data_6Y8F # _entry.id 6Y8F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Y8F pdb_00006y8f 10.2210/pdb6y8f/pdb WWPDB D_1292107119 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-31 2 'Structure model' 1 1 2022-05-04 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_database_2.pdbx_DOI' 10 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Y8F _pdbx_database_status.recvd_initial_deposition_date 2020-03-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hehemann, J.H.' 1 0000-0002-8700-2564 'Solanki, V.A.' 2 0000-0003-0354-9296 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Isme J' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1751-7370 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Glycoside hydrolase from the GH76 family indicates that marine Salegentibacter sp. Hel_I_6 consumes alpha-mannan from fungi.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41396-022-01223-w _citation.pdbx_database_id_PubMed 35414716 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Solanki, V.' 1 ? primary 'Kruger, K.' 2 0000-0001-7579-8414 primary 'Crawford, C.J.' 3 0000-0002-1314-1019 primary 'Pardo-Vargas, A.' 4 ? primary 'Danglad-Flores, J.' 5 ? primary 'Hoang, K.L.M.' 6 ? primary 'Klassen, L.' 7 ? primary 'Abbott, D.W.' 8 ? primary 'Seeberger, P.H.' 9 ? primary 'Amann, R.I.' 10 0000-0002-0846-7372 primary 'Teeling, H.' 11 0000-0003-1889-7859 primary 'Hehemann, J.H.' 12 0000-0002-8700-2564 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Alpha-1,6-endo-mannanase GH76A mutant' 43876.734 1 ? ? ? ? 2 branched man 'alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose' 504.438 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? 4 water nat water 18.015 439 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMASSADDDGIDDVQEEEEEQPVEPGEEEDDEVADWGEVAENLQEQTYNIYLTSNGTFRQD NEGNENFNYWWNAHMLDVLIDGYERTGDESYLPKMKSLLEGIEVRNGNKYENVFINNMEWLGIACLRTYKLTNDQQYKEV ADLLWEETKQGWSDVHGGGIAWKTDTPNSKNACSNGPAAIFALYLYEIDQDEEDLEWAKKIYHWLKDTLVDPESGLVWDN IDYHDGEAIINRDWIFTYNVGTYIGAANLLHQATGEGMYLDDAIKSASSVVAPGELTTGGVLKNEGQGDGGLFKGILVRY FTQLALNPDLPDGKRNEFEEFVLFNAETLYHNGLTSAGLAGPNWNDEPSGRVDLSTQLSGVMLMEAKALLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMASSADDDGIDDVQEEEEEQPVEPGEEEDDEVADWGEVAENLQEQTYNIYLTSNGTFRQD NEGNENFNYWWNAHMLDVLIDGYERTGDESYLPKMKSLLEGIEVRNGNKYENVFINNMEWLGIACLRTYKLTNDQQYKEV ADLLWEETKQGWSDVHGGGIAWKTDTPNSKNACSNGPAAIFALYLYEIDQDEEDLEWAKKIYHWLKDTLVDPESGLVWDN IDYHDGEAIINRDWIFTYNVGTYIGAANLLHQATGEGMYLDDAIKSASSVVAPGELTTGGVLKNEGQGDGGLFKGILVRY FTQLALNPDLPDGKRNEFEEFVLFNAETLYHNGLTSAGLAGPNWNDEPSGRVDLSTQLSGVMLMEAKALLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 SER n 1 24 SER n 1 25 ALA n 1 26 ASP n 1 27 ASP n 1 28 ASP n 1 29 GLY n 1 30 ILE n 1 31 ASP n 1 32 ASP n 1 33 VAL n 1 34 GLN n 1 35 GLU n 1 36 GLU n 1 37 GLU n 1 38 GLU n 1 39 GLU n 1 40 GLN n 1 41 PRO n 1 42 VAL n 1 43 GLU n 1 44 PRO n 1 45 GLY n 1 46 GLU n 1 47 GLU n 1 48 GLU n 1 49 ASP n 1 50 ASP n 1 51 GLU n 1 52 VAL n 1 53 ALA n 1 54 ASP n 1 55 TRP n 1 56 GLY n 1 57 GLU n 1 58 VAL n 1 59 ALA n 1 60 GLU n 1 61 ASN n 1 62 LEU n 1 63 GLN n 1 64 GLU n 1 65 GLN n 1 66 THR n 1 67 TYR n 1 68 ASN n 1 69 ILE n 1 70 TYR n 1 71 LEU n 1 72 THR n 1 73 SER n 1 74 ASN n 1 75 GLY n 1 76 THR n 1 77 PHE n 1 78 ARG n 1 79 GLN n 1 80 ASP n 1 81 ASN n 1 82 GLU n 1 83 GLY n 1 84 ASN n 1 85 GLU n 1 86 ASN n 1 87 PHE n 1 88 ASN n 1 89 TYR n 1 90 TRP n 1 91 TRP n 1 92 ASN n 1 93 ALA n 1 94 HIS n 1 95 MET n 1 96 LEU n 1 97 ASP n 1 98 VAL n 1 99 LEU n 1 100 ILE n 1 101 ASP n 1 102 GLY n 1 103 TYR n 1 104 GLU n 1 105 ARG n 1 106 THR n 1 107 GLY n 1 108 ASP n 1 109 GLU n 1 110 SER n 1 111 TYR n 1 112 LEU n 1 113 PRO n 1 114 LYS n 1 115 MET n 1 116 LYS n 1 117 SER n 1 118 LEU n 1 119 LEU n 1 120 GLU n 1 121 GLY n 1 122 ILE n 1 123 GLU n 1 124 VAL n 1 125 ARG n 1 126 ASN n 1 127 GLY n 1 128 ASN n 1 129 LYS n 1 130 TYR n 1 131 GLU n 1 132 ASN n 1 133 VAL n 1 134 PHE n 1 135 ILE n 1 136 ASN n 1 137 ASN n 1 138 MET n 1 139 GLU n 1 140 TRP n 1 141 LEU n 1 142 GLY n 1 143 ILE n 1 144 ALA n 1 145 CYS n 1 146 LEU n 1 147 ARG n 1 148 THR n 1 149 TYR n 1 150 LYS n 1 151 LEU n 1 152 THR n 1 153 ASN n 1 154 ASP n 1 155 GLN n 1 156 GLN n 1 157 TYR n 1 158 LYS n 1 159 GLU n 1 160 VAL n 1 161 ALA n 1 162 ASP n 1 163 LEU n 1 164 LEU n 1 165 TRP n 1 166 GLU n 1 167 GLU n 1 168 THR n 1 169 LYS n 1 170 GLN n 1 171 GLY n 1 172 TRP n 1 173 SER n 1 174 ASP n 1 175 VAL n 1 176 HIS n 1 177 GLY n 1 178 GLY n 1 179 GLY n 1 180 ILE n 1 181 ALA n 1 182 TRP n 1 183 LYS n 1 184 THR n 1 185 ASP n 1 186 THR n 1 187 PRO n 1 188 ASN n 1 189 SER n 1 190 LYS n 1 191 ASN n 1 192 ALA n 1 193 CYS n 1 194 SER n 1 195 ASN n 1 196 GLY n 1 197 PRO n 1 198 ALA n 1 199 ALA n 1 200 ILE n 1 201 PHE n 1 202 ALA n 1 203 LEU n 1 204 TYR n 1 205 LEU n 1 206 TYR n 1 207 GLU n 1 208 ILE n 1 209 ASP n 1 210 GLN n 1 211 ASP n 1 212 GLU n 1 213 GLU n 1 214 ASP n 1 215 LEU n 1 216 GLU n 1 217 TRP n 1 218 ALA n 1 219 LYS n 1 220 LYS n 1 221 ILE n 1 222 TYR n 1 223 HIS n 1 224 TRP n 1 225 LEU n 1 226 LYS n 1 227 ASP n 1 228 THR n 1 229 LEU n 1 230 VAL n 1 231 ASP n 1 232 PRO n 1 233 GLU n 1 234 SER n 1 235 GLY n 1 236 LEU n 1 237 VAL n 1 238 TRP n 1 239 ASP n 1 240 ASN n 1 241 ILE n 1 242 ASP n 1 243 TYR n 1 244 HIS n 1 245 ASP n 1 246 GLY n 1 247 GLU n 1 248 ALA n 1 249 ILE n 1 250 ILE n 1 251 ASN n 1 252 ARG n 1 253 ASP n 1 254 TRP n 1 255 ILE n 1 256 PHE n 1 257 THR n 1 258 TYR n 1 259 ASN n 1 260 VAL n 1 261 GLY n 1 262 THR n 1 263 TYR n 1 264 ILE n 1 265 GLY n 1 266 ALA n 1 267 ALA n 1 268 ASN n 1 269 LEU n 1 270 LEU n 1 271 HIS n 1 272 GLN n 1 273 ALA n 1 274 THR n 1 275 GLY n 1 276 GLU n 1 277 GLY n 1 278 MET n 1 279 TYR n 1 280 LEU n 1 281 ASP n 1 282 ASP n 1 283 ALA n 1 284 ILE n 1 285 LYS n 1 286 SER n 1 287 ALA n 1 288 SER n 1 289 SER n 1 290 VAL n 1 291 VAL n 1 292 ALA n 1 293 PRO n 1 294 GLY n 1 295 GLU n 1 296 LEU n 1 297 THR n 1 298 THR n 1 299 GLY n 1 300 GLY n 1 301 VAL n 1 302 LEU n 1 303 LYS n 1 304 ASN n 1 305 GLU n 1 306 GLY n 1 307 GLN n 1 308 GLY n 1 309 ASP n 1 310 GLY n 1 311 GLY n 1 312 LEU n 1 313 PHE n 1 314 LYS n 1 315 GLY n 1 316 ILE n 1 317 LEU n 1 318 VAL n 1 319 ARG n 1 320 TYR n 1 321 PHE n 1 322 THR n 1 323 GLN n 1 324 LEU n 1 325 ALA n 1 326 LEU n 1 327 ASN n 1 328 PRO n 1 329 ASP n 1 330 LEU n 1 331 PRO n 1 332 ASP n 1 333 GLY n 1 334 LYS n 1 335 ARG n 1 336 ASN n 1 337 GLU n 1 338 PHE n 1 339 GLU n 1 340 GLU n 1 341 PHE n 1 342 VAL n 1 343 LEU n 1 344 PHE n 1 345 ASN n 1 346 ALA n 1 347 GLU n 1 348 THR n 1 349 LEU n 1 350 TYR n 1 351 HIS n 1 352 ASN n 1 353 GLY n 1 354 LEU n 1 355 THR n 1 356 SER n 1 357 ALA n 1 358 GLY n 1 359 LEU n 1 360 ALA n 1 361 GLY n 1 362 PRO n 1 363 ASN n 1 364 TRP n 1 365 ASN n 1 366 ASP n 1 367 GLU n 1 368 PRO n 1 369 SER n 1 370 GLY n 1 371 ARG n 1 372 VAL n 1 373 ASP n 1 374 LEU n 1 375 SER n 1 376 THR n 1 377 GLN n 1 378 LEU n 1 379 SER n 1 380 GLY n 1 381 VAL n 1 382 MET n 1 383 LEU n 1 384 MET n 1 385 GLU n 1 386 ALA n 1 387 LYS n 1 388 ALA n 1 389 LEU n 1 390 LEU n 1 391 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 391 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salegentibacter sp. Hel_I_6' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1250278 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'BL21 DE3' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpa1-6DManpa1-6DManpa1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,3,2/[a1122h-1a_1-5]/1-1-1/a6-b1_b6-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][a-D-Manp]{[(6+1)][a-D-Manp]{[(6+1)][a-D-Manp]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 MAN C1 O1 1 MAN O6 HO6 sing ? 2 2 3 MAN C1 O1 2 MAN O6 HO6 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose 'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 MET 21 21 ? ? ? A . n A 1 22 ALA 22 22 ? ? ? A . n A 1 23 SER 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 ALA 25 25 ? ? ? A . n A 1 26 ASP 26 26 ? ? ? A . n A 1 27 ASP 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 GLY 29 29 ? ? ? A . n A 1 30 ILE 30 30 ? ? ? A . n A 1 31 ASP 31 31 ? ? ? A . n A 1 32 ASP 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 GLN 34 34 ? ? ? A . n A 1 35 GLU 35 35 ? ? ? A . n A 1 36 GLU 36 36 ? ? ? A . n A 1 37 GLU 37 37 ? ? ? A . n A 1 38 GLU 38 38 ? ? ? A . n A 1 39 GLU 39 39 ? ? ? A . n A 1 40 GLN 40 40 ? ? ? A . n A 1 41 PRO 41 41 ? ? ? A . n A 1 42 VAL 42 42 ? ? ? A . n A 1 43 GLU 43 43 ? ? ? A . n A 1 44 PRO 44 44 ? ? ? A . n A 1 45 GLY 45 45 ? ? ? A . n A 1 46 GLU 46 46 ? ? ? A . n A 1 47 GLU 47 47 ? ? ? A . n A 1 48 GLU 48 48 ? ? ? A . n A 1 49 ASP 49 49 ? ? ? A . n A 1 50 ASP 50 50 ? ? ? A . n A 1 51 GLU 51 51 ? ? ? A . n A 1 52 VAL 52 52 ? ? ? A . n A 1 53 ALA 53 53 ? ? ? A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 MET 115 115 115 MET MET A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 TRP 140 140 140 TRP TRP A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 CYS 145 145 145 CYS CYS A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 TRP 165 165 165 TRP TRP A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 TRP 172 172 172 TRP TRP A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 TRP 182 182 182 TRP TRP A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 CYS 193 193 193 CYS CYS A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 TRP 217 217 217 TRP TRP A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 TYR 222 222 222 TYR TYR A . n A 1 223 HIS 223 223 223 HIS HIS A . n A 1 224 TRP 224 224 224 TRP TRP A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 LYS 226 226 226 LYS LYS A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 PRO 232 232 232 PRO PRO A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 SER 234 234 234 SER SER A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 TRP 238 238 238 TRP TRP A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 ASN 240 240 240 ASN ASN A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 ASP 242 242 242 ASP ASP A . n A 1 243 TYR 243 243 243 TYR TYR A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 ASN 251 251 251 ASN ASN A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 TRP 254 254 254 TRP TRP A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 TYR 258 258 258 TYR TYR A . n A 1 259 ASN 259 259 259 ASN ASN A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 THR 262 262 262 THR THR A . n A 1 263 TYR 263 263 263 TYR TYR A . n A 1 264 ILE 264 264 264 ILE ILE A . n A 1 265 GLY 265 265 265 GLY GLY A . n A 1 266 ALA 266 266 266 ALA ALA A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 HIS 271 271 271 HIS HIS A . n A 1 272 GLN 272 272 272 GLN GLN A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 THR 274 274 274 THR THR A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 MET 278 278 278 MET MET A . n A 1 279 TYR 279 279 279 TYR TYR A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 ASP 282 282 282 ASP ASP A . n A 1 283 ALA 283 283 283 ALA ALA A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 LYS 285 285 285 LYS LYS A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 SER 289 289 289 SER SER A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 VAL 291 291 291 VAL VAL A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 PRO 293 293 293 PRO PRO A . n A 1 294 GLY 294 294 294 GLY GLY A . n A 1 295 GLU 295 295 295 GLU GLU A . n A 1 296 LEU 296 296 296 LEU LEU A . n A 1 297 THR 297 297 297 THR THR A . n A 1 298 THR 298 298 298 THR THR A . n A 1 299 GLY 299 299 299 GLY GLY A . n A 1 300 GLY 300 300 300 GLY GLY A . n A 1 301 VAL 301 301 301 VAL VAL A . n A 1 302 LEU 302 302 302 LEU LEU A . n A 1 303 LYS 303 303 303 LYS LYS A . n A 1 304 ASN 304 304 304 ASN ASN A . n A 1 305 GLU 305 305 305 GLU GLU A . n A 1 306 GLY 306 306 306 GLY GLY A . n A 1 307 GLN 307 307 307 GLN GLN A . n A 1 308 GLY 308 308 308 GLY GLY A . n A 1 309 ASP 309 309 309 ASP ASP A . n A 1 310 GLY 310 310 310 GLY GLY A . n A 1 311 GLY 311 311 311 GLY GLY A . n A 1 312 LEU 312 312 312 LEU LEU A . n A 1 313 PHE 313 313 313 PHE PHE A . n A 1 314 LYS 314 314 314 LYS LYS A . n A 1 315 GLY 315 315 315 GLY GLY A . n A 1 316 ILE 316 316 316 ILE ILE A . n A 1 317 LEU 317 317 317 LEU LEU A . n A 1 318 VAL 318 318 318 VAL VAL A . n A 1 319 ARG 319 319 319 ARG ARG A . n A 1 320 TYR 320 320 320 TYR TYR A . n A 1 321 PHE 321 321 321 PHE PHE A . n A 1 322 THR 322 322 322 THR THR A . n A 1 323 GLN 323 323 323 GLN GLN A . n A 1 324 LEU 324 324 324 LEU LEU A . n A 1 325 ALA 325 325 325 ALA ALA A . n A 1 326 LEU 326 326 326 LEU LEU A . n A 1 327 ASN 327 327 327 ASN ASN A . n A 1 328 PRO 328 328 328 PRO PRO A . n A 1 329 ASP 329 329 329 ASP ASP A . n A 1 330 LEU 330 330 330 LEU LEU A . n A 1 331 PRO 331 331 331 PRO PRO A . n A 1 332 ASP 332 332 332 ASP ASP A . n A 1 333 GLY 333 333 333 GLY GLY A . n A 1 334 LYS 334 334 334 LYS LYS A . n A 1 335 ARG 335 335 335 ARG ARG A . n A 1 336 ASN 336 336 336 ASN ASN A . n A 1 337 GLU 337 337 337 GLU GLU A . n A 1 338 PHE 338 338 338 PHE PHE A . n A 1 339 GLU 339 339 339 GLU GLU A . n A 1 340 GLU 340 340 340 GLU GLU A . n A 1 341 PHE 341 341 341 PHE PHE A . n A 1 342 VAL 342 342 342 VAL VAL A . n A 1 343 LEU 343 343 343 LEU LEU A . n A 1 344 PHE 344 344 344 PHE PHE A . n A 1 345 ASN 345 345 345 ASN ASN A . n A 1 346 ALA 346 346 346 ALA ALA A . n A 1 347 GLU 347 347 347 GLU GLU A . n A 1 348 THR 348 348 348 THR THR A . n A 1 349 LEU 349 349 349 LEU LEU A . n A 1 350 TYR 350 350 350 TYR TYR A . n A 1 351 HIS 351 351 351 HIS HIS A . n A 1 352 ASN 352 352 352 ASN ASN A . n A 1 353 GLY 353 353 353 GLY GLY A . n A 1 354 LEU 354 354 354 LEU LEU A . n A 1 355 THR 355 355 355 THR THR A . n A 1 356 SER 356 356 356 SER SER A . n A 1 357 ALA 357 357 357 ALA ALA A . n A 1 358 GLY 358 358 358 GLY GLY A . n A 1 359 LEU 359 359 359 LEU LEU A . n A 1 360 ALA 