CHAIN' 17 18 TYR A 81 ? ? 0.110 'SIDE CHAIN' 18 19 TYR A 81 ? ? 0.112 'SIDE CHAIN' 19 20 TYR A 81 ? ? 0.098 'SIDE CHAIN' # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Austrian Science Fund' Austria P26849 1 'Austrian Research Promotion Agency' Austria 858017 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #