data_6YG5 # _entry.id 6YG5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YG5 pdb_00006yg5 10.2210/pdb6yg5/pdb WWPDB D_1292107564 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-12 2 'Structure model' 1 1 2020-09-02 3 'Structure model' 1 2 2020-10-28 4 'Structure model' 1 3 2024-01-24 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 4 'Structure model' '_database_2.pdbx_DOI' 13 4 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YG5 _pdbx_database_status.recvd_initial_deposition_date 2020-03-27 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chaikuad, A.' 1 0000-0003-1120-2209 'Knapp, S.' 2 ? 'Structural Genomics Consortium (SGC)' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Chem Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2451-9456 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1285 _citation.page_last 1295.e4 _citation.title 'Catalytic Domain Plasticity of MKK7 Reveals Structural Mechanisms of Allosteric Activation and Diverse Targeting Opportunities.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.chembiol.2020.07.014 _citation.pdbx_database_id_PubMed 32783966 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schroder, M.' 1 ? primary 'Tan, L.' 2 ? primary 'Wang, J.' 3 ? primary 'Liang, Y.' 4 ? primary 'Gray, N.S.' 5 ? primary 'Knapp, S.' 6 ? primary 'Chaikuad, A.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity mitogen-activated protein kinase kinase 7' 34976.621 1 2.7.12.2 ? ? ? 2 non-polymer syn '[4-({4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl}amino)phenyl]acetonitrile' 381.433 1 ? ? ? ? 3 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;MAPKK 7,JNK-activating kinase 2,MAPK/ERK kinase 7,MEK 7,Stress-activated protein kinase kinase 4,SAPKK4,c-Jun N-terminal kinase kinase 2,JNKK 2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPY IVQCFGTFITNTDVFIAMELMGT(CSO)AEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDER GQIKL(CSO)DFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFE VLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPR ; _entity_poly.pdbx_seq_one_letter_code_can ;SMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPY IVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIK LCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQE EPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[4-({4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl}amino)phenyl]acetonitrile' IHH 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 LYS n 1 4 GLN n 1 5 THR n 1 6 GLY n 1 7 TYR n 1 8 LEU n 1 9 THR n 1 10 ILE n 1 11 GLY n 1 12 GLY n 1 13 GLN n 1 14 ARG n 1 15 TYR n 1 16 GLN n 1 17 ALA n 1 18 GLU n 1 19 ILE n 1 20 ASN n 1 21 ASP n 1 22 LEU n 1 23 GLU n 1 24 ASN n 1 25 LEU n 1 26 GLY n 1 27 GLU n 1 28 MET n 1 29 GLY n 1 30 SER n 1 31 GLY n 1 32 THR n 1 33 CYS n 1 34 GLY n 1 35 GLN n 1 36 VAL n 1 37 TRP n 1 38 LYS n 1 39 MET n 1 40 ARG n 1 41 PHE n 1 42 ARG n 1 43 LYS n 1 44 THR n 1 45 GLY n 1 46 HIS n 1 47 VAL n 1 48 ILE n 1 49 ALA n 1 50 VAL n 1 51 LYS n 1 52 GLN n 1 53 MET n 1 54 ARG n 1 55 ARG n 1 56 SER n 1 57 GLY n 1 58 ASN n 1 59 LYS n 1 60 GLU n 1 61 GLU n 1 62 ASN n 1 63 LYS n 1 64 ARG n 1 65 ILE n 1 66 LEU n 1 67 MET n 1 68 ASP n 1 69 LEU n 1 70 ASP n 1 71 VAL n 1 72 VAL n 1 73 LEU n 1 74 LYS n 1 75 SER n 1 76 HIS n 1 77 ASP n 1 78 CYS n 1 79 PRO n 1 80 TYR n 1 81 ILE n 1 82 VAL n 1 83 GLN n 1 84 CYS n 1 85 PHE n 1 86 GLY n 1 87 THR n 1 88 PHE n 1 89 ILE n 1 90 THR n 1 91 ASN n 1 92 THR n 1 93 ASP n 1 94 VAL n 1 95 PHE n 1 96 ILE n 1 97 ALA n 1 98 MET n 1 99 GLU n 1 100 LEU n 1 101 MET n 1 102 GLY n 1 103 THR n 1 104 CSO n 1 105 ALA n 1 106 GLU n 1 107 LYS n 1 108 LEU n 1 109 LYS n 1 110 LYS n 1 111 ARG n 1 112 MET n 1 113 GLN n 1 114 GLY n 1 115 PRO n 1 116 ILE n 1 117 PRO n 1 118 GLU n 1 119 ARG n 1 120 ILE n 1 121 LEU n 1 122 GLY n 1 123 LYS n 1 124 MET n 1 125 THR n 1 126 VAL n 1 127 ALA n 1 128 ILE n 1 129 VAL n 1 130 LYS n 1 131 ALA n 1 132 LEU n 1 133 TYR n 1 134 TYR n 1 135 LEU n 1 136 LYS n 1 137 GLU n 1 138 LYS n 1 139 HIS n 1 140 GLY n 1 141 VAL n 1 142 ILE n 1 143 HIS n 1 144 ARG n 1 145 ASP n 1 146 VAL n 1 147 LYS n 1 148 PRO n 1 149 SER n 1 150 ASN n 1 151 ILE n 1 152 LEU n 1 153 LEU n 1 154 ASP n 1 155 GLU n 1 156 ARG n 1 157 GLY n 1 158 GLN n 1 159 ILE n 1 160 LYS n 1 161 LEU n 1 162 CSO n 1 163 ASP n 1 164 PHE n 1 165 GLY n 1 166 ILE n 1 167 SER n 1 168 GLY n 1 169 ARG n 1 170 LEU n 1 171 VAL n 1 172 ASP n 1 173 SER n 1 174 LYS n 1 175 ALA n 1 176 LYS n 1 177 THR n 1 178 ARG n 1 179 SER n 1 180 ALA n 1 181 GLY n 1 182 CYS n 1 183 ALA n 1 184 ALA n 1 185 TYR n 1 186 MET n 1 187 ALA n 1 188 PRO n 1 189 GLU n 1 190 ARG n 1 191 ILE n 1 192 ASP n 1 193 PRO n 1 194 PRO n 1 195 ASP n 1 196 PRO n 1 197 THR n 1 198 LYS n 1 199 PRO n 1 200 ASP n 1 201 TYR n 1 202 ASP n 1 203 ILE n 1 204 ARG n 1 205 ALA n 1 206 ASP n 1 207 VAL n 1 208 TRP n 1 209 SER n 1 210 LEU n 1 211 GLY n 1 212 ILE n 1 213 SER n 1 214 LEU n 1 215 VAL n 1 216 GLU n 1 217 LEU n 1 218 ALA n 1 219 THR n 1 220 GLY n 1 221 GLN n 1 222 PHE n 1 223 PRO n 1 224 TYR n 1 225 LYS n 1 226 ASN n 1 227 CYS n 1 228 LYS n 1 229 THR n 1 230 ASP n 1 231 PHE n 1 232 GLU n 1 233 VAL n 1 234 LEU n 1 235 THR n 1 236 LYS n 1 237 VAL n 1 238 LEU n 1 239 GLN n 1 240 GLU n 1 241 GLU n 1 242 PRO n 1 243 PRO n 1 244 LEU n 1 245 LEU n 1 246 PRO n 1 247 GLY n 1 248 HIS n 1 249 MET n 1 250 GLY n 1 251 PHE n 1 252 SER n 1 253 GLY n 1 254 ASP n 1 255 PHE n 1 256 GLN n 1 257 SER n 1 258 PHE n 1 259 VAL n 1 260 LYS n 1 261 ASP n 1 262 CYS n 1 263 LEU n 1 264 THR n 1 265 LYS n 1 266 ASP n 1 267 HIS n 1 268 ARG n 1 269 LYS n 1 270 ARG n 1 271 PRO n 1 272 LYS n 1 273 TYR n 1 274 ASN n 1 275 LYS n 1 276 LEU n 1 277 LEU n 1 278 GLU n 1 279 HIS n 1 280 SER n 1 281 PHE n 1 282 ILE n 1 283 LYS n 1 284 ARG n 1 285 TYR n 1 286 GLU n 1 287 THR n 1 288 LEU n 1 289 GLU n 1 290 VAL n 1 291 ASP n 1 292 VAL n 1 293 ALA n 1 294 SER n 1 295 TRP n 1 296 PHE n 1 297 LYS n 1 298 ASP n 1 299 VAL n 1 300 MET n 1 301 ALA n 1 302 LYS n 1 303 THR n 1 304 GLU n 1 305 SER n 1 306 PRO n 1 307 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 307 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP2K7, JNKK2, MEK7, MKK7, PRKMK7, SKK4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant -R3-pRARE2 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC28-Bsa4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IHH non-polymer . '[4-({4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl}amino)phenyl]acetonitrile' ? 