360 360 360 ALA ALA A . n A 1 361 GLY 361 361 361 GLY GLY A . n A 1 362 PRO 362 362 362 PRO PRO A . n A 1 363 ASN 363 363 363 ASN ASN A . n A 1 364 TRP 364 364 364 TRP TRP A . n A 1 365 ASN 365 365 365 ASN ASN A . n A 1 366 ASP 366 366 366 ASP ASP A . n A 1 367 GLU 367 367 367 GLU GLU A . n A 1 368 PRO 368 368 368 PRO PRO A . n A 1 369 SER 369 369 369 SER SER A . n A 1 370 GLY 370 370 370 GLY GLY A . n A 1 371 ARG 371 371 371 ARG ARG A . n A 1 372 VAL 372 372 372 VAL VAL A . n A 1 373 ASP 373 373 373 ASP ASP A . n A 1 374 LEU 374 374 374 LEU LEU A . n A 1 375 SER 375 375 375 SER SER A . n A 1 376 THR 376 376 376 THR THR A . n A 1 377 GLN 377 377 377 GLN GLN A . n A 1 378 LEU 378 378 378 LEU LEU A . n A 1 379 SER 379 379 379 SER SER A . n A 1 380 GLY 380 380 380 GLY GLY A . n A 1 381 VAL 381 381 381 VAL VAL A . n A 1 382 MET 382 382 382 MET MET A . n A 1 383 LEU 383 383 383 LEU LEU A . n A 1 384 MET 384 384 384 MET MET A . n A 1 385 GLU 385 385 385 GLU GLU A . n A 1 386 ALA 386 386 386 ALA ALA A . n A 1 387 LYS 387 387 387 LYS LYS A . n A 1 388 ALA 388 388 388 ALA ALA A . n A 1 389 LEU 389 389 389 LEU LEU A . n A 1 390 LEU 390 390 390 LEU LEU A . n A 1 391 GLU 391 391 391 GLU GLU A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 MAN 1 B MAN 1 B MAN 1 n B 2 MAN 2 B MAN 2 B MAN 2 n B 2 MAN 3 B MAN 3 B MAN 3 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 404 1 CA CA A . D 3 CA 1 405 2 CA CA A . E 3 CA 1 406 3 CA CA A . F 4 HOH 1 501 327 HOH HOH A . F 4 HOH 2 502 412 HOH HOH A . F 4 HOH 3 503 460 HOH HOH A . F 4 HOH 4 504 253 HOH HOH A . F 4 HOH 5 505 448 HOH HOH A . F 4 HOH 6 506 210 HOH HOH A . F 4 HOH 7 507 211 HOH HOH A . F 4 HOH 8 508 193 HOH HOH A . F 4 HOH 9 509 379 HOH HOH A . F 4 HOH 10 510 155 HOH HOH A . F 4 HOH 11 511 65 HOH HOH A . F 4 HOH 12 512 228 HOH HOH A . F 4 HOH 13 513 415 HOH HOH A . F 4 HOH 14 514 292 HOH HOH A . F 4 HOH 15 515 200 HOH HOH A . F 4 HOH 16 516 241 HOH HOH A . F 4 HOH 17 517 390 HOH HOH A . F 4 HOH 18 518 351 HOH HOH A . F 4 HOH 19 519 300 HOH HOH A . F 4 HOH 20 520 236 HOH HOH A . F 4 HOH 21 521 217 HOH HOH A . F 4 HOH 22 522 254 HOH HOH A . F 4 HOH 23 523 441 HOH HOH A . F 4 HOH 24 524 78 HOH HOH A . F 4 HOH 25 525 195 HOH HOH A . F 4 HOH 26 526 359 HOH HOH A . F 4 HOH 27 527 343 HOH HOH A . F 4 HOH 28 528 219 HOH HOH A . F 4 HOH 29 529 373 HOH HOH A . F 4 HOH 30 530 348 HOH HOH A . F 4 HOH 31 531 443 HOH HOH A . F 4 HOH 32 532 232 HOH HOH A . F 4 HOH 33 533 216 HOH HOH A . F 4 HOH 34 534 290 HOH HOH A . F 4 HOH 35 535 281 HOH HOH A . F 4 HOH 36 536 222 HOH HOH A . F 4 HOH 37 537 319 HOH HOH A . F 4 HOH 38 538 395 HOH HOH A . F 4 HOH 39 539 330 HOH HOH A . F 4 HOH 40 540 190 HOH HOH A . F 4 HOH 41 541 413 HOH HOH A . F 4 HOH 42 542 103 HOH HOH A . F 4 HOH 43 543 257 HOH HOH A . F 4 HOH 44 544 234 HOH HOH A . F 4 HOH 45 545 377 HOH HOH A . F 4 HOH 46 546 160 HOH HOH A . F 4 HOH 47 547 411 HOH HOH A . F 4 HOH 48 548 164 HOH HOH A . F 4 HOH 49 549 423 HOH HOH A . F 4 HOH 50 550 106 HOH HOH A . F 4 HOH 51 551 421 HOH HOH A . F 4 HOH 52 552 73 HOH HOH A . F 4 HOH 53 553 302 HOH HOH A . F 4 HOH 54 554 44 HOH HOH A . F 4 HOH 55 555 159 HOH HOH A . F 4 HOH 56 556 172 HOH HOH A . F 4 HOH 57 557 414 HOH HOH A . F 4 HOH 58 558 168 HOH HOH A . F 4 HOH 59 559 105 HOH HOH A . F 4 HOH 60 560 40 HOH HOH A . F 4 HOH 61 561 102 HOH HOH A . F 4 HOH 62 562 225 HOH HOH A . F 4 HOH 63 563 214 HOH HOH A . F 4 HOH 64 564 93 HOH HOH A . F 4 HOH 65 565 79 HOH HOH A . F 4 HOH 66 566 416 HOH HOH A . F 4 HOH 67 567 263 HOH HOH A . F 4 HOH 68 568 115 HOH HOH A . F 4 HOH 69 569 72 HOH HOH A . F 4 HOH 70 570 199 HOH HOH A . F 4 HOH 71 571 17 HOH HOH A . F 4 HOH 72 572 58 HOH HOH A . F 4 HOH 73 573 394 HOH HOH A . F 4 HOH 74 574 329 HOH HOH A . F 4 HOH 75 575 96 HOH HOH A . F 4 HOH 76 576 124 HOH HOH A . F 4 HOH 77 577 375 HOH HOH A . F 4 HOH 78 578 205 HOH HOH A . F 4 HOH 79 579 54 HOH HOH A . F 4 HOH 80 580 208 HOH HOH A . F 4 HOH 81 581 67 HOH HOH A . F 4 HOH 82 582 392 HOH HOH A . F 4 HOH 83 583 117 HOH HOH A . F 4 HOH 84 584 41 HOH HOH A . F 4 HOH 85 585 30 HOH HOH A . F 4 HOH 86 586 91 HOH HOH A . F 4 HOH 87 587 84 HOH HOH A . F 4 HOH 88 588 92 HOH HOH A . F 4 HOH 89 589 360 HOH HOH A . F 4 HOH 90 590 99 HOH HOH A . F 4 HOH 91 591 4 HOH HOH A . F 4 HOH 92 592 89 HOH HOH A . F 4 HOH 93 593 95 HOH HOH A . F 4 HOH 94 594 382 HOH HOH A . F 4 HOH 95 595 29 HOH HOH A . F 4 HOH 96 596 259 HOH HOH A . F 4 HOH 97 597 9 HOH HOH A . F 4 HOH 98 598 301 HOH HOH A . F 4 HOH 99 599 121 HOH HOH A . F 4 HOH 100 600 82 HOH HOH A . F 4 HOH 101 601 23 HOH HOH A . F 4 HOH 102 602 36 HOH HOH A . F 4 HOH 103 603 11 HOH HOH A . F 4 HOH 104 604 244 HOH HOH A . F 4 HOH 105 605 308 HOH HOH A . F 4 HOH 106 606 109 HOH HOH A . F 4 HOH 107 607 39 HOH HOH A . F 4 HOH 108 608 5 HOH HOH A . F 4 HOH 109 609 86 HOH HOH A . F 4 HOH 110 610 231 HOH HOH A . F 4 HOH 111 611 38 HOH HOH A . F 4 HOH 112 612 197 HOH HOH A . F 4 HOH 113 613 364 HOH HOH A . F 4 HOH 114 614 49 HOH HOH A . F 4 HOH 115 615 138 HOH HOH A . F 4 HOH 116 616 303 HOH HOH A . F 4 HOH 117 617 48 HOH HOH A . F 4 HOH 118 618 246 HOH HOH A . F 4 HOH 119 619 250 HOH HOH A . F 4 HOH 120 620 304 HOH HOH A . F 4 HOH 121 621 169 HOH HOH A . F 4 HOH 122 622 63 HOH HOH A . F 4 HOH 123 623 34 HOH HOH A . F 4 HOH 124 624 380 HOH HOH A . F 4 HOH 125 625 162 HOH HOH A . F 4 HOH 126 626 238 HOH HOH A . F 4 HOH 127 627 353 HOH HOH A . F 4 HOH 128 628 324 HOH HOH A . F 4 HOH 129 629 386 HOH HOH A . F 4 HOH 130 630 198 HOH HOH A . F 4 HOH 131 631 27 HOH HOH A . F 4 HOH 132 632 111 HOH HOH A . F 4 HOH 133 633 247 HOH HOH A . F 4 HOH 134 634 3 HOH HOH A . F 4 HOH 135 635 165 HOH HOH A . F 4 HOH 136 636 369 HOH HOH A . F 4 HOH 137 637 306 HOH HOH A . F 4 HOH 138 638 47 HOH HOH A . F 4 HOH 139 639 85 HOH HOH A . F 4 HOH 140 640 282 HOH HOH A . F 4 HOH 141 641 7 HOH HOH A . F 4 HOH 142 642 90 HOH HOH A . F 4 HOH 143 643 337 HOH HOH A . F 4 HOH 144 644 110 HOH HOH A . F 4 HOH 145 645 173 HOH HOH A . F 4 HOH 146 646 398 HOH HOH A . F 4 HOH 147 647 45 HOH HOH A . F 4 HOH 148 648 20 HOH HOH A . F 4 HOH 149 649 8 HOH HOH A . F 4 HOH 150 650 202 HOH HOH A . F 4 HOH 151 651 170 HOH HOH A . F 4 HOH 152 652 262 HOH HOH A . F 4 HOH 153 653 18 HOH HOH A . F 4 HOH 154 654 334 HOH HOH A . F 4 HOH 155 655 468 HOH HOH A . F 4 HOH 156 656 101 HOH HOH A . F 4 HOH 157 657 270 HOH HOH A . F 4 HOH 158 658 194 HOH HOH A . F 4 HOH 159 659 122 HOH HOH A . F 4 HOH 160 660 429 HOH HOH A . F 4 HOH 161 661 140 HOH HOH A . F 4 HOH 162 662 141 HOH HOH A . F 4 HOH 163 663 76 HOH HOH A . F 4 HOH 164 664 129 HOH HOH A . F 4 HOH 165 665 107 HOH HOH A . F 4 HOH 166 666 42 HOH HOH A . F 4 HOH 167 667 6 HOH HOH A . F 4 HOH 168 668 278 HOH HOH A . F 4 HOH 169 669 57 HOH HOH A . F 4 HOH 170 670 137 HOH HOH A . F 4 HOH 171 671 112 HOH HOH A . F 4 HOH 172 672 153 HOH HOH A . F 4 HOH 173 673 13 HOH HOH A . F 4 HOH 174 674 378 HOH HOH A . F 4 HOH 175 675 24 