data_6YJH # _entry.id 6YJH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YJH pdb_00006yjh 10.2210/pdb6yjh/pdb WWPDB D_1292107732 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-14 2 'Structure model' 1 1 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YJH _pdbx_database_status.recvd_initial_deposition_date 2020-04-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Timofeev, V.I.' 1 ? 'Abramchik, Y.A.' 2 ? 'Skvortsov, T.A.' 3 ? 'Azhikina, T.L.' 4 ? 'Muravieva, T.I.' 5 ? 'Kostromina, M.A.' 6 ? 'Esipov, R.S.' 7 ? 'Kuranova, I.P.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Imidazole Glycerol Phosphate Dehydratase from Mycobacterium tuberculosis at 1.61 A resolution' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Timofeev, V.I.' 1 ? primary 'Abramchik, Y.A.' 2 ? primary 'Skvortsov, T.A.' 3 ? primary 'Azhikina, T.L.' 4 ? primary 'Muravieva, T.I.' 5 ? primary 'Kostromina, M.A.' 6 ? primary 'Esipov, R.S.' 7 ? primary 'Kuranova, I.P.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Imidazoleglycerol-phosphate dehydratase' 20970.527 1 ? ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 3 ? ? ? ? 3 water nat water 18.015 99 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQ ALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRV LYGRDPHHITEAQYKAVARALRQAVEPDPRV ; _entity_poly.pdbx_seq_one_letter_code_can ;SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQ ALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRV LYGRDPHHITEAQYKAVARALRQAVEPDPRV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ARG n 1 3 ARG n 1 4 ALA n 1 5 ARG n 1 6 ILE n 1 7 GLU n 1 8 ARG n 1 9 ARG n 1 10 THR n 1 11 ARG n 1 12 GLU n 1 13 SER n 1 14 ASP n 1 15 ILE n 1 16 VAL n 1 17 ILE n 1 18 GLU n 1 19 LEU n 1 20 ASP n 1 21 LEU n 1 22 ASP n 1 23 GLY n 1 24 THR n 1 25 GLY n 1 26 GLN n 1 27 VAL n 1 28 ALA n 1 29 VAL n 1 30 ASP n 1 31 THR n 1 32 GLY n 1 33 VAL n 1 34 PRO n 1 35 PHE n 1 36 TYR n 1 37 ASP n 1 38 HIS n 1 39 MET n 1 40 LEU n 1 41 THR n 1 42 ALA n 1 43 LEU n 1 44 GLY n 1 45 SER n 1 46 HIS n 1 47 ALA n 1 48 SER n 1 49 PHE n 1 50 ASP n 1 51 LEU n 1 52 THR n 1 53 VAL n 1 54 ARG n 1 55 ALA n 1 56 THR n 1 57 GLY n 1 58 ASP n 1 59 VAL n 1 60 GLU n 1 61 ILE n 1 62 GLU n 1 63 ALA n 1 64 HIS n 1 65 HIS n 1 66 THR n 1 67 ILE n 1 68 GLU n 1 69 ASP n 1 70 THR n 1 71 ALA n 1 72 ILE n 1 73 ALA n 1 74 LEU n 1 75 GLY n 1 76 THR n 1 77 ALA n 1 78 LEU n 1 79 GLY n 1 80 GLN n 1 81 ALA n 1 82 LEU n 1 83 GLY n 1 84 ASP n 1 85 LYS n 1 86 ARG n 1 87 GLY n 1 88 ILE n 1 89 ARG n 1 90 ARG n 1 91 PHE n 1 92 GLY n 1 93 ASP n 1 94 ALA n 1 95 PHE n 1 96 ILE n 1 97 PRO n 1 98 MET n 1 99 ASP n 1 100 GLU n 1 101 THR n 1 102 LEU n 1 103 ALA n 1 104 HIS n 1 105 ALA n 1 106 ALA n 1 107 VAL n 1 108 ASP n 1 109 LEU n 1 110 SER n 1 111 GLY n 1 112 ARG n 1 113 PRO n 1 114 TYR n 1 115 CYS n 1 116 VAL n 1 117 HIS n 1 118 THR n 1 119 GLY n 1 120 GLU n 1 121 PRO n 1 122 ASP n 1 123 HIS n 1 124 LEU n 1 125 GLN n 1 126 HIS n 1 127 THR n 1 128 THR n 1 129 ILE n 1 130 ALA n 1 131 GLY n 1 132 SER n 1 133 SER n 1 134 VAL n 1 135 PRO n 1 136 TYR n 1 137 HIS n 1 138 THR n 1 139 VAL n 1 140 ILE n 1 141 ASN n 1 142 ARG n 1 143 HIS n 1 144 VAL n 1 145 PHE n 1 146 GLU n 1 147 SER n 1 148 LEU n 1 149 ALA n 1 150 ALA n 1 151 ASN n 1 152 ALA n 1 153 ARG n 1 154 ILE n 1 155 ALA n 1 156 LEU n 1 157 HIS n 1 158 VAL n 1 159 ARG n 1 160 VAL n 1 161 LEU n 1 162 TYR n 1 163 GLY n 1 164 ARG n 1 165 ASP n 1 166 PRO n 1 167 HIS n 1 168 HIS n 1 169 ILE n 1 170 THR n 1 171 GLU n 1 172 ALA n 1 173 GLN n 1 174 TYR n 1 175 LYS n 1 176 ALA n 1 177 VAL n 1 178 ALA n 1 179 ARG n 1 180 ALA n 1 181 LEU n 1 182 ARG n 1 183 GLN n 1 184 ALA n 1 185 VAL n 1 186 GLU n 1 187 PRO n 1 188 ASP n 1 189 PRO n 1 190 ARG n 1 191 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 191 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 10 10 SER SER A . n A 1 2 ARG 2 11 11 ARG ARG A . n A 1 3 ARG 3 12 12 ARG ARG A . n A 1 4 ALA 4 13 13 ALA ALA A . n A 1 5 ARG 5 14 14 ARG ARG A . n A 1 6 ILE 6 15 15 ILE ILE A . n A 1 7 GLU 7 16 16 GLU GLU A . n A 1 8 ARG 8 17 17 ARG ARG A . n A 1 9 ARG 9 18 18 ARG ARG A . n A 1 10 THR 10 19 19 THR THR A . n A 1 11 ARG 11 20 20 ARG ARG A . n A 1 12 GLU 12 21 21 GLU GLU A . n A 1 13 SER 13 22 22 SER SER A . n A 1 14 ASP 14 23 23 ASP ASP A . n A 1 15 ILE 15 24 24 ILE ILE A . n A 1 16 VAL 16 25 25 VAL VAL A . n A 1 17 ILE 17 26 26 ILE ILE A . n A 1 18 GLU 18 27 27 GLU GLU A . n A 1 19 LEU 19 28 28 LEU LEU A . n A 1 20 ASP 20 29 29 ASP ASP A . n A 1 21 LEU 21 30 30 LEU LEU A . n A 1 22 ASP 22 31 31 ASP ASP A . n A 1 23 GLY 23 32 32 GLY GLY A . n A 1 24 THR 24 33 33 THR THR A . n A 1 25 GLY 25 34 34 GLY GLY A . n A 1 26 GLN 26 35 35 GLN GLN A . n A 1 27 VAL 27 36 36 VAL VAL A . n A 1 28 ALA 28 37 37 ALA ALA A . n A 1 29 VAL 29 38 38 VAL VAL A . n A 1 30 ASP 30 39 39 ASP ASP A . n A 1 31 THR 31 40 40 THR THR A . n A 1 32 GLY 32 41 41 GLY GLY A . n A 1 33 VAL 33 42 42 VAL VAL A . n A 1 34 PRO 34 43 43 PRO PRO A . n A 1 35 PHE 35 44 44 PHE PHE A . n A 1 36 TYR 36 45 45 TYR TYR A . n A 1 37 ASP 37 46 46 ASP ASP A . n A 1 38 HIS 38 47 47 HIS HIS A . n A 1 39 MET 39 48 48 MET MET A . n A 1 40 LEU 40 49 49 LEU LEU A . n A 1 41 THR 41 50 50 THR THR A . n A 1 42 ALA 42 51 51 ALA ALA A . n A 1 43 LEU 43 52 52 LEU LEU A . n A 1 44 GLY 44 53 53 GLY GLY A . n A 1 45 SER 45 54 54 SER SER A . n A 1 46 HIS 46 55 55 HIS HIS A . n A 1 47 ALA 47 56 56 ALA ALA A . n A 1 48 SER 48 57 57 SER SER A . n A 1 49 PHE 49 58 58 PHE PHE A . n A 1 50 ASP 50 59 59 ASP ASP A . n A 1 51 LEU 51 60 60 LEU LEU A . n A 1 52 THR 52 61 61 THR THR A . n A 1 53 VAL 53 62 62 VAL VAL A . n A 1 54 ARG 54 63 63 ARG ARG A . n A 1 55 ALA 55 64 64 ALA ALA A . n A 1 56 THR 56 65 65 THR THR A . n A 1 57 GLY 57 66 66 GLY GLY A . n A 1 58 ASP 58 67 67 ASP ASP A . n A 1 59 VAL 59 68 68 VAL VAL A . n A 1 60 GLU 60 69 69 GLU GLU A . n A 1 61 ILE 61 70 70 ILE ILE A . n A 1 62 GLU 62 71 71 GLU GLU A . n A 1 63 ALA 63 72 72 ALA ALA A . n A 1 64 HIS 64 73 73 HIS HIS A . n A 1 65 HIS 65 74 74 HIS HIS A . n A 1 66 THR 66 75 75 THR THR A . n A 1 67 ILE 67 76 76 ILE ILE A . n A 1 68 GLU 68 77 77 GLU GLU A . n A 1 69 ASP 69 78 78 ASP ASP A . n A 1 70 THR 70 79 79 THR THR A . n A 1 71 ALA 71 80 80 ALA ALA A . n A 1 72 ILE 72 81 81 ILE ILE A . n A 1 73 ALA 73 82 82 ALA ALA A . n A 1 74 LEU 74 83 83 LEU LEU A . n A 1 75 GLY 75 84 84 GLY GLY A . n A 1 76 THR 76 85 85 THR THR A . n A 1 77 ALA 77 86 86 ALA ALA A . n A 1 78 LEU 78 87 87 LEU LEU A . n A 1 79 GLY 79 88 88 GLY GLY A . n A 1 80 GLN 80 89 89 GLN GLN A . n A 1 81 ALA 81 90 90 ALA ALA A . n A 1 82 LEU 82 91 91 LEU LEU A . n A 1 83 GLY 83 92 92 GLY GLY A . n A 1 84 ASP 84 93 93 ASP ASP A . n A 1 85 LYS 85 94 94 LYS LYS A . n A 1 86 ARG 86 95 95 ARG ARG A . n A 1 87 GLY 87 96 96 GLY GLY A . n A 1 88 ILE 88 97 97 ILE ILE A . n A 1 89 ARG 89 98 98 ARG ARG A . n A 1 90 ARG 90 99 99 ARG ARG A . n A 1 91 PHE 91 100 100 PHE PHE A . n A 1 92 GLY 92 101 101 GLY GLY A . n A 1 93 ASP 93 102 102 ASP ASP A . n A 1 94 ALA 94 103 103 ALA ALA A . n A 1 95 PHE 95 104 104 PHE PHE A . n A 1 96 ILE 96 105 105 ILE ILE A . n A 1 97 PRO 97 106 106 PRO PRO A . n A 1 98 MET 98 107 107 MET MET A . n A 1 99 ASP 99 108 108 ASP ASP A . n A 1 100 GLU 100 109 109 GLU GLU A . n A 1 101 THR 101 110 110 THR THR A . n A 1 102 LEU 102 111 111 LEU LEU A . n A 1 103 ALA 103 112 112 ALA ALA A . n A 1 104 HIS 104 113 113 HIS HIS A . n A 1 105 ALA 105 114 114 ALA ALA A . n A 1 106 ALA 106 115 115 ALA ALA A . n A 1 107 VAL 107 116 116 VAL VAL A . n A 1 108 ASP 108 117 117 ASP ASP A . n A 1 109 LEU 109 118 118 LEU LEU A . n A 1 110 SER 110 119 119 SER SER A . n A 1 111 GLY 111 120 120 GLY GLY A . n A 1 112 ARG 112 121 121 ARG ARG A . n A 1 113 PRO 113 122 122 PRO PRO A . n A 1 114 TYR 114 123 123 TYR TYR A . n A 1 115 