'C22 H19 N7' 381.433 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 115 ? ? ? A . n A 1 2 MET 2 116 ? ? ? A . n A 1 3 LYS 3 117 117 LYS LYS A . n A 1 4 GLN 4 118 118 GLN GLN A . n A 1 5 THR 5 119 119 THR THR A . n A 1 6 GLY 6 120 120 GLY GLY A . n A 1 7 TYR 7 121 121 TYR TYR A . n A 1 8 LEU 8 122 122 LEU LEU A . n A 1 9 THR 9 123 123 THR THR A . n A 1 10 ILE 10 124 124 ILE ILE A . n A 1 11 GLY 11 125 125 GLY GLY A . n A 1 12 GLY 12 126 126 GLY GLY A . n A 1 13 GLN 13 127 127 GLN GLN A . n A 1 14 ARG 14 128 128 ARG ARG A . n A 1 15 TYR 15 129 129 TYR TYR A . n A 1 16 GLN 16 130 130 GLN GLN A . n A 1 17 ALA 17 131 131 ALA ALA A . n A 1 18 GLU 18 132 132 GLU GLU A . n A 1 19 ILE 19 133 133 ILE ILE A . n A 1 20 ASN 20 134 134 ASN ASN A . n A 1 21 ASP 21 135 135 ASP ASP A . n A 1 22 LEU 22 136 136 LEU LEU A . n A 1 23 GLU 23 137 137 GLU GLU A . n A 1 24 ASN 24 138 138 ASN ASN A . n A 1 25 LEU 25 139 139 LEU LEU A . n A 1 26 GLY 26 140 140 GLY GLY A . n A 1 27 GLU 27 141 141 GLU GLU A . n A 1 28 MET 28 142 142 MET MET A . n A 1 29 GLY 29 143 143 GLY GLY A . n A 1 30 SER 30 144 ? ? ? A . n A 1 31 GLY 31 145 ? ? ? A . n A 1 32 THR 32 146 ? ? ? A . n A 1 33 CYS 33 147 ? ? ? A . n A 1 34 GLY 34 148 148 GLY GLY A . n A 1 35 GLN 35 149 149 GLN GLN A . n A 1 36 VAL 36 150 150 VAL VAL A . n A 1 37 TRP 37 151 151 TRP TRP A . n A 1 38 LYS 38 152 152 LYS LYS A . n A 1 39 MET 39 153 153 MET MET A . n A 1 40 ARG 40 154 154 ARG ARG A . n A 1 41 PHE 41 155 155 PHE PHE A . n A 1 42 ARG 42 156 156 ARG ARG A . n A 1 43 LYS 43 157 157 LYS LYS A . n A 1 44 THR 44 158 158 THR THR A . n A 1 45 GLY 45 159 159 GLY GLY A . n A 1 46 HIS 46 160 160 HIS HIS A . n A 1 47 VAL 47 161 161 VAL VAL A . n A 1 48 ILE 48 162 162 ILE ILE A . n A 1 49 ALA 49 163 163 ALA ALA A . n A 1 50 VAL 50 164 164 VAL VAL A . n A 1 51 LYS 51 165 165 LYS LYS A . n A 1 52 GLN 52 166 166 GLN GLN A . n A 1 53 MET 53 167 167 MET MET A . n A 1 54 ARG 54 168 168 ARG ARG A . n A 1 55 ARG 55 169 169 ARG ARG A . n A 1 56 SER 56 170 170 SER SER A . n A 1 57 GLY 57 171 171 GLY GLY A . n A 1 58 ASN 58 172 172 ASN ASN A . n A 1 59 LYS 59 173 173 LYS LYS A . n A 1 60 GLU 60 174 174 GLU GLU A . n A 1 61 GLU 61 175 175 GLU GLU A . n A 1 62 ASN 62 176 176 ASN ASN A . n A 1 63 LYS 63 177 177 LYS LYS A . n A 1 64 ARG 64 178 178 ARG ARG A . n A 1 65 ILE 65 179 179 ILE ILE A . n A 1 66 LEU 66 180 180 LEU LEU A . n A 1 67 MET 67 181 181 MET MET A . n A 1 68 ASP 68 182 182 ASP ASP A . n A 1 69 LEU 69 183 183 LEU LEU A . n A 1 70 ASP 70 184 184 ASP ASP A . n A 1 71 VAL 71 185 185 VAL VAL A . n A 1 72 VAL 72 186 186 VAL VAL A . n A 1 73 LEU 73 187 187 LEU LEU A . n A 1 74 LYS 74 188 188 LYS LYS A . n A 1 75 SER 75 189 189 SER SER A . n A 1 76 HIS 76 190 190 HIS HIS A . n A 1 77 ASP 77 191 191 ASP ASP A . n A 1 78 CYS 78 192 192 CYS CYS A . n A 1 79 PRO 79 193 193 PRO PRO A . n A 1 80 TYR 80 194 194 TYR TYR A . n A 1 81 ILE 81 195 195 ILE ILE A . n A 1 82 VAL 82 196 196 VAL VAL A . n A 1 83 GLN 83 197 197 GLN GLN A . n A 1 84 CYS 84 198 198 CYS CYS A . n A 1 85 PHE 85 199 199 PHE PHE A . n A 1 86 GLY 86 200 200 GLY GLY A . n A 1 87 THR 87 201 201 THR THR A . n A 1 88 PHE 88 202 202 PHE PHE A . n A 1 89 ILE 89 203 203 ILE ILE A . n A 1 90 THR 90 204 204 THR THR A . n A 1 91 ASN 91 205 205 ASN ASN A . n A 1 92 THR 92 206 206 THR THR A . n A 1 93 ASP 93 207 207 ASP ASP A . n A 1 94 VAL 94 208 208 VAL VAL A . n A 1 95 PHE 95 209 209 PHE PHE A . n A 1 96 ILE 96 210 210 ILE ILE A . n A 1 97 ALA 97 211 211 ALA ALA A . n A 1 98 MET 98 212 212 MET MET A . n A 1 99 GLU 99 213 213 GLU GLU A . n A 1 100 LEU 100 214 214 LEU LEU A . n A 1 101 MET 101 215 215 MET MET A . n A 1 102 GLY 102 216 216 GLY GLY A . n A 1 103 THR 103 217 217 THR THR A . n A 1 104 CSO 104 218 218 CSO CSO A . n A 1 105 ALA 105 219 219 ALA ALA A . n A 1 106 GLU 106 220 220 GLU GLU A . n A 1 107 LYS 107 221 221 LYS LYS A . n A 1 108 LEU 108 222 222 LEU LEU A . n A 1 109 LYS 109 223 223 LYS LYS A . n A 1 110 LYS 110 224 224 LYS LYS A . n A 1 111 ARG 111 225 225 ARG ARG A . n A 1 112 MET 112 226 226 MET MET A . n A 1 113 GLN 113 227 227 GLN GLN A . n A 1 114 GLY 114 228 228 GLY GLY A . n A 1 115 PRO 115 229 229 PRO PRO A . n A 1 116 ILE 116 230 230 ILE ILE A . n A 1 117 PRO 117 231 231 PRO PRO A . n A 1 118 GLU 118 232 232 GLU GLU A . n A 1 119 ARG 119 233 233 ARG ARG A . n A 1 120 ILE 120 234 234 ILE ILE A . n A 1 121 LEU 121 235 235 LEU LEU A . n A 1 122 GLY 122 236 236 GLY GLY A . n A 1 123 LYS 123 237 237 LYS LYS A . n A 1 124 MET 124 238 238 MET MET A . n A 1 125 THR 125 239 239 THR THR A . n A 1 126 VAL 126 240 240 VAL VAL A . n A 1 127 ALA 127 241 241 ALA ALA A . n A 1 128 ILE 128 242 242 ILE ILE A . n A 1 129 VAL 129 243 243 VAL VAL A . n A 1 130 LYS 130 244 244 LYS LYS A . n A 1 131 ALA 131 245 245 ALA ALA A . n A 1 132 LEU 132 246 246 LEU LEU A . n A 1 133 TYR 133 247 247 TYR TYR A . n A 1 134 TYR 134 248 248 TYR TYR A . n A 1 135 LEU 135 249 249 LEU LEU A . n A 1 136 LYS 136 250 250 LYS LYS A . n A 1 137 GLU 137 251 251 GLU GLU A . n A 1 138 LYS 138 252 252 LYS LYS A . n A 1 139 HIS 139 253 253 HIS HIS A . n A 1 140 GLY 140 254 254 GLY GLY A . n A 1 141 VAL 141 255 255 VAL VAL A . n A 1 142 ILE 142 256 256 ILE ILE A . n A 1 143 HIS 143 257 257 HIS HIS A . n A 1 144 ARG 144 258 258 ARG ARG A . n A 1 145 ASP 145 259 259 ASP ASP A . n A 1 146 VAL 146 260 260 VAL VAL A . n A 1 147 LYS 147 261 261 LYS LYS A . n A 1 148 PRO 148 262 262 PRO PRO A . n A 1 149 SER 149 263 263 SER SER A . n A 1 150 ASN 150 264 264 ASN