HOH HOH A . F 4 HOH 176 676 1 HOH HOH A . F 4 HOH 177 677 22 HOH HOH A . F 4 HOH 178 678 127 HOH HOH A . F 4 HOH 179 679 215 HOH HOH A . F 4 HOH 180 680 74 HOH HOH A . F 4 HOH 181 681 269 HOH HOH A . F 4 HOH 182 682 305 HOH HOH A . F 4 HOH 183 683 68 HOH HOH A . F 4 HOH 184 684 148 HOH HOH A . F 4 HOH 185 685 191 HOH HOH A . F 4 HOH 186 686 80 HOH HOH A . F 4 HOH 187 687 87 HOH HOH A . F 4 HOH 188 688 243 HOH HOH A . F 4 HOH 189 689 163 HOH HOH A . F 4 HOH 190 690 64 HOH HOH A . F 4 HOH 191 691 33 HOH HOH A . F 4 HOH 192 692 435 HOH HOH A . F 4 HOH 193 693 224 HOH HOH A . F 4 HOH 194 694 266 HOH HOH A . F 4 HOH 195 695 118 HOH HOH A . F 4 HOH 196 696 450 HOH HOH A . F 4 HOH 197 697 399 HOH HOH A . F 4 HOH 198 698 376 HOH HOH A . F 4 HOH 199 699 361 HOH HOH A . F 4 HOH 200 700 221 HOH HOH A . F 4 HOH 201 701 230 HOH HOH A . F 4 HOH 202 702 336 HOH HOH A . F 4 HOH 203 703 37 HOH HOH A . F 4 HOH 204 704 136 HOH HOH A . F 4 HOH 205 705 128 HOH HOH A . F 4 HOH 206 706 32 HOH HOH A . F 4 HOH 207 707 271 HOH HOH A . F 4 HOH 208 708 28 HOH HOH A . F 4 HOH 209 709 275 HOH HOH A . F 4 HOH 210 710 252 HOH HOH A . F 4 HOH 211 711 75 HOH HOH A . F 4 HOH 212 712 14 HOH HOH A . F 4 HOH 213 713 31 HOH HOH A . F 4 HOH 214 714 97 HOH HOH A . F 4 HOH 215 715 66 HOH HOH A . F 4 HOH 216 716 428 HOH HOH A . F 4 HOH 217 717 175 HOH HOH A . F 4 HOH 218 718 108 HOH HOH A . F 4 HOH 219 719 384 HOH HOH A . F 4 HOH 220 720 207 HOH HOH A . F 4 HOH 221 721 71 HOH HOH A . F 4 HOH 222 722 171 HOH HOH A . F 4 HOH 223 723 161 HOH HOH A . F 4 HOH 224 724 61 HOH HOH A . F 4 HOH 225 725 98 HOH HOH A . F 4 HOH 226 726 267 HOH HOH A . F 4 HOH 227 727 60 HOH HOH A . F 4 HOH 228 728 422 HOH HOH A . F 4 HOH 229 729 456 HOH HOH A . F 4 HOH 230 730 425 HOH HOH A . F 4 HOH 231 731 35 HOH HOH A . F 4 HOH 232 732 268 HOH HOH A . F 4 HOH 233 733 239 HOH HOH A . F 4 HOH 234 734 203 HOH HOH A . F 4 HOH 235 735 16 HOH HOH A . F 4 HOH 236 736 69 HOH HOH A . F 4 HOH 237 737 418 HOH HOH A . F 4 HOH 238 738 83 HOH HOH A . F 4 HOH 239 739 248 HOH HOH A . F 4 HOH 240 740 201 HOH HOH A . F 4 HOH 241 741 158 HOH HOH A . F 4 HOH 242 742 387 HOH HOH A . F 4 HOH 243 743 280 HOH HOH A . F 4 HOH 244 744 12 HOH HOH A . F 4 HOH 245 745 62 HOH HOH A . F 4 HOH 246 746 242 HOH HOH A . F 4 HOH 247 747 15 HOH HOH A . F 4 HOH 248 748 147 HOH HOH A . F 4 HOH 249 749 277 HOH HOH A . F 4 HOH 250 750 318 HOH HOH A . F 4 HOH 251 751 237 HOH HOH A . F 4 HOH 252 752 321 HOH HOH A . F 4 HOH 253 753 368 HOH HOH A . F 4 HOH 254 754 276 HOH HOH A . F 4 HOH 255 755 131 HOH HOH A . F 4 HOH 256 756 125 HOH HOH A . F 4 HOH 257 757 139 HOH HOH A . F 4 HOH 258 758 192 HOH HOH A . F 4 HOH 259 759 2 HOH HOH A . F 4 HOH 260 760 264 HOH HOH A . F 4 HOH 261 761 291 HOH HOH A . F 4 HOH 262 762 320 HOH HOH A . F 4 HOH 263 763 296 HOH HOH A . F 4 HOH 264 764 50 HOH HOH A . F 4 HOH 265 765 56 HOH HOH A . F 4 HOH 266 766 10 HOH HOH A . F 4 HOH 267 767 145 HOH HOH A . F 4 HOH 268 768 55 HOH HOH A . F 4 HOH 269 769 372 HOH HOH A . F 4 HOH 270 770 43 HOH HOH A . F 4 HOH 271 771 298 HOH HOH A . F 4 HOH 272 772 174 HOH HOH A . F 4 HOH 273 773 354 HOH HOH A . F 4 HOH 274 774 344 HOH HOH A . F 4 HOH 275 775 94 HOH HOH A . F 4 HOH 276 776 260 HOH HOH A . F 4 HOH 277 777 119 HOH HOH A . F 4 HOH 278 778 143 HOH HOH A . F 4 HOH 279 779 440 HOH HOH A . F 4 HOH 280 780 25 HOH HOH A . F 4 HOH 281 781 19 HOH HOH A . F 4 HOH 282 782 53 HOH HOH A . F 4 HOH 283 783 328 HOH HOH A . F 4 HOH 284 784 309 HOH HOH A . F 4 HOH 285 785 286 HOH HOH A . F 4 HOH 286 786 104 HOH HOH A . F 4 HOH 287 787 464 HOH HOH A . F 4 HOH 288 788 154 HOH HOH A . F 4 HOH 289 789 88 HOH HOH A . F 4 HOH 290 790 26 HOH HOH A . F 4 HOH 291 791 134 HOH HOH A . F 4 HOH 292 792 295 HOH HOH A . F 4 HOH 293 793 430 HOH HOH A . F 4 HOH 294 794 310 HOH HOH A . F 4 HOH 295 795 465 HOH HOH A . F 4 HOH 296 796 362 HOH HOH A . F 4 HOH 297 797 21 HOH HOH A . F 4 HOH 298 798 410 HOH HOH A . F 4 HOH 299 799 463 HOH HOH A . F 4 HOH 300 800 227 HOH HOH A . F 4 HOH 301 801 113 HOH HOH A . F 4 HOH 302 802 235 HOH HOH A . F 4 HOH 303 803 347 HOH HOH A . F 4 HOH 304 804 251 HOH HOH A . F 4 HOH 305 805 314 HOH HOH A . F 4 HOH 306 806 152 HOH HOH A . F 4 HOH 307 807 467 HOH HOH A . F 4 HOH 308 808 408 HOH HOH A . F 4 HOH 309 809 196 HOH HOH A . F 4 HOH 310 810 299 HOH HOH A . F 4 HOH 311 811 81 HOH HOH A . F 4 HOH 312 812 405 HOH HOH A . F 4 HOH 313 813 287 HOH HOH A . F 4 HOH 314 814 245 HOH HOH A . F 4 HOH 315 815 279 HOH HOH A . F 4 HOH 316 816 315 HOH HOH A . F 4 HOH 317 817 229 HOH HOH A . F 4 HOH 318 818 311 HOH HOH A . F 4 HOH 319 819 52 HOH HOH A . F 4 HOH 320 820 385 HOH HOH A . F 4 HOH 321 821 459 HOH HOH A . F 4 HOH 322 822 442 HOH HOH A . F 4 HOH 323 823 452 HOH HOH A . F 4 HOH 324 824 218 HOH HOH A . F 4 HOH 325 825 114 HOH HOH A . F 4 HOH 326 826 466 HOH HOH A . F 4 HOH 327 827 149 HOH HOH A . F 4 HOH 328 828 288 HOH HOH A . F 4 HOH 329 829 156 HOH HOH A . F 4 HOH 330 830 133 HOH HOH A . F 4 HOH 331 831 449 HOH HOH A . F 4 HOH 332 832 381 HOH HOH A . F 4 HOH 333 833 426 HOH HOH A . F 4 HOH 334 834 388 HOH HOH A . F 4 HOH 335 835 265 HOH HOH A . F 4 HOH 336 836 417 HOH HOH A . F 4 HOH 337 837 150 HOH HOH A . F 4 HOH 338 838 434 HOH HOH A . F 4 HOH 339 839 402 HOH HOH A . F 4 HOH 340 840 204 HOH HOH A . F 4 HOH 341 841 445 HOH HOH A . F 4 HOH 342 842 166 HOH HOH A . F 4 HOH 343 843 438 HOH HOH A . F 4 HOH 344 844 157 HOH HOH A . F 4 HOH 345 845 455 HOH HOH A . F 4 HOH 346 846 183 HOH HOH A . F 4 HOH 347 847 220 HOH HOH A . F 4 HOH 348 848 51 HOH HOH A . F 4 HOH 349 849 181 HOH HOH A . F 4 HOH 350 850 120 HOH HOH A . F 4 HOH 351 851 46 HOH HOH A . F 4 HOH 352 852 342 HOH HOH A . F 4 HOH 353 853 346 HOH HOH A . F 4 HOH 354 854 132 HOH HOH A . F 4 HOH 355 855 420 HOH HOH A . F 4 HOH 356 856 59 HOH HOH A . F 4 HOH 357 857 371 HOH HOH A . F 4 HOH 358 858 374 HOH HOH A . F 4 HOH 359 859 135 HOH HOH A . F 4 HOH 360 860 453 HOH HOH A . F 4 HOH 361 861 249 HOH HOH A . F 4 HOH 362 862 167 HOH HOH A . F 4 HOH 363 863 403 HOH HOH A . F 4 HOH 364 864 233 HOH HOH A . F 4 HOH 365 865 406 HOH HOH A . F 4 HOH 366 866 272 HOH HOH A . F 4 HOH 367 867 77 HOH HOH A . F 4 HOH 368 868 365 HOH HOH A . F 4 HOH 369 869 363 HOH HOH A . F 4 HOH 370 870 335 HOH HOH A . F 4 HOH 371 871 284 HOH HOH A . F 4 HOH 372 872 447 HOH HOH A . F 4 HOH 373 873 350 HOH HOH A . F 4 HOH 374 874 325 HOH HOH A . F 4 HOH 375 875 261 HOH HOH A . F 4 HOH 376 876 326 HOH HOH A . F 4 HOH 377 877 273 HOH HOH A . F 4 HOH 378 878 212 HOH HOH A . F 4 HOH 379 879 454 HOH HOH A . F 4 HOH 380 880 307 HOH HOH A . F 4 HOH 381 881 458 HOH HOH A . F 4 HOH 382 882 100 HOH HOH A . F 4 HOH 383 883 209 HOH HOH A . F 4 HOH 384 884 293 HOH HOH A . F 4 HOH 385 885 436 HOH HOH A . F 4 HOH 386 886 176 HOH HOH A . F 4 HOH 387 887 396 HOH HOH A . F 4 HOH 388 888 182 HOH HOH A . F 4 HOH 389 889 323 HOH HOH A . F 4 HOH 390 890 457 HOH HOH A . F 4 HOH 391 891 370 HOH