ASN A . n A 1 151 ILE 151 265 265 ILE ILE A . n A 1 152 LEU 152 266 266 LEU LEU A . n A 1 153 LEU 153 267 267 LEU LEU A . n A 1 154 ASP 154 268 268 ASP ASP A . n A 1 155 GLU 155 269 269 GLU GLU A . n A 1 156 ARG 156 270 270 ARG ARG A . n A 1 157 GLY 157 271 271 GLY GLY A . n A 1 158 GLN 158 272 272 GLN GLN A . n A 1 159 ILE 159 273 273 ILE ILE A . n A 1 160 LYS 160 274 274 LYS LYS A . n A 1 161 LEU 161 275 275 LEU LEU A . n A 1 162 CSO 162 276 276 CSO CSO A . n A 1 163 ASP 163 277 277 ASP ASP A . n A 1 164 PHE 164 278 278 PHE PHE A . n A 1 165 GLY 165 279 279 GLY GLY A . n A 1 166 ILE 166 280 280 ILE ILE A . n A 1 167 SER 167 281 281 SER SER A . n A 1 168 GLY 168 282 282 GLY GLY A . n A 1 169 ARG 169 283 ? ? ? A . n A 1 170 LEU 170 284 ? ? ? A . n A 1 171 VAL 171 285 ? ? ? A . n A 1 172 ASP 172 286 ? ? ? A . n A 1 173 SER 173 287 ? ? ? A . n A 1 174 LYS 174 288 ? ? ? A . n A 1 175 ALA 175 289 ? ? ? A . n A 1 176 LYS 176 290 ? ? ? A . n A 1 177 THR 177 291 ? ? ? A . n A 1 178 ARG 178 292 ? ? ? A . n A 1 179 SER 179 293 ? ? ? A . n A 1 180 ALA 180 294 ? ? ? A . n A 1 181 GLY 181 295 ? ? ? A . n A 1 182 CYS 182 296 ? ? ? A . n A 1 183 ALA 183 297 ? ? ? A . n A 1 184 ALA 184 298 ? ? ? A . n A 1 185 TYR 185 299 ? ? ? A . n A 1 186 MET 186 300 ? ? ? A . n A 1 187 ALA 187 301 ? ? ? A . n A 1 188 PRO 188 302 ? ? ? A . n A 1 189 GLU 189 303 ? ? ? A . n A 1 190 ARG 190 304 ? ? ? A . n A 1 191 ILE 191 305 ? ? ? A . n A 1 192 ASP 192 306 ? ? ? A . n A 1 193 PRO 193 307 ? ? ? A . n A 1 194 PRO 194 308 ? ? ? A . n A 1 195 ASP 195 309 ? ? ? A . n A 1 196 PRO 196 310 ? ? ? A . n A 1 197 THR 197 311 ? ? ? A . n A 1 198 LYS 198 312 ? ? ? A . n A 1 199 PRO 199 313 ? ? ? A . n A 1 200 ASP 200 314 ? ? ? A . n A 1 201 TYR 201 315 ? ? ? A . n A 1 202 ASP 202 316 ? ? ? A . n A 1 203 ILE 203 317 ? ? ? A . n A 1 204 ARG 204 318 ? ? ? A . n A 1 205 ALA 205 319 ? ? ? A . n A 1 206 ASP 206 320 320 ASP ASP A . n A 1 207 VAL 207 321 321 VAL VAL A . n A 1 208 TRP 208 322 322 TRP TRP A . n A 1 209 SER 209 323 323 SER SER A . n A 1 210 LEU 210 324 324 LEU LEU A . n A 1 211 GLY 211 325 325 GLY GLY A . n A 1 212 ILE 212 326 326 ILE ILE A . n A 1 213 SER 213 327 327 SER SER A . n A 1 214 LEU 214 328 328 LEU LEU A . n A 1 215 VAL 215 329 329 VAL VAL A . n A 1 216 GLU 216 330 330 GLU GLU A . n A 1 217 LEU 217 331 331 LEU LEU A . n A 1 218 ALA 218 332 332 ALA ALA A . n A 1 219 THR 219 333 333 THR THR A . n A 1 220 GLY 220 334 334 GLY GLY A . n A 1 221 GLN 221 335 335 GLN GLN A . n A 1 222 PHE 222 336 336 PHE PHE A . n A 1 223 PRO 223 337 337 PRO PRO A . n A 1 224 TYR 224 338 338 TYR TYR A . n A 1 225 LYS 225 339 339 LYS LYS A . n A 1 226 ASN 226 340 340 ASN ASN A . n A 1 227 CYS 227 341 341 CYS CYS A . n A 1 228 LYS 228 342 342 LYS LYS A . n A 1 229 THR 229 343 343 THR THR A . n A 1 230 ASP 230 344 344 ASP ASP A . n A 1 231 PHE 231 345 345 PHE PHE A . n A 1 232 GLU 232 346 346 GLU GLU A . n A 1 233 VAL 233 347 347 VAL VAL A . n A 1 234 LEU 234 348 348 LEU LEU A . n A 1 235 THR 235 349 349 THR THR A . n A 1 236 LYS 236 350 350 LYS LYS A . n A 1 237 VAL 237 351 351 VAL VAL A . n A 1 238 LEU 238 352 352 LEU LEU A . n A 1 239 GLN 239 353 353 GLN GLN A . n A 1 240 GLU 240 354 354 GLU GLU A . n A 1 241 GLU 241 355 355 GLU GLU A . n A 1 242 PRO 242 356 356 PRO PRO A . n A 1 243 PRO 243 357 357 PRO PRO A . n A 1 244 LEU 244 358 358 LEU LEU A . n A 1 245 LEU 245 359 359 LEU LEU A . n A 1 246 PRO 246 360 360 PRO PRO A . n A 1 247 GLY 247 361 361 GLY GLY A . n A 1 248 HIS 248 362 362 HIS HIS A . n A 1 249 MET 249 363 363 MET MET A . n A 1 250 GLY 250 364 364 GLY GLY A . n A 1 251 PHE 251 365 365 PHE PHE A . n A 1 252 SER 252 366 366 SER SER A . n A 1 253 GLY 253 367 367 GLY GLY A . n A 1 254 ASP 254 368 368 ASP ASP A . n A 1 255 PHE 255 369 369 PHE PHE A . n A 1 256 GLN 256 370 370 GLN GLN A . n A 1 257 SER 257 371 371 SER SER A . n A 1 258 PHE 258 372 372 PHE PHE A . n A 1 259 VAL 259 373 373 VAL VAL A . n A 1 260 LYS 260 374 374 LYS LYS A . n A 1 261 ASP 261 375 375 ASP ASP A . n A 1 262 CYS 262 376 376 CYS CYS A . n A 1 263 LEU 263 377 377 LEU LEU A . n A 1 264 THR 264 378 378 THR THR A . n A 1 265 LYS 265 379 379 LYS LYS A . n A 1 266 ASP 266 380 380 ASP ASP A . n A 1 267 HIS 267 381 381 HIS HIS A . n A 1 268 ARG 268 382 382 ARG ARG A . n A 1 269 LYS 269 383 383 LYS LYS A . n A 1 270 ARG 270 384 384 ARG ARG A . n A 1 271 PRO 271 385 385 PRO PRO A . n A 1 272 LYS 272 386 386 LYS LYS A . n A 1 273 TYR 273 387 387 TYR TYR A . n A 1 274 ASN 274 388 388 ASN ASN A . n A 1 275 LYS 275 389 389 LYS LYS A . n A 1 276 LEU 276 390 390 LEU LEU A . n A 1 277 LEU 277 391 391 LEU LEU A . n A 1 278 GLU 278 392 392 GLU GLU A . n A 1 279 HIS 279 393 393 HIS HIS A . n A 1 280 SER 280 394 394 SER SER A . n A 1 281 PHE 281 395 395 PHE PHE A . n A 1 282 ILE 282 396 396 ILE ILE A . n A 1 283 LYS 283 397 397 LYS LYS A . n A 1 284 ARG 284 398 398 ARG ARG A . n A 1 285 TYR 285 399 399 TYR TYR A . n A 1 286 GLU 286 400 400 GLU GLU A . n A 1 287 THR 287 401 401 THR THR A . n A 1 288 LEU 288 402 402 LEU LEU A . n A 1 289 GLU 289 403 403 GLU GLU A . n A 1 290 VAL 290 404 404 VAL VAL A . n A 1 291 ASP 291 405 405 ASP ASP A . n A 1 292 VAL 292 406 406 VAL VAL A . n A 1 293 ALA 293 407 407 ALA ALA A . n A 1 294 SER 294 408 408 SER SER A . n A 1 295 TRP 295 409 409 TRP TRP A . n A 1 296 PHE 296 410 410 PHE PHE A . n A 1 297 LYS 297 411 411 LYS LYS A . n A 1 298 ASP 298 412 412 ASP ASP A . n A 1 299 VAL 299 413 413 VAL VAL A . n A 1 300 MET 300 414 414 MET MET A . n A 1 301 ALA 301 415 415 ALA ALA A . n A 1 302 LYS 302 416 416 LYS LYS A . n A 1 303 THR 303 417 417 THR THR A . n A 1 304 GLU 304 418 418 GLU GLU A . n A 1 305 SER 305 419 419 SER SER A . n A 1 306 PRO 306 420 ? ? ? A . n A 1 307 ARG 307 421 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IHH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IHH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IHH 1 501 1 IHH XXX A . C 3 HOH 1 601 10 HOH HOH A . C 3 HOH 2 602 6 HOH HOH A . C 3 