HOH A . F 4 HOH 392 892 226 HOH HOH A . F 4 HOH 393 893 424 HOH HOH A . F 4 HOH 394 894 289 HOH HOH A . F 4 HOH 395 895 70 HOH HOH A . F 4 HOH 396 896 123 HOH HOH A . F 4 HOH 397 897 317 HOH HOH A . F 4 HOH 398 898 177 HOH HOH A . F 4 HOH 399 899 213 HOH HOH A . F 4 HOH 400 900 409 HOH HOH A . F 4 HOH 401 901 358 HOH HOH A . F 4 HOH 402 902 144 HOH HOH A . F 4 HOH 403 903 401 HOH HOH A . F 4 HOH 404 904 126 HOH HOH A . F 4 HOH 405 905 274 HOH HOH A . F 4 HOH 406 906 432 HOH HOH A . F 4 HOH 407 907 333 HOH HOH A . F 4 HOH 408 908 439 HOH HOH A . F 4 HOH 409 909 146 HOH HOH A . F 4 HOH 410 910 367 HOH HOH A . F 4 HOH 411 911 130 HOH HOH A . F 4 HOH 412 912 313 HOH HOH A . F 4 HOH 413 913 142 HOH HOH A . F 4 HOH 414 914 285 HOH HOH A . F 4 HOH 415 915 391 HOH HOH A . F 4 HOH 416 916 389 HOH HOH A . F 4 HOH 417 917 339 HOH HOH A . F 4 HOH 418 918 461 HOH HOH A . F 4 HOH 419 919 332 HOH HOH A . F 4 HOH 420 920 340 HOH HOH A . F 4 HOH 421 921 178 HOH HOH A . F 4 HOH 422 922 179 HOH HOH A . F 4 HOH 423 923 256 HOH HOH A . F 4 HOH 424 924 431 HOH HOH A . F 4 HOH 425 925 223 HOH HOH A . F 4 HOH 426 926 355 HOH HOH A . F 4 HOH 427 927 116 HOH HOH A . F 4 HOH 428 928 393 HOH HOH A . F 4 HOH 429 929 404 HOH HOH A . F 4 HOH 430 930 427 HOH HOH A . F 4 HOH 431 931 357 HOH HOH A . F 4 HOH 432 932 188 HOH HOH A . F 4 HOH 433 933 187 HOH HOH A . F 4 HOH 434 934 255 HOH HOH A . F 4 HOH 435 935 283 HOH HOH A . F 4 HOH 436 936 400 HOH HOH A . F 4 HOH 437 937 185 HOH HOH A . F 4 HOH 438 938 352 HOH HOH A . F 4 HOH 439 939 151 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 94.440 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6Y8F _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.311 _cell.length_a_esd ? _cell.length_b 82.774 _cell.length_b_esd ? _cell.length_c 49.700 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Y8F _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Y8F _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;14 % v/v 2-propanol, 30 % v/v Glycerol, 70 mM Sodium acetate pH 4.6, 140 mM Calcium chloride ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si-111 and Si-113 double crystal monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03320 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03320 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6Y8F _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.470 _reflns.d_resolution_low 82.770 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 50967 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.600 _reflns.pdbx_Rmerge_I_obs 0.083 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 480 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.091 _reflns.pdbx_Rpim_I_all 0.038 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 287715 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.470 1.500 ? ? 13225 ? ? ? 2576 100.000 ? ? ? ? 0.371 ? ? ? ? ? ? ? ? 5.100 ? ? ? 3.300 0.413 0.179 ? 1 1 0.928 ? ? 8.060 82.770 ? ? 2084 ? ? ? 333 99.800 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 6.300 ? ? ? 21.300 0.051 0.020 ? 2 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 56.250 _refine.B_iso_mean 19.9933 _refine.B_iso_min 7.320 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Y8F _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4720 _refine.ls_d_res_low 49.5510 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 50884 _refine.ls_number_reflns_R_free 2568 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8800 _refine.ls_percent_reflns_R_free 5.0500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1643 _refine.ls_R_factor_R_free 0.1994 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1624 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6SHD _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.1100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.4720 _refine_hist.d_res_low 49.5510 _refine_hist.number_atoms_solvent 452 _refine_hist.number_atoms_total 3179 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 338 _refine_hist.pdbx_B_iso_mean_ligand 17.76 _refine_hist.pdbx_B_iso_mean_solvent 32.92 _refine_hist.pdbx_number_atoms_protein 2690 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2796 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.557 ? 3805 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.061 ? 408 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 493 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 6.399 ? 1002 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4720 1.5003 . . 124 2729 100.0000 . . . 0.2788 0.0000 0.1980 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5003 1.5309 . . 152 2639 100.0000 . . . 0.2762 0.0000 0.1794 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5309 1.5642 . . 125 2704 100.0000 . . . 0.2431 0.0000 0.1689 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5642 1.6006 . . 124 2692 100.0000 . . . 0.2437 0.0000 0.1810 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6006 1.6406 . . 134 2652 100.0000 . . . 0.2526 0.0000 0.1677 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6406 1.6850 . . 121 2710 100.0000 . . . 0.2507 0.0000 0.1550 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6850 1.7346 . . 132 2656 100.0000 . . . 0.2112 0.0000 0.1488 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7346 1.7906 . . 171 2681 100.0000 . . . 0.2144 0.0000 0.1549 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7906 1.8546 . . 145 2684 100.0000 . . . 0.2098 0.0000 0.1596 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8546 1.9288 . . 155 2657 100.0000 . . . 0.2139 0.0000 0.1625 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9288 2.0166 . . 135 2696 100.0000 . . . 0.2133 0.0000 0.1638 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0166 2.1229 . . 168 2638 100.0000 . . . 0.1933 0.0000 0.1537 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1229 2.2559 . . 149 2668 100.0000 . . . 0.1976 0.0000 0.1515 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2559 2.4301 . . 150 2689 100.0000 . . . 0.1834 0.0000 0.1570 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4301 2.6747 . . 173 2671 100.0000 . . . 0.1746 0.0000 0.1618 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6747 3.0616 . . 153 2673 100.0000 . . . 0.1856 0.0000 0.1702 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0616 3.8571 . . 136 2712 100.0000 . . . 0.1822 0.0000 0.1569 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8571 49.55 . . 121 2765 100.0000 . . . 0.1910 0.0000 0.1677 . . . . . . . . . . . # _struct.entry_id 6Y8F _struct.title ;An inactive (D136N and D137N) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotriose ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Y8F _struct_keywords.text 'Glycoside hydrolase, GH76, Mannan, CAZymes, Mannanases, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6Y8F _struct_ref.pdbx_db_accession 6Y8F _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Y8F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 391 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6Y8F _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 391 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 391 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1300 ? 