HOH 3 603 3 HOH HOH A . C 3 HOH 4 604 5 HOH HOH A . C 3 HOH 5 605 2 HOH HOH A . C 3 HOH 6 606 14 HOH HOH A . C 3 HOH 7 607 11 HOH HOH A . C 3 HOH 8 608 4 HOH HOH A . C 3 HOH 9 609 15 HOH HOH A . C 3 HOH 10 610 13 HOH HOH A . C 3 HOH 11 611 9 HOH HOH A . C 3 HOH 12 612 12 HOH HOH A . C 3 HOH 13 613 8 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 117 ? CG ? A LYS 3 CG 2 1 Y 1 A LYS 117 ? CD ? A LYS 3 CD 3 1 Y 1 A LYS 117 ? CE ? A LYS 3 CE 4 1 Y 1 A LYS 117 ? NZ ? A LYS 3 NZ 5 1 Y 1 A GLN 127 ? CG ? A GLN 13 CG 6 1 Y 1 A GLN 127 ? CD ? A GLN 13 CD 7 1 Y 1 A GLN 127 ? OE1 ? A GLN 13 OE1 8 1 Y 1 A GLN 127 ? NE2 ? A GLN 13 NE2 9 1 Y 1 A LYS 165 ? CD ? A LYS 51 CD 10 1 Y 1 A LYS 165 ? CE ? A LYS 51 CE 11 1 Y 1 A LYS 165 ? NZ ? A LYS 51 NZ 12 1 Y 1 A LYS 173 ? CD ? A LYS 59 CD 13 1 Y 1 A LYS 173 ? CE ? A LYS 59 CE 14 1 Y 1 A LYS 173 ? NZ ? A LYS 59 NZ 15 1 Y 1 A LYS 177 ? CG ? A LYS 63 CG 16 1 Y 1 A LYS 177 ? CD ? A LYS 63 CD 17 1 Y 1 A LYS 177 ? CE ? A LYS 63 CE 18 1 Y 1 A LYS 177 ? NZ ? A LYS 63 NZ 19 1 Y 1 A ARG 178 ? CG ? A ARG 64 CG 20 1 Y 1 A ARG 178 ? CD ? A ARG 64 CD 21 1 Y 1 A ARG 178 ? NE ? A ARG 64 NE 22 1 Y 1 A ARG 178 ? CZ ? A ARG 64 CZ 23 1 Y 1 A ARG 178 ? NH1 ? A ARG 64 NH1 24 1 Y 1 A ARG 178 ? NH2 ? A ARG 64 NH2 25 1 Y 1 A MET 181 ? CG ? A MET 67 CG 26 1 Y 1 A MET 181 ? SD ? A MET 67 SD 27 1 Y 1 A MET 181 ? CE ? A MET 67 CE 28 1 Y 1 A ARG 258 ? CG ? A ARG 144 CG 29 1 Y 1 A ARG 258 ? CD ? A ARG 144 CD 30 1 Y 1 A ARG 258 ? NE ? A ARG 144 NE 31 1 Y 1 A ARG 258 ? CZ ? A ARG 144 CZ 32 1 Y 1 A ARG 258 ? NH1 ? A ARG 144 NH1 33 1 Y 1 A ARG 258 ? NH2 ? A ARG 144 NH2 34 1 Y 1 A LYS 339 ? CE ? A LYS 225 CE 35 1 Y 1 A LYS 339 ? NZ ? A LYS 225 NZ 36 1 Y 1 A LYS 342 ? CD ? A LYS 228 CD 37 1 Y 1 A LYS 342 ? CE ? A LYS 228 CE 38 1 Y 1 A LYS 342 ? NZ ? A LYS 228 NZ 39 1 Y 1 A LYS 383 ? CG ? A LYS 269 CG 40 1 Y 1 A LYS 383 ? CD ? A LYS 269 CD 41 1 Y 1 A LYS 383 ? CE ? A LYS 269 CE 42 1 Y 1 A LYS 383 ? NZ ? A LYS 269 NZ 43 1 Y 1 A LYS 386 ? CG ? A LYS 272 CG 44 1 Y 1 A LYS 386 ? CD ? A LYS 272 CD 45 1 Y 1 A LYS 386 ? CE ? A LYS 272 CE 46 1 Y 1 A LYS 386 ? NZ ? A LYS 272 NZ 47 1 N 1 A IHH 501 ? C1 ? B IHH 1 C1 48 1 N 1 A IHH 501 ? C2 ? B IHH 1 C2 49 1 N 1 A IHH 501 ? C4 ? B IHH 1 C4 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.21 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0253 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6YG5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.660 _cell.length_a_esd ? _cell.length_b 68.031 _cell.length_b_esd ? _cell.length_c 84.700 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YG5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YG5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;16% PEG3350, 0.2 M ammonium acetate, 0.1 M tris, pH 7.8 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-08-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6YG5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.400 _reflns.d_resolution_low 39.640 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13948 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.700 _reflns.pdbx_Rmerge_I_obs 0.061 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 5.200 _reflns.pdbx_netI_over_sigmaI 12.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.069 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.400 2.530 ? 1.000 ? ? ? ? 2013 99.600 ? ? ? ? 0.730 ? ? ? ? ? ? ? ? 4.700 0.730 ? ? ? 0.819 0.364 ? 1 1 0.766 ? ? 2.530 2.680 ? 1.800 ? ? ? ? 1860 99.400 ? ? ? ? 0.424 ? ? ? ? ? ? ? ? 4.800 0.424 ? ? ? 0.474 0.209 ? 2 1 ? ? ? 2.680 2.870 ? 2.800 ? ? ? ? 1792 99.300 ? ? ? ? 0.259 ? ? ? ? ? ? ? ? 4.800 0.259 ? ? ? 0.290 0.128 ? 3 1 ? ? ? 2.870 3.100 ? 4.900 ? ? ? ? 1675 99.700 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 4.700 0.147 ? ? ? 0.165 0.074 ? 4 1 ? ? ? 3.100 3.390 ? 7.500 ? ? ? ? 1529 99.300 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 4.700 0.092 ? ? ? 0.103 0.047 ? 5 1 ? ? ? 3.390 3.790 ? 9.900 ? ? ? ? 1402 99.600 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 4.800 0.059 ? ? ? 0.066 0.030 ? 6 1 ? ? ? 3.790 4.380 ? 12.100 ? ? ? ? 1250 99.800 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 4.800 0.050 ? ? ? 0.056 0.025 ? 7 1 ? ? ? 4.380 5.370 ? 11.400 ? ? ? ? 1081 99.500 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 4.500 0.048 ? ? ? 0.055 0.025 ? 8 1 ? ? ? 5.370 7.590 ? 10.900 ? ? ? ? 846 99.500 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 4.400 0.049 ? ? ? 0.056 0.025 ? 9 1 ? ? ? 7.590 39.640 ? 10.400 ? ? ? ? 500 98.100 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 4.100 0.048 ? ? ? 0.055 0.026 ? 10 1 ? ? ? # _refine.aniso_B[1][1] -0.8700 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -2.1200 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 2.9900 _refine.B_iso_max 141.000 _refine.B_iso_mean 77.0710 _refine.B_iso_min 52.580 _refine.correlation_coeff_Fo_to_Fc 0.9460 _refine.correlation_coeff_Fo_to_Fc_free 0.9310 _refine.details 'U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YG5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4000 _refine.ls_d_res_low 39.6400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13237 _refine.ls_number_reflns_R_free 677 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.2700 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2333 _refine.ls_R_factor_R_free 0.2815 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2307 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2dyl _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3720 _refine.pdbx_overall_ESU_R_Free 0.2740 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 26.3730 _refine.overall_SU_ML 0.2710 _refine.overall_SU_R_Cruickshank_DPI 0.3716 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4000 _refine_hist.d_res_low 39.6400 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 2099 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 262 _refine_hist.pdbx_B_iso_mean_ligand 100.34 _refine_hist.pdbx_B_iso_mean_solvent 72.27 _refine_hist.pdbx_number_atoms_protein 2060 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 2128 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1991 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.174 1.643 2867 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.123 1.594 4614 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.116 5.000 259 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.713 22.816 103 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.918 15.000 380 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.970 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.042 0.200 272 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 2451 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 438 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.4000 _refine_ls_shell.d_res_low 2.4620 _refine_ls_shell.number_reflns_all 1008 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_R_work 972 _refine_ls_shell.percent_reflns_obs 99.7000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3200 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3140 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YG5 _struct.title 'Crystal structure of MKK7 (MAP2K7) in complex with ASC69' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YG5 _struct_keywords.text ;kinase, kinase inhibitor, MKK7, MEK7, MAP2K7, MAP2K, MEK, JNK signaling, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MP2K7_HUMAN _struct_ref.pdbx_db_accession O14733 _struct_ref.pdbx_db_isoform O14733-3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYI VQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKL CDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEE PPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPR ; _struct_ref.pdbx_align_begin 100 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YG5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 307 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14733 _struct_ref_seq.db_align_beg 116 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 421 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 116 _struct_ref_seq.pdbx_auth_seq_align_end 421 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6YG5 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O14733 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 115 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13550 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 18 ? ASN A 20 ? GLU A 132 ASN A 134 5 ? 3 HELX_P HELX_P2 AA2 ASN A 58 ? SER A 75 ? ASN A 172 SER A 189 1 ? 18 HELX_P HELX_P3 AA3 ALA A 105 ? GLN A 113 ? ALA A 219 GLN A 227 1 ? 9 HELX_P HELX_P4 AA4 PRO A 117 ? GLY A 140 ? PRO A 231 GLY A 254 1 ? 24 HELX_P HELX_P5 AA5 LYS A 147 ? SER A 149 ? LYS A 261 SER A 263 5 ? 3 HELX_P HELX_P6 AA6 VAL A 207 ? GLY A 220 ? VAL A 321 GLY A 334 1 ? 14 HELX_P HELX_P7 AA7 THR A 229 ? GLU A 240 ? THR A 343 GLU A 354 1 ? 12 HELX_P HELX_P8 AA8 SER A 252 ? LEU A 263 ? SER A 366 LEU A 377 1 ? 12 HELX_P HELX_P9 AA9 ASP A 266 ? ARG A 270 ? ASP A 380 ARG A 384 5 ? 5 HELX_P HELX_P10 AB1 LYS A 272 ? LEU A 277 ? LYS A 386 LEU A 391 1 ? 6 HELX_P HELX_P11 AB2 HIS A 279 ? LEU A 288 ? HIS A 393 LEU A 402 1 ? 10 HELX_P HELX_P12 AB3 ASP A 291 ? LYS A 302 ? ASP A 405 LYS A 416 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 103 C ? ? ? 1_555 A CSO 104 N ? ? A THR 217 A CSO 218 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale2 covale both ? A CSO 104 C ? ? ? 1_555 A ALA 105 N ? ? A CSO 218 A ALA 219 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale3 covale both ? A LEU 161 C ? ? ? 1_555 A CSO 162 N ? ? A LEU 275 A CSO 276 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale4 covale both ? A CSO 162 C ? ? ? 1_555 A ASP 163 N ? ? A CSO 276 A ASP 277 1_555 ? ? ? ? ? ? ? 1.344 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CSO A 104 ? . . . . CSO A 218 ? 1_555 . . . . . . . CYS 1 CSO Hydroxylation 'Named protein modification' 2 CSO A 162 ? . . . . CSO A 276 ? 1_555 . . . . . . . CYS 1 CSO Hydroxylation 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 7 ? LEU A 8 ? TYR A 121 LEU A 122 AA1 2 TYR A 15 ? GLN A 16 ? TYR A 129 GLN A 130 AA2 1 LEU A 22 ? GLU A 27 ? LEU A 136 GLU A 141 AA2 2 VAL A 36 ? PHE A 41 ? VAL A 150 PHE A 155 AA2 3 VAL A 47 ? ARG A 54 ? VAL A 161 ARG A 168 AA2 4 ASP A 93 ? MET A 98 ? ASP A 207 MET A 212 AA2 5 CYS A 84 ? ILE A 89 ? CYS A 198 ILE A 203 AA3 1 THR A 103 ? CSO A 104 ? THR A 217 CSO A 218 AA3 2 ILE A 151 ? LEU A 153 ? ILE A 265 LEU A 267 AA3 3 ILE A 159 ? LEU A 161 ? ILE A 273 LEU A 275 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 8 ? N LEU A 122 O TYR A 15 ? O TYR A 129 AA2 1 2 N GLU A 23 ? N GLU A 137 O ARG A 40 ? O ARG A 154 AA2 2 3 N TRP A 37 ? N TRP A 151 O VAL A 50 ? O VAL A 164 AA2 3 4 N ALA A 49 ? N ALA A 163 O MET A 98 ? O MET A 212 AA2 4 5 O ALA A 97 ? O ALA A 211 N GLY A 86 ? N GLY A 200 AA3 1 2 N THR A 103 ? N THR A 217 O LEU A 153 ? O LEU A 267 AA3 2 3 N LEU A 152 ? N LEU A 266 O LYS A 160 ? O LYS A 274 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id IHH _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'binding site for residue IHH A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 GLY A 29 ? GLY A 143 . ? 1_555 ? 2 AC1 8 GLU A 99 ? GLU A 213 . ? 1_555 ? 3 AC1 8 LEU A 100 ? LEU A 214 . ? 1_555 ? 4 AC1 8 MET A 101 ? MET A 215 . ? 1_555 ? 5 AC1 8 GLY A 102 ? GLY A 216 . ? 1_555 ? 6 AC1 8 THR A 103 ? THR A 217 . ? 1_555 ? 7 AC1 8 CSO A 162 ? CSO A 276 . ? 1_555 ? 8 AC1 8 ASP A 163 ? ASP A 277 . ? 1_555 ? # _pdbx_entry_details.entry_id 6YG5 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 158 ? ? -132.56 -35.02 2 1 ASN A 172 ? ? -34.93 121.60 3 1 GLU A 213 ? ? -34.77 124.32 4 1 PRO A 229 ? ? -39.06 146.49 5 1 ASP A 259 ? ? -165.81 60.05 6 1 LEU A 377 ? ? -101.66 40.31 7 1 ASN A 388 ? ? -36.12 -39.31 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CSO 104 A CSO 218 ? CYS 'modified residue' 2 A CSO 162 A CSO 276 ? CYS 'modified residue' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 18.1030 _pdbx_refine_tls.origin_y 9.2010 _pdbx_refine_tls.origin_z 11.9280 _pdbx_refine_tls.T[1][1] 0.4477 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.1033 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0342 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.6607 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0684 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0421 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.7373 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -2.0765 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.8219 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.5919 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.6437 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.0831 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0153 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0865 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.2117 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0499 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0546 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1568 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.2001 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0190 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0699 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 117 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 419 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 115 ? A SER 1 2 1 Y 1 A MET 116 ? A MET 2 3 1 Y 1 A SER 144 ? A SER 30 4 1 Y 1 A GLY 145 ? A GLY 31 5 1 Y 1 A THR 146 ? A THR 32 6 1 Y 1 A CYS 147 ? A CYS 33 7 1 Y 1 A ARG 283 ? A ARG 169 8 1 Y 1 A LEU 284 ? A LEU 170 9 1 Y 1 A VAL 285 ? A VAL 171 10 1 Y 1 A ASP 286 ? A ASP 172 11 1 Y 1 A SER 287 ? A SER 173 12 1 Y 1 A LYS 288 ? A LYS 174 13 1 Y 1 A ALA 289 ? A ALA 175 14 1 Y 1 A LYS 290 ? A LYS 176 15 1 Y 1 A THR 291 ? A THR 177 16 1 Y 1 A ARG 292 ? A ARG 178 17 1 Y 1 A SER 293 ? A SER 179 18 1 Y 1 A ALA 294 ? A ALA 180 19 1 Y 1 A GLY 295 ? A GLY 181 20 1 Y 1 A CYS 296 ? A CYS 182 21 1 Y 1 A ALA 297 ? A ALA 183 22 1 Y 1 A ALA 298 ? A ALA 184 23 1 Y 1 A TYR 299 ? A TYR 185 24 1 Y 1 A MET 300 ? A MET 186 25 1 Y 1 A ALA 301 ? A ALA 187 26 1 Y 1 A PRO 302 ? A PRO 188 27 1 Y 1 A GLU 303 ? A GLU 189 28 1 Y 1 A ARG 304 ? A ARG 190 29 1 Y 1 A ILE 305 ? A ILE 191 30 1 Y 1 A ASP 306 ? A ASP 192 31 1 Y 1 A PRO 307 ? A PRO 193 32 1 Y 1 A PRO 308 ? A PRO 194 33 1 Y 1 A ASP 309 ? A ASP 195 34 1 Y 1 A PRO 310 ? A PRO 196 35 1 Y 1 A THR 311 ? A THR 197 36 1 Y 1 A LYS 312 ? A LYS 198 37 1 Y 1 A PRO 313 ? A PRO 199 38 1 Y 1 A ASP 314 ? A ASP 200 39 1 Y 1 A TYR 315 ? A TYR 201 40 1 Y 1 A ASP 316 ? A ASP 202 41 1 Y 1 A ILE 317 ? A ILE 203 42 1 Y 1 A ARG 318 ? A ARG 204 43 1 Y 1 A ALA 319 ? A ALA 205 44 1 Y 1 A PRO 420 ? A PRO 306 45 1 Y 1 A ARG 421 ? A ARG 307 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSO N N N N 74 CSO CA C N R 75 CSO CB C N N 76 CSO SG S N N 77 CSO C C N N 78 CSO O O N N 79 CSO OXT O N N 80 CSO OD O N N 81 CSO H H N N 82 CSO H2 H N N 83 CSO HA H N N 84 CSO HB2 H N N 85 CSO HB3 H N N 86 CSO HXT H N N 87 CSO HD H N N 88 CYS N N N N 89 CYS CA C N R 90 CYS C C N N 91 CYS O O N N 92 CYS CB C N N 93 CYS SG S N N 94 CYS OXT O N N 95 CYS H H N N 96 CYS H2 H N N 97 CYS HA H N N 98 CYS HB2 H N N 99 CYS HB3 H N N 100 CYS HG H N N 101 CYS HXT H N N 102 GLN N N N N 103 GLN CA C N S 104 GLN C C N N 105 GLN O O N N 106 GLN CB C N N 107 GLN CG C N N 108 GLN CD C N N 109 GLN OE1 O N N 110 GLN NE2 N N N 111 GLN OXT O N N 112 GLN H H N N 113 GLN H2 H N N 114 GLN HA H N N 115 GLN HB2 H N N 116 GLN HB3 H N N 117 GLN HG2 H N N 118 GLN HG3 H N N 119 GLN HE21 H N N 120 GLN HE22 H N N 121 GLN HXT H N N 122 GLU N N N N 123 GLU CA C N S 124 GLU C C N N 125 GLU O O N N 126 GLU CB C N N 127 GLU CG C N N 128 GLU CD C N N 129 GLU OE1 O N N 130 GLU OE2 O N N 131 GLU OXT O N N 132 GLU H H N N 133 GLU H2 H N N 134 GLU HA H N N 135 GLU HB2 H N N 136 GLU HB3 H N N 137 GLU HG2 H N N 138 GLU HG3 H N N 139 GLU HE2 H N N 140 GLU HXT H N N 141 GLY N N N N 142 GLY CA C N N 143 GLY C C N N 144 GLY O O N N 145 GLY OXT O N N 146 GLY H H N N 147 GLY H2 H N N 148 GLY HA2 H N N 149 GLY HA3 H N N 150 GLY HXT H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 IHH C1 C Y N 176 IHH C2 C Y N 177 IHH C3 C Y N 178 IHH C4 C Y N 179 IHH C5 C Y N 180 IHH C6 C Y N 181 IHH C8 C Y N 182 IHH C10 C Y N 183 IHH C12 C Y N 184 IHH C13 C Y N 185 IHH C14 C Y N 186 IHH C15 C Y N 187 IHH C28 C N N 188 IHH C29 C N N 189 IHH C27 C N N 190 IHH C24 C Y N 191 IHH C23 C Y N 192 IHH N25 N Y N 193 IHH N26 N Y N 194 IHH C22 C Y N 195 IHH N21 N N N 196 IHH N9 N Y N 197 IHH N7 N Y N 198 IHH N11 N N N 199 IHH C17 C Y N 200 IHH C16 C Y N 201 IHH C18 C N N 202 IHH C19 C N N 203 IHH N20 N N N 204 IHH H1 H N N 205 IHH H2 H N N 206 IHH H3 H N N 207 IHH H4 H N N 208 IHH H13 H N N 209 IHH H14 H N N 210 IHH H28 H N N 211 IHH H28A H N N 212 IHH H29 H N N 213 IHH H29A H N N 214 IHH H27 H N N 215 IHH H23 H N N 216 IHH HN11 H N N 217 IHH H17 H N N 218 IHH H16 H N N 219 IHH H18 H N N 220 IHH H18A H N N 221 IHH H181 H N N 222 IHH H19 H N N 223 ILE N N N N 224 ILE CA C N S 225 ILE C C N N 226 ILE O O N N 227 ILE CB C N S 228 ILE CG1 C N N 229 ILE CG2 C N N 230 ILE CD1 C N N 231 ILE OXT O N N 232 ILE H H N N 233 ILE H2 H N N 234 ILE HA H N N 235 ILE HB H N N 236 ILE HG12 H N N 237 ILE HG13 H N N 238 ILE HG21 H N N 239 ILE HG22 H N N 240 ILE HG23 H N N 241 ILE HD11 H N N 242 ILE HD12 H N N 243 ILE HD13 H N N 244 ILE HXT H N N 245 LEU N N N N 246 LEU CA C N S 247 LEU C C N N 248 LEU O O N N 249 LEU CB C N N 250 LEU CG C N N 251 LEU CD1 C N N 252 LEU CD2 C N N 253 LEU OXT O N N 254 LEU H H N N 255 LEU H2 H N N 256 LEU HA H N N 257 LEU HB2 H N N 258 LEU HB3 H N N 259 LEU HG H N N 260 LEU HD11 H N N 261 LEU HD12 H N N 262 LEU HD13 H N N 263 LEU HD21 H N N 264 LEU HD22 H N N 265 LEU HD23 H N N 266 LEU HXT H N N 267 LYS N N N N 268 LYS CA C N S 269 LYS C C N N 270 LYS O O N N 271 LYS CB C N N 272 LYS CG C N N 273 LYS