1 MORE -10 ? 1 'SSA (A^2)' 12970 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 54 ? LEU A 71 ? ASP A 54 LEU A 71 1 ? 18 HELX_P HELX_P2 AA2 THR A 72 ? THR A 76 ? THR A 72 THR A 76 5 ? 5 HELX_P HELX_P3 AA3 ASN A 88 ? GLY A 107 ? ASN A 88 GLY A 107 1 ? 20 HELX_P HELX_P4 AA4 SER A 110 ? ASN A 126 ? SER A 110 ASN A 126 1 ? 17 HELX_P HELX_P5 AA5 PHE A 134 ? ASN A 153 ? PHE A 134 ASN A 153 1 ? 20 HELX_P HELX_P6 AA6 ASP A 154 ? GLY A 171 ? ASP A 154 GLY A 171 1 ? 18 HELX_P HELX_P7 AA7 ASP A 174 ? GLY A 178 ? ASP A 174 GLY A 178 5 ? 5 HELX_P HELX_P8 AA8 ASN A 195 ? GLN A 210 ? ASN A 195 GLN A 210 1 ? 16 HELX_P HELX_P9 AA9 ASP A 211 ? LEU A 229 ? ASP A 211 LEU A 229 1 ? 19 HELX_P HELX_P10 AB1 PHE A 256 ? GLY A 275 ? PHE A 256 GLY A 275 1 ? 20 HELX_P HELX_P11 AB2 GLU A 276 ? ALA A 292 ? GLU A 276 ALA A 292 1 ? 17 HELX_P HELX_P12 AB3 GLN A 307 ? GLY A 311 ? GLN A 307 GLY A 311 5 ? 5 HELX_P HELX_P13 AB4 LEU A 312 ? LEU A 326 ? LEU A 312 LEU A 326 1 ? 15 HELX_P HELX_P14 AB5 PRO A 331 ? GLY A 353 ? PRO A 331 GLY A 353 1 ? 23 HELX_P HELX_P15 AB6 ASP A 373 ? GLU A 391 ? ASP A 373 GLU A 391 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B MAN . O6 ? ? ? 1_555 B MAN . C1 ? ? B MAN 1 B MAN 2 1_555 ? ? ? ? ? ? ? 1.437 ? ? covale2 covale both ? B MAN . O6 ? ? ? 1_555 B MAN . C1 ? ? B MAN 2 B MAN 3 1_555 ? ? ? ? ? ? ? 1.429 ? ? metalc1 metalc ? ? A GLU 60 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 60 A CA 404 1_555 ? ? ? ? ? ? ? 2.378 ? ? metalc2 metalc ? ? A GLU 64 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 64 A CA 404 1_555 ? ? ? ? ? ? ? 2.637 ? ? metalc3 metalc ? ? A GLY 107 O ? ? ? 1_555 D CA . CA ? ? A GLY 107 A CA 405 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc4 metalc ? ? A GLU 109 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 109 A CA 405 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc5 metalc ? ? A GLU 109 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 109 A CA 405 1_555 ? ? ? ? ? ? ? 2.559 ? ? metalc6 metalc ? ? A ASN 128 O ? ? ? 1_555 E CA . CA ? ? A ASN 128 A CA 406 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc7 metalc ? ? A GLU 213 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 213 A CA 404 2_455 ? ? ? ? ? ? ? 2.445 ? ? metalc8 metalc ? ? A GLU 213 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 213 A CA 404 2_455 ? ? ? ? ? ? ? 2.417 ? ? metalc9 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 404 A HOH 623 1_555 ? ? ? ? ? ? ? 2.468 ? ? metalc10 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 404 A HOH 658 2_445 ? ? ? ? ? ? ? 2.388 ? ? metalc11 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 404 A HOH 809 2_445 ? ? ? ? ? ? ? 2.419 ? ? metalc12 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 405 A HOH 547 2_445 ? ? ? ? ? ? ? 2.371 ? ? metalc13 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 405 A HOH 741 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc14 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 405 A HOH 798 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc15 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 405 A HOH 861 2_445 ? ? ? ? ? ? ? 2.204 ? ? metalc16 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 406 A HOH 612 1_556 ? ? ? ? ? ? ? 2.381 ? ? metalc17 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 406 A HOH 614 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc18 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 406 A HOH 737 1_555 ? ? ? ? ? ? ? 2.358 ? ? metalc19 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 406 A HOH 758 1_556 ? ? ? ? ? ? ? 2.414 ? ? metalc20 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 406 A HOH 830 1_555 ? ? ? ? ? ? ? 2.545 ? ? metalc21 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 406 A HOH 921 1_555 ? ? ? ? ? ? ? 2.506 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 OE2 ? A GLU 64 ? A GLU 64 ? 1_555 95.0 ? 2 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 OE1 ? A GLU 213 ? A GLU 213 ? 1_555 62.4 ? 3 OE2 ? A GLU 64 ? A GLU 64 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 OE1 ? A GLU 213 ? A GLU 213 ? 1_555 138.8 ? 4 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 OE2 ? A GLU 213 ? A GLU 213 ? 1_555 61.7 ? 5 OE2 ? A GLU 64 ? A GLU 64 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 OE2 ? A GLU 213 ? A GLU 213 ? 1_555 139.1 ? 6 OE1 ? A GLU 213 ? A GLU 213 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 OE2 ? A GLU 213 ? A GLU 213 ? 1_555 1.0 ? 7 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 623 ? 1_555 69.0 ? 8 OE2 ? A GLU 64 ? A GLU 64 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 623 ? 1_555 104.0 ? 9 OE1 ? A GLU 213 ? A GLU 213 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 623 ? 1_555 37.5 ? 10 OE2 ? A GLU 213 ? A GLU 213 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 623 ? 1_555 38.2 ? 11 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 658 ? 2_445 85.1 ? 12 OE2 ? A GLU 64 ? A GLU 64 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 658 ? 2_445 88.1 ? 13 OE1 ? A GLU 213 ? A GLU 213 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 658 ? 2_445 120.8 ? 14 OE2 ? A GLU 213 ? A GLU 213 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 658 ? 2_445 119.8 ? 15 O ? F HOH . ? A HOH 623 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 658 ? 2_445 152.1 ? 16 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 809 ? 2_445 92.3 ? 17 OE2 ? A GLU 64 ? A GLU 64 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 809 ? 2_445 170.9 ? 18 OE1 ? A GLU 213 ? A GLU 213 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 809 ? 2_445 50.0 ? 19 OE2 ? A GLU 213 ? A GLU 213 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 809 ? 2_445 49.8 ? 20 O ? F HOH . ? A HOH 623 ? 1_555 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 809 ? 2_445 83.7 ? 21 O ? F HOH . ? A HOH 658 ? 2_445 CA ? C CA . ? A CA 404 ? 1_555 O ? F HOH . ? A HOH 809 ? 2_445 87.1 ? 22 O ? A GLY 107 ? A GLY 107 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 OE1 ? A GLU 109 ? A GLU 109 ? 1_555 89.7 ? 23 O ? A GLY 107 ? A GLY 107 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 OE2 ? A GLU 109 ? A GLU 109 ? 1_555 94.9 ? 24 OE1 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 OE2 ? A GLU 109 ? A GLU 109 ? 1_555 53.7 ? 25 O ? A GLY 107 ? A GLY 107 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 547 ? 2_445 84.6 ? 26 OE1 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 547 ? 2_445 79.8 ? 