CD C N N 274 LYS CE C N N 275 LYS NZ N N N 276 LYS OXT O N N 277 LYS H H N N 278 LYS H2 H N N 279 LYS HA H N N 280 LYS HB2 H N N 281 LYS HB3 H N N 282 LYS HG2 H N N 283 LYS HG3 H N N 284 LYS HD2 H N N 285 LYS HD3 H N N 286 LYS HE2 H N N 287 LYS HE3 H N N 288 LYS HZ1 H N N 289 LYS HZ2 H N N 290 LYS HZ3 H N N 291 LYS HXT H N N 292 MET N N N N 293 MET CA C N S 294 MET C C N N 295 MET O O N N 296 MET CB C N N 297 MET CG C N N 298 MET SD S N N 299 MET CE C N N 300 MET OXT O N N 301 MET H H N N 302 MET H2 H N N 303 MET HA H N N 304 MET HB2 H N N 305 MET HB3 H N N 306 MET HG2 H N N 307 MET HG3 H N N 308 MET HE1 H N N 309 MET HE2 H N N 310 MET HE3 H N N 311 MET HXT H N N 312 PHE N N N N 313 PHE CA C N S 314 PHE C C N N 315 PHE O O N N 316 PHE CB C N N 317 PHE CG C Y N 318 PHE CD1 C Y N 319 PHE CD2 C Y N 320 PHE CE1 C Y N 321 PHE CE2 C Y N 322 PHE CZ C Y N 323 PHE OXT O N N 324 PHE H H N N 325 PHE H2 H N N 326 PHE HA H N N 327 PHE HB2 H N N 328 PHE HB3 H N N 329 PHE HD1 H N N 330 PHE HD2 H N N 331 PHE HE1 H N N 332 PHE HE2 H N N 333 PHE HZ H N N 334 PHE HXT H N N 335 PRO N N N N 336 PRO CA C N S 337 PRO C C N N 338 PRO O O N N 339 PRO CB C N N 340 PRO CG C N N 341 PRO CD C N N 342 PRO OXT O N N 343 PRO H H N N 344 PRO HA H N N 345 PRO HB2 H N N 346 PRO HB3 H N N 347 PRO HG2 H N N 348 PRO HG3 H N N 349 PRO HD2 H N N 350 PRO HD3 H N N 351 PRO HXT H N N 352 SER N N N N 353 SER CA C N S 354 SER C C N N 355 SER O O N N 356 SER CB C N N 357 SER OG O N N 358 SER OXT O N N 359 SER H H N N 360 SER H2 H N N 361 SER HA H N N 362 SER HB2 H N N 363 SER HB3 H N N 364 SER HG H N N 365 SER HXT H N N 366 THR N N N N 367 THR CA C N S 368 THR C C N N 369 THR O O N N 370 THR CB C N R 371 THR OG1 O N N 372 THR CG2 C N N 373 THR OXT O N N 374 THR H H N N 375 THR H2 H N N 376 THR HA H N N 377 THR HB H N N 378 THR HG1 H N N 379 THR HG21 H N N 380 THR HG22 H N N 381 THR HG23 H N N 382 THR HXT H N N 383 TRP N N N N 384 TRP CA C N S 385 TRP C C N N 386 TRP O O N N 387 TRP CB C N N 388 TRP CG C Y N 389 TRP CD1 C Y N 390 TRP CD2 C Y N 391 TRP NE1 N Y N 392 TRP CE2 C Y N 393 TRP CE3 C Y N 394 TRP CZ2 C Y N 395 TRP CZ3 C Y N 396 TRP CH2 C Y N 397 TRP OXT O N N 398 TRP H H N N 399 TRP H2 H N N 400 TRP HA H N N 401 TRP HB2 H N N 402 TRP HB3 H N N 403 TRP HD1 H N N 404 TRP HE1 H N N 405 TRP HE3 H N N 406 TRP HZ2 H N N 407 TRP HZ3 H N N 408 TRP HH2 H N N 409 TRP HXT H N N 410 TYR N N N N 411 TYR CA C N S 412 TYR C C N N 413 TYR O O N N 414 TYR CB C N N 415 TYR CG C Y N 416 TYR CD1 C Y N 417 TYR CD2 C Y N 418 TYR CE1 C Y N 419 TYR CE2 C Y N 420 TYR CZ C Y N 421 TYR OH O N N 422 TYR OXT O N N 423 TYR H H N N 424 TYR H2 H N N 425 TYR HA H N N 426 TYR HB2 H N N 427 TYR HB3 H N N 428 TYR HD1 H N N 429 TYR HD2 H N N 430 TYR HE1 H N N 431 TYR HE2 H N N 432 TYR HH H N N 433 TYR HXT H N N 434 VAL N N N N 435 VAL CA C N S 436 VAL C C N N 437 VAL O O N N 438 VAL CB C N N 439 VAL CG1 C N N 440 VAL CG2 C N N 441 VAL OXT O N N 442 VAL H H N N 443 VAL H2 H N N 444 VAL HA H N N 445 VAL HB H N N 446 VAL HG11 H N N 447 VAL HG12 H N N 448 VAL HG13 H N N 449 VAL HG21 H N N 450 VAL HG22 H N N 451 VAL HG23 H N N 452 VAL HXT H N N 453 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 CYS N CA sing N N 84 CYS N H sing N N 85 CYS N H2 sing N N 86 CYS CA C sing N N 87 CYS CA CB sing N N 88 CYS CA HA sing N N 89 CYS C O doub N N 90 CYS C OXT sing N N 91 CYS CB SG sing N N 92 CYS CB HB2 sing N N 93 CYS CB HB3 sing N N 94 CYS SG HG sing N N 95 CYS OXT HXT sing N N 96 GLN N CA sing N N 97 GLN N H sing N N 98 GLN N H2 sing N N 99 GLN CA C sing N N 100 GLN CA CB sing N N 101 GLN CA HA sing N N 102 GLN C O doub N N 103 GLN C OXT sing N N 104 GLN CB CG sing N N 105 GLN CB HB2 sing N N 106 GLN CB HB3 sing N N 107 GLN CG CD sing N N 108 GLN CG HG2 sing N N 109 GLN CG HG3 sing N N 110 GLN CD OE1 doub N N 111 GLN CD NE2 sing N N 112 GLN NE2 HE21 sing N N 113 GLN NE2 HE22 sing N N 114 GLN OXT HXT sing N N 115 GLU N CA sing N N 116 GLU N H sing N N 117 GLU N H2 sing N N 118 GLU CA C sing N N 119 GLU CA CB sing N N 120 GLU CA HA sing N N 121 GLU C O doub N N 122 GLU C OXT sing N N 123 GLU CB CG sing N N 124 GLU CB HB2 sing N N 125 GLU CB HB3 sing N N 126 GLU CG CD sing N N 127 GLU CG HG2 sing N N 128 GLU CG HG3 sing N N 129 GLU CD OE1 doub N N 130 GLU CD OE2 sing N N 131 GLU OE2 HE2 sing N N 132 GLU OXT HXT sing N N 133 GLY N CA sing N N 134 GLY N H sing N N 135 GLY N H2 sing N N 136 GLY CA C sing N N 137 GLY CA HA2 sing N N 138 GLY CA HA3 sing N N 139 GLY C O doub N N 140 GLY C OXT sing N N 141 GLY OXT HXT sing N N 142 HIS N CA sing N N 143 HIS N H sing N N 144 HIS N H2 sing N N 145 HIS CA C sing N N 146 HIS CA CB sing N N 147 HIS CA HA sing N N 148 HIS C O doub N N 149 HIS C OXT sing N N 150 HIS CB CG sing N N 151 HIS CB HB2 sing N N 152 HIS CB HB3 sing N N 153 HIS CG ND1 sing Y N 154 HIS CG CD2 doub Y N 155 HIS ND1 CE1 doub Y N 156 HIS ND1 HD1 sing N N 157 HIS CD2 NE2 sing Y N 158 HIS CD2 HD2 sing N N 159 HIS CE1 NE2 sing Y N 160 HIS CE1 HE1 sing N N 161 HIS NE2 HE2 sing N N 162 HIS OXT HXT sing N N 163 HOH O H1 sing N N 164 HOH O H2 sing N N 165 IHH C1 C2 doub Y N 166 IHH C1 C4 sing Y N 167 IHH C1 H1 sing N N 168 IHH C2 C3 sing Y N 169 IHH C2 H2 sing N N 170 IHH C3 C6 doub Y N 171 IHH C3 H3 sing N N 172 IHH C4 C5 doub Y N 173 IHH C4 H4 sing N N 174 IHH C5 C6 sing Y N 175 IHH C5 C10 sing Y N 176 IHH C6 N7 sing Y N 177 IHH C8 N9 sing Y N 178 IHH C8 N7 doub Y N 179 IHH C8 N11 sing N N 180 IHH C10 N21 sing N N 181 IHH C10 N9 doub Y N 182 IHH C12 C13 doub Y N 183 IHH C12 N11 sing N N 184 IHH C12 C17 sing Y N 185 IHH C13 C14 sing Y N 186 IHH C13 H13 sing N N 187 IHH C14 C15 doub Y N 188 IHH C14 H14 sing N N 189 IHH C15 C16 sing Y N 190 IHH C15 C18 sing N N 191 IHH C28 C29 sing N N 192 IHH C28 C27 sing N N 193 IHH C28 H28 sing N N 194 IHH C28 H28A sing N N 195 IHH C29 C27 sing N N 196 IHH C29 H29 sing N N 197 IHH C29 H29A sing N N 198 IHH C27 C24 sing N N 199 IHH C27 H27 sing N N 200 IHH C24 C23 doub Y N 201 IHH C24 N25 sing Y N 202 IHH C23 C22 sing Y