27 OE2 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 547 ? 2_445 133.5 ? 28 O ? A GLY 107 ? A GLY 107 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 741 ? 1_555 83.3 ? 29 OE1 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 741 ? 1_555 129.3 ? 30 OE2 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 741 ? 1_555 76.9 ? 31 O ? F HOH . ? A HOH 547 ? 2_445 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 741 ? 1_555 148.2 ? 32 O ? A GLY 107 ? A GLY 107 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 798 ? 1_555 86.1 ? 33 OE1 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 798 ? 1_555 157.1 ? 34 OE2 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 798 ? 1_555 149.1 ? 35 O ? F HOH . ? A HOH 547 ? 2_445 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 798 ? 1_555 77.4 ? 36 O ? F HOH . ? A HOH 741 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 798 ? 1_555 72.6 ? 37 O ? A GLY 107 ? A GLY 107 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 861 ? 2_445 169.2 ? 38 OE1 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 861 ? 2_445 101.1 ? 39 OE2 ? A GLU 109 ? A GLU 109 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 861 ? 2_445 91.6 ? 40 O ? F HOH . ? A HOH 547 ? 2_445 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 861 ? 2_445 97.2 ? 41 O ? F HOH . ? A HOH 741 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 861 ? 2_445 89.8 ? 42 O ? F HOH . ? A HOH 798 ? 1_555 CA ? D CA . ? A CA 405 ? 1_555 O ? F HOH . ? A HOH 861 ? 2_445 83.9 ? 43 O ? A ASN 128 ? A ASN 128 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 612 ? 1_556 87.3 ? 44 O ? A ASN 128 ? A ASN 128 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 614 ? 1_555 89.2 ? 45 O ? F HOH . ? A HOH 612 ? 1_556 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 614 ? 1_555 72.8 ? 46 O ? A ASN 128 ? A ASN 128 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 737 ? 1_555 77.6 ? 47 O ? F HOH . ? A HOH 612 ? 1_556 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 737 ? 1_555 142.6 ? 48 O ? F HOH . ? A HOH 614 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 737 ? 1_555 139.7 ? 49 O ? A ASN 128 ? A ASN 128 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 758 ? 1_556 91.2 ? 50 O ? F HOH . ? A HOH 612 ? 1_556 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 758 ? 1_556 75.9 ? 51 O ? F HOH . ? A HOH 614 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 758 ? 1_556 148.7 ? 52 O ? F HOH . ? A HOH 737 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 758 ? 1_556 70.5 ? 53 O ? A ASN 128 ? A ASN 128 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 830 ? 1_555 91.4 ? 54 O ? F HOH . ? A HOH 612 ? 1_556 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 830 ? 1_555 148.5 ? 55 O ? F HOH . ? A HOH 614 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 830 ? 1_555 75.6 ? 56 O ? F HOH . ? A HOH 737 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 830 ? 1_555 66.9 ? 57 O ? F HOH . ? A HOH 758 ? 1_556 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 830 ? 1_555 135.6 ? 58 O ? A ASN 128 ? A ASN 128 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 921 ? 1_555 172.9 ? 59 O ? F HOH . ? A HOH 612 ? 1_556 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 921 ? 1_555 90.2 ? 60 O ? F HOH . ? A HOH 614 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 921 ? 1_555 83.7 ? 61 O ? F HOH . ? A HOH 737 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 921 ? 1_555 108.1 ? 62 O ? F HOH . ? A HOH 758 ? 1_556 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 921 ? 1_555 94.6 ? 63 O ? F HOH . ? A HOH 830 ? 1_555 CA ? E CA . ? A CA 406 ? 1_555 O ? F HOH . ? A HOH 921 ? 1_555 87.3 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 190 ? ASN A 191 ? LYS A 190 ASN A 191 AA1 2 ASN A 240 ? HIS A 244 ? ASN A 240 HIS A 244 AA1 3 GLU A 247 ? ILE A 250 ? GLU A 247 ILE A 250 AA2 1 THR A 297 ? THR A 298 ? THR A 297 THR A 298 AA2 2 VAL A 301 ? LEU A 302 ? VAL A 301 LEU A 302 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 190 ? N LYS A 190 O ILE A 241 ? O ILE A 241 AA1 2 3 N ASP A 242 ? N ASP A 242 O ILE A 249 ? O ILE A 249 AA2 1 2 N THR A 298 ? N THR A 298 O VAL A 301 ? O VAL A 301 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 64 ? ? O A HOH 501 ? ? 2.14 2 1 O A HOH 508 ? ? O A HOH 692 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 72 ? ? -123.59 -158.34 2 1 GLU A 82 ? ? -118.14 -120.21 3 1 THR A 186 ? ? -118.66 71.85 # _pdbx_entry_details.entry_id 6Y8F _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A HIS 20 ? A HIS 20 21 1 Y 1 A MET 21 ? A MET 21 22 1 Y 1 A ALA 22 ? A ALA 22 23 1 Y 1 A SER 23 ? A SER 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A ALA 25 ? A ALA 25 26 1 Y 1 A ASP 26 ? A ASP 26 27 1 Y 1 A ASP 27 ? A ASP 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A GLY 29 ? A GLY 29 30 1 Y 1 A ILE 30 ? A ILE 30 31 1 Y 1 A ASP 31 ? A ASP 31 32 1 Y 1 A ASP 32 ? A ASP 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A GLN 34 ? A GLN 34 35 1 Y 1 A GLU 35 ? A GLU 35 36 1 Y 1 A GLU 36 ? A GLU 36 37 1 Y 1 A GLU 37 ? A GLU 37 38 1 Y 1 A GLU 38 ? A GLU 38 39 1 Y 1 A GLU 39 ? A GLU 39 40 1 Y 1 A GLN 40 ? A GLN 40 41 1 Y 1 A PRO 41 ? A PRO 41 42 1 Y 1 A VAL 42 ? A VAL 42 43 1 Y 1 A GLU 43 ? A GLU 43 44 1 Y 1 A PRO 44 ? A PRO 44 45 1 Y 1 A GLY 45 ? A GLY 45 46 1 Y 1 A GLU 46 ? A GLU 46 47 1 Y 1 A GLU 47 ? A GLU 47 48 1 Y 1 A GLU 48 ? A GLU 48 49 1 Y 1 A ASP 49 ? A ASP 49 50 1 Y 1 A ASP 50 ? A ASP 50 51 1 Y 1 A GLU 51 ? A GLU 51 52 1 Y 1 A VAL 52 ? A VAL 52 53 1 Y 1 A ALA 53 ? A ALA 53 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MAN C1 C N S 231 MAN C2 C N S 232 MAN C3 C N S 233 MAN C4 C N S 234 MAN C5 C N R 235 MAN C6 C N N 236 MAN O1 O N N 237 MAN O2 O N N 238 MAN O3 O N N 239 MAN O4 O N N 240 MAN O5 O N N 241 MAN O6 O N N 242 MAN H1 H N N 243 MAN H2 H N N 244 MAN H3 H N N 245 MAN H4 H N N 246 MAN H5 H N N 247 MAN H61 H N N 248 MAN H62 H N N 249 MAN HO1 H N N 250 MAN HO2 H N N 251 MAN HO3 H N N 252 MAN HO4 H N N 253 MAN HO6 H N N 254 MET N N N N 255 MET CA C N S 256 MET C C N N 257 MET O O N N 258 MET CB C N N 259 MET CG C N N 260 MET SD S N N 261 MET CE C N N 262 MET OXT O N N 263 MET H H N N 264 MET H2 H N N 265 MET HA H N N 266 MET HB2 H N N 267 MET HB3 H N N 268 MET HG2 H N N 269 MET HG3 H N N 270 MET HE1 H N N 271 MET HE2 H N N 272 MET HE3 H N N 273 MET HXT H N N 274 PHE N N N N 275 PHE CA C N S 276 PHE C C N N 277 PHE O O N N 278 PHE CB C N N 279 PHE CG C Y N 280 PHE CD1 C Y N 281 PHE CD2 C Y N 282 PHE CE1 C Y N 283 PHE CE2 C Y N 284 PHE CZ C Y N 285 PHE OXT O N N 286 PHE H H N N 287 PHE H2 H N N 288 PHE HA H N N 289 PHE HB2 H N N 290 PHE HB3 H N N 291 PHE HD1 H N N 292 PHE HD2 H N N 293 PHE HE1 H N N 294 PHE HE2 H N N 295 PHE HZ H N N 296 PHE HXT H N N 297 PRO N N N N 298 PRO CA C N S 299 PRO C C N N 300 PRO O O N N 301 PRO CB C N N 302 PRO CG C N N 303 PRO CD C N N 304 