N 203 IHH C23 H23 sing N N 204 IHH N25 N26 sing Y N 205 IHH N26 C22 doub Y N 206 IHH C22 N21 sing N N 207 IHH N11 HN11 sing N N 208 IHH C17 C16 doub Y N 209 IHH C17 H17 sing N N 210 IHH C16 H16 sing N N 211 IHH C18 C19 sing N N 212 IHH C18 H18 sing N N 213 IHH C18 H18A sing N N 214 IHH C19 N20 trip N N 215 IHH N25 H181 sing N N 216 IHH N21 H19 sing N N 217 ILE N CA sing N N 218 ILE N H sing N N 219 ILE N H2 sing N N 220 ILE CA C sing N N 221 ILE CA CB sing N N 222 ILE CA HA sing N N 223 ILE C O doub N N 224 ILE C OXT sing N N 225 ILE CB CG1 sing N N 226 ILE CB CG2 sing N N 227 ILE CB HB sing N N 228 ILE CG1 CD1 sing N N 229 ILE CG1 HG12 sing N N 230 ILE CG1 HG13 sing N N 231 ILE CG2 HG21 sing N N 232 ILE CG2 HG22 sing N N 233 ILE CG2 HG23 sing N N 234 ILE CD1 HD11 sing N N 235 ILE CD1 HD12 sing N N 236 ILE CD1 HD13 sing N N 237 ILE OXT HXT sing N N 238 LEU N CA sing N N 239 LEU N H sing N N 240 LEU N H2 sing N N 241 LEU CA C sing N N 242 LEU CA CB sing N N 243 LEU CA HA sing N N 244 LEU C O doub N N 245 LEU C OXT sing N N 246 LEU CB CG sing N N 247 LEU CB HB2 sing N N 248 LEU CB HB3 sing N N 249 LEU CG CD1 sing N N 250 LEU CG CD2 sing N N 251 LEU CG HG sing N N 252 LEU CD1 HD11 sing N N 253 LEU CD1 HD12 sing N N 254 LEU CD1 HD13 sing N N 255 LEU CD2 HD21 sing N N 256 LEU CD2 HD22 sing N N 257 LEU CD2 HD23 sing N N 258 LEU OXT HXT sing N N 259 LYS N CA sing N N 260 LYS N H sing N N 261 LYS N H2 sing N N 262 LYS CA C sing N N 263 LYS CA CB sing N N 264 LYS CA HA sing N N 265 LYS C O doub N N 266 LYS C OXT sing N N 267 LYS CB CG sing N N 268 LYS CB HB2 sing N N 269 LYS CB HB3 sing N N 270 LYS CG CD sing N N 271 LYS CG HG2 sing N N 272 LYS CG HG3 sing N N 273 LYS CD CE sing N N 274 LYS CD HD2 sing N N 275 LYS CD HD3 sing N N 276 LYS CE NZ sing N N 277 LYS CE HE2 sing N N 278 LYS CE HE3 sing N N 279 LYS NZ HZ1 sing N N 280 LYS NZ HZ2 sing N N 281 LYS NZ HZ3 sing N N 282 LYS OXT HXT sing N N 283 MET N CA sing N N 284 MET N H sing N N 285 MET N H2 sing N N 286 MET CA C sing N N 287 MET CA CB sing N N 288 MET CA HA sing N N 289 MET C O doub N N 290 MET C OXT sing N N 291 MET CB CG sing N N 292 MET CB HB2 sing N N 293 MET CB HB3 sing N N 294 MET CG SD sing N N 295 MET CG HG2 sing N N 296 MET CG HG3 sing N N 297 MET SD CE sing N N 298 MET CE HE1 sing N N 299 MET CE HE2 sing N N 300 MET CE HE3 sing N N 301 MET OXT HXT sing N N 302 PHE N CA sing N N 303 PHE N H sing N N 304 PHE N H2 sing N N 305 PHE CA C sing N N 306 PHE CA CB sing N N 307 PHE CA HA sing N N 308 PHE C O doub N N 309 PHE C OXT sing N N 310 PHE CB CG sing N N 311 PHE CB HB2 sing N N 312 PHE CB HB3 sing N N 313 PHE CG CD1 doub Y N 314 PHE CG CD2 sing Y N 315 PHE CD1 CE1 sing Y N 316 PHE CD1 HD1 sing N N 317 PHE CD2 CE2 doub Y N 318 PHE CD2 HD2 sing N N 319 PHE CE1 CZ doub Y N 320 PHE CE1 HE1 sing N N 321 PHE CE2 CZ sing Y N 322 PHE CE2 HE2 sing N N 323 PHE CZ HZ sing N N 324 PHE OXT HXT sing N N 325 PRO N CA sing N N 326 PRO N CD sing N N 327 PRO N H sing N N 328 PRO CA C sing N N 329 PRO CA CB sing N N 330 PRO CA HA sing N N 331 PRO C O doub N N 332 PRO C OXT sing N N 333 PRO CB CG sing N N 334 PRO CB HB2 sing N N 335 PRO CB HB3 sing N N 336 PRO CG CD sing N N 337 PRO CG HG2 sing N N 338 PRO CG HG3 sing N N 339 PRO CD HD2 sing N N 340 PRO CD HD3 sing N N 341 PRO OXT HXT sing N N 342 SER N CA sing N N 343 SER N H sing N N 344 SER N H2 sing N N 345 SER CA C sing N N 346 SER CA CB sing N N 347 SER CA HA sing N N 348 SER C O doub N N 349 SER C OXT sing N N 350 SER CB OG sing N N 351 SER CB HB2 sing N N 352 SER CB HB3 sing N N 353 SER OG HG sing N N 354 SER OXT HXT sing N N 355 THR N CA sing N N 356 THR N H sing N N 357 THR N H2 sing N N 358 THR CA C sing N N 359 THR CA CB sing N N 360 THR CA HA sing N N 361 THR C O doub N N 362 THR C OXT sing N N 363 THR CB OG1 sing N N 364 THR CB CG2 sing N N 365 THR CB HB sing N N 366 THR OG1 HG1 sing N N 367 THR CG2 HG21 sing N N 368 THR CG2 HG22 sing N N 369 THR CG2 HG23 sing N N 370 THR OXT HXT sing N N 371 TRP N CA sing N N 372 TRP N H sing N N 373 TRP N H2 sing N N 374 TRP CA C sing N N 375 TRP CA CB sing N N 376 TRP CA HA sing N N 377 TRP C O doub N N 378 TRP C OXT sing N N 379 TRP CB CG sing N N 380 TRP CB HB2 sing N N 381 TRP CB HB3 sing N N 382 TRP CG CD1 doub Y N 383 TRP CG CD2 sing Y N 384 TRP CD1 NE1 sing Y N 385 TRP CD1 HD1 sing N N 386 TRP CD2 CE2 doub Y N 387 TRP CD2 CE3 sing Y N 388 TRP NE1 CE2 sing Y N 389 TRP NE1 HE1 sing N N 390 TRP CE2 CZ2 sing Y N 391 TRP CE3 CZ3 doub Y N 392 TRP CE3 HE3 sing N N 393 TRP CZ2 CH2 doub Y N 394 TRP CZ2 HZ2 sing N N 395 TRP CZ3 CH2 sing Y N 396 TRP CZ3 HZ3 sing N N 397 TRP CH2 HH2 sing N N 398 TRP OXT HXT sing N N 399 TYR N CA sing N N 400 TYR N H sing N N 401 TYR N H2 sing N N 402 TYR CA C sing N N 403 TYR CA CB sing N N 404 TYR CA HA sing N N 405 TYR C O doub N N 406 TYR C OXT sing N N 407 TYR CB CG sing N N 408 TYR CB HB2 sing N N 409 TYR CB HB3 sing N N 410 TYR CG CD1 doub Y N 411 TYR CG CD2 sing Y N 412 TYR CD1 CE1 sing Y N 413 TYR CD1 HD1 sing N N 414 TYR CD2 CE2 doub Y N 415 TYR CD2 HD2 sing N N 416 TYR CE1 CZ doub Y N 417 TYR CE1 HE1 sing N N 418 TYR CE2 CZ sing Y N 419 TYR CE2 HE2 sing N N 420 TYR CZ OH sing N N 421 TYR OH HH sing N N 422 TYR OXT HXT sing N N 423 VAL N CA sing N N 424 VAL N H sing N N 425 VAL N H2 sing N N 426 VAL CA C sing N N 427 VAL CA CB sing N N 428 VAL CA HA sing N N 429 VAL C O doub N N 430 VAL C OXT sing N N 431 VAL CB CG1 sing N N 432 VAL CB CG2 sing N N 433 VAL CB HB sing N N 434 VAL CG1 HG11 sing N N 435 VAL CG1 HG12 sing N N 436 VAL CG1 HG13 sing N N 437 VAL CG2 HG21 sing N N 438 VAL CG2 HG22 sing N N 439 VAL CG2 HG23 sing N N 440 VAL OXT HXT sing N N 441 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2DYL _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YG5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016762 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014699 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011806 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_