PRO OXT O N N 305 PRO H H N N 306 PRO HA H N N 307 PRO HB2 H N N 308 PRO HB3 H N N 309 PRO HG2 H N N 310 PRO HG3 H N N 311 PRO HD2 H N N 312 PRO HD3 H N N 313 PRO HXT H N N 314 SER N N N N 315 SER CA C N S 316 SER C C N N 317 SER O O N N 318 SER CB C N N 319 SER OG O N N 320 SER OXT O N N 321 SER H H N N 322 SER H2 H N N 323 SER HA H N N 324 SER HB2 H N N 325 SER HB3 H N N 326 SER HG H N N 327 SER HXT H N N 328 THR N N N N 329 THR CA C N S 330 THR C C N N 331 THR O O N N 332 THR CB C N R 333 THR OG1 O N N 334 THR CG2 C N N 335 THR OXT O N N 336 THR H H N N 337 THR H2 H N N 338 THR HA H N N 339 THR HB H N N 340 THR HG1 H N N 341 THR HG21 H N N 342 THR HG22 H N N 343 THR HG23 H N N 344 THR HXT H N N 345 TRP N N N N 346 TRP CA C N S 347 TRP C C N N 348 TRP O O N N 349 TRP CB C N N 350 TRP CG C Y N 351 TRP CD1 C Y N 352 TRP CD2 C Y N 353 TRP NE1 N Y N 354 TRP CE2 C Y N 355 TRP CE3 C Y N 356 TRP CZ2 C Y N 357 TRP CZ3 C Y N 358 TRP CH2 C Y N 359 TRP OXT O N N 360 TRP H H N N 361 TRP H2 H N N 362 TRP HA H N N 363 TRP HB2 H N N 364 TRP HB3 H N N 365 TRP HD1 H N N 366 TRP HE1 H N N 367 TRP HE3 H N N 368 TRP HZ2 H N N 369 TRP HZ3 H N N 370 TRP HH2 H N N 371 TRP HXT H N N 372 TYR N N N N 373 TYR CA C N S 374 TYR C C N N 375 TYR O O N N 376 TYR CB C N N 377 TYR CG C Y N 378 TYR CD1 C Y N 379 TYR CD2 C Y N 380 TYR CE1 C Y N 381 TYR CE2 C Y N 382 TYR CZ C Y N 383 TYR OH O N N 384 TYR OXT O N N 385 TYR H H N N 386 TYR H2 H N N 387 TYR HA H N N 388 TYR HB2 H N N 389 TYR HB3 H N N 390 TYR HD1 H N N 391 TYR HD2 H N N 392 TYR HE1 H N N 393 TYR HE2 H N N 394 TYR HH H N N 395 TYR HXT H N N 396 VAL N N N N 397 VAL CA C N S 398 VAL C C N N 399 VAL O O N N 400 VAL CB C N N 401 VAL CG1 C N N 402 VAL CG2 C N N 403 VAL OXT O N N 404 VAL H H N N 405 VAL H2 H N N 406 VAL HA H N N 407 VAL HB H N N 408 VAL HG11 H N N 409 VAL HG12 H N N 410 VAL HG13 H N N 411 VAL HG21 H N N 412 VAL HG22 H N N 413 VAL HG23 H N N 414 VAL HXT H N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MAN C1 C2 sing N N 218 MAN C1 O1 sing N N 219 MAN C1 O5 sing N N 220 MAN C1 H1 sing N N 221 MAN C2 C3 sing N N 222 MAN C2 O2 sing N N 223 MAN C2 H2 sing N N 224 MAN C3 C4 sing N N 225 MAN C3 O3 sing N N 226 MAN C3 H3 sing N N 227 MAN C4 C5 sing N N 228 MAN C4 O4 sing N N 229 MAN C4 H4 sing N N 230 MAN C5 C6 sing N N 231 MAN C5 O5 sing N N 232 MAN C5 H5 sing N N 233 MAN C6 O6 sing N N 234 MAN C6 H61 sing N N 235 MAN C6 H62 sing N N 236 MAN O1 HO1 sing N N 237 MAN O2 HO2 sing N N 238 MAN O3 HO3 sing N N 239 MAN O4 HO4 sing N N 240 MAN O6 HO6 sing N N 241 MET N CA sing N N 242 MET N H sing N N 243 MET N H2 sing N N 244 MET CA C sing N N 245 MET CA CB sing N N 246 MET CA HA sing N N 247 MET C O doub N N 248 MET C OXT sing N N 249 MET CB CG sing N N 250 MET CB HB2 sing N N 251 MET CB HB3 sing N N 252 MET CG SD sing N N 253 MET CG HG2 sing N N 254 MET CG HG3 sing N N 255 MET SD CE sing N N 256 MET CE HE1 sing N N 257 MET CE HE2 sing N N 258 MET CE HE3 sing N N 259 MET OXT HXT sing N N 260 PHE N CA sing N N 261 PHE N H sing N N 262 PHE N H2 sing N N 263 PHE CA C sing N N 264 PHE CA CB sing N N 265 PHE CA HA sing N N 266 PHE C O doub N N 267 PHE C OXT sing N N 268 PHE CB CG sing N N 269 PHE CB HB2 sing N N 270 PHE CB HB3 sing N N 271 PHE CG CD1 doub Y N 272 PHE CG CD2 sing Y N 273 PHE CD1 CE1 sing Y N 274 PHE CD1 HD1 sing N N 275 PHE CD2 CE2 doub Y N 276 PHE CD2 HD2 sing N N 277 PHE CE1 CZ doub Y N 278 PHE CE1 HE1 sing N N 279 PHE CE2 CZ sing Y N 280 PHE CE2 HE2 sing N N 281 PHE CZ HZ sing N N 282 PHE OXT HXT sing N N 283 PRO N CA sing N N 284 PRO N CD sing N N 285 PRO N H sing N N 286 PRO CA C sing N N 287 PRO CA CB sing N N 288 PRO CA HA sing N N 289 PRO C O doub N N 290 PRO C OXT sing N N 291 PRO CB CG sing N N 292 PRO CB HB2 sing N N 293 PRO CB HB3 sing N N 294 PRO CG CD sing N N 295 PRO CG HG2 sing N N 296 PRO CG HG3 sing N N 297 PRO CD HD2 sing N N 298 PRO CD HD3 sing N N 299 PRO OXT HXT sing N N 300 SER N CA sing N N 301 SER N H sing N N 302 SER N H2 sing N N 303 SER CA C sing N N 304 SER CA CB sing N N 305 SER CA HA sing N N 306 SER C O doub N N 307 SER C OXT sing N N 308 SER CB OG sing N N 309 SER CB HB2 sing N N 310 SER CB HB3 sing N N 311 SER OG HG sing N N 312 SER OXT HXT sing N N 313 THR N CA sing N N 314 THR N H sing N N 315 THR N H2 sing N N 316 THR CA C sing N N 317 THR CA CB sing N N 318 THR CA HA sing N N 319 THR C O doub N N 320 THR C OXT sing N N 321 THR CB OG1 sing N N 322 THR CB CG2 sing N N 323 THR CB HB sing N N 324 THR OG1 HG1 sing N N 325 THR CG2 HG21 sing N N 326 THR CG2 HG22 sing N N 327 THR CG2 HG23 sing N N 328 THR OXT HXT sing N N 329 TRP N CA sing N N 330 TRP N H sing N N 331 TRP N H2 sing N N 332 TRP CA C sing N N 333 TRP CA CB sing N N 334 TRP CA HA sing N N 335 TRP C O doub N N 336 TRP C OXT sing N N 337 TRP CB CG sing N N 338 TRP CB HB2 sing N N 339 TRP CB HB3 sing N N 340 TRP CG CD1 doub Y N 341 TRP CG CD2 sing Y N 342 TRP CD1 NE1 sing Y N 343 TRP CD1 HD1 sing N N 344 TRP CD2 CE2 doub Y N 345 TRP CD2 CE3 sing Y N 346 TRP NE1 CE2 sing Y N 347 TRP NE1 HE1 sing N N 348 TRP CE2 CZ2 sing Y N 349 TRP CE3 CZ3 doub Y N 350 TRP CE3 HE3 sing N N 351 TRP CZ2 CH2 doub Y N 352 TRP CZ2 HZ2 sing N N 353 TRP CZ3 CH2 sing Y N 354 TRP CZ3 HZ3 sing N N 355 TRP CH2 HH2 sing N N 356 TRP OXT HXT sing N N 357 TYR N CA sing N N 358 TYR N H sing N N 359 TYR N H2 sing N N 360 TYR CA C sing N N 361 TYR CA CB sing N N 362 TYR CA HA sing N N 363 TYR C O doub N N 364 TYR C OXT sing N N 365 TYR CB CG sing N N 366 TYR CB HB2 sing N N 367 TYR CB HB3 sing N N 368 TYR CG CD1 doub Y N 369 TYR CG CD2 sing Y N 370 TYR CD1 CE1 sing Y N 371 TYR CD1 HD1 sing N N 372 TYR CD2 CE2 doub Y N 373 TYR CD2 HD2 sing N N 374 TYR CE1 CZ doub Y N 375 TYR CE1 HE1 sing N N 376 TYR CE2 CZ sing Y N 377 TYR CE2 HE2 sing N N 378 TYR CZ OH sing N N 379 TYR OH HH sing N N 380 TYR OXT HXT sing N N 381 VAL N CA sing N N 382 VAL N H sing N N 383 VAL N H2 sing N N 384 VAL CA C sing N N 385 VAL CA CB sing N N 386 VAL CA HA sing N N 387 VAL C O doub N N 388 VAL C OXT sing N N 389 VAL CB CG1 sing N N 390 VAL CB CG2 sing N N 391 VAL CB HB sing N N 392 VAL CG1 HG11 sing N N 393 VAL CG1 HG12 sing N N 394 VAL CG1 HG13 sing N N 395 VAL CG2 HG21 sing N N 396 VAL CG2 HG22 sing N N 397 VAL CG2 HG23 sing N N 398 VAL OXT HXT sing N N 399 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 MAN 1 n 2 MAN 2 n 2 MAN 3 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CA ? ? CA ? ? 'SUBJECT OF INVESTIGATION' ? 2 MAN ? ? MAN ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6SHD _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6Y8F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026802 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002081 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012081 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020181 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S # loop_ # loop_ #