CYS 115 124 124 CYS CYS A . n A 1 116 VAL 116 125 125 VAL VAL A . n A 1 117 HIS 117 126 126 HIS HIS A . n A 1 118 THR 118 127 127 THR THR A . n A 1 119 GLY 119 128 128 GLY GLY A . n A 1 120 GLU 120 129 129 GLU GLU A . n A 1 121 PRO 121 130 130 PRO PRO A . n A 1 122 ASP 122 131 131 ASP ASP A . n A 1 123 HIS 123 132 132 HIS HIS A . n A 1 124 LEU 124 133 133 LEU LEU A . n A 1 125 GLN 125 134 134 GLN GLN A . n A 1 126 HIS 126 135 135 HIS HIS A . n A 1 127 THR 127 136 136 THR THR A . n A 1 128 THR 128 137 137 THR THR A . n A 1 129 ILE 129 138 138 ILE ILE A . n A 1 130 ALA 130 139 139 ALA ALA A . n A 1 131 GLY 131 140 140 GLY GLY A . n A 1 132 SER 132 141 141 SER SER A . n A 1 133 SER 133 142 142 SER SER A . n A 1 134 VAL 134 143 143 VAL VAL A . n A 1 135 PRO 135 144 144 PRO PRO A . n A 1 136 TYR 136 145 145 TYR TYR A . n A 1 137 HIS 137 146 146 HIS HIS A . n A 1 138 THR 138 147 147 THR THR A . n A 1 139 VAL 139 148 148 VAL VAL A . n A 1 140 ILE 140 149 149 ILE ILE A . n A 1 141 ASN 141 150 150 ASN ASN A . n A 1 142 ARG 142 151 151 ARG ARG A . n A 1 143 HIS 143 152 152 HIS HIS A . n A 1 144 VAL 144 153 153 VAL VAL A . n A 1 145 PHE 145 154 154 PHE PHE A . n A 1 146 GLU 146 155 155 GLU GLU A . n A 1 147 SER 147 156 156 SER SER A . n A 1 148 LEU 148 157 157 LEU LEU A . n A 1 149 ALA 149 158 158 ALA ALA A . n A 1 150 ALA 150 159 159 ALA ALA A . n A 1 151 ASN 151 160 160 ASN ASN A . n A 1 152 ALA 152 161 161 ALA ALA A . n A 1 153 ARG 153 162 162 ARG ARG A . n A 1 154 ILE 154 163 163 ILE ILE A . n A 1 155 ALA 155 164 164 ALA ALA A . n A 1 156 LEU 156 165 165 LEU LEU A . n A 1 157 HIS 157 166 166 HIS HIS A . n A 1 158 VAL 158 167 167 VAL VAL A . n A 1 159 ARG 159 168 168 ARG ARG A . n A 1 160 VAL 160 169 169 VAL VAL A . n A 1 161 LEU 161 170 170 LEU LEU A . n A 1 162 TYR 162 171 171 TYR TYR A . n A 1 163 GLY 163 172 172 GLY GLY A . n A 1 164 ARG 164 173 173 ARG ARG A . n A 1 165 ASP 165 174 174 ASP ASP A . n A 1 166 PRO 166 175 175 PRO PRO A . n A 1 167 HIS 167 176 176 HIS HIS A . n A 1 168 HIS 168 177 177 HIS HIS A . n A 1 169 ILE 169 178 178 ILE ILE A . n A 1 170 THR 170 179 179 THR THR A . n A 1 171 GLU 171 180 180 GLU GLU A . n A 1 172 ALA 172 181 181 ALA ALA A . n A 1 173 GLN 173 182 182 GLN GLN A . n A 1 174 TYR 174 183 183 TYR TYR A . n A 1 175 LYS 175 184 184 LYS LYS A . n A 1 176 ALA 176 185 185 ALA ALA A . n A 1 177 VAL 177 186 186 VAL VAL A . n A 1 178 ALA 178 187 187 ALA ALA A . n A 1 179 ARG 179 188 188 ARG ARG A . n A 1 180 ALA 180 189 189 ALA ALA A . n A 1 181 LEU 181 190 190 LEU LEU A . n A 1 182 ARG 182 191 191 ARG ARG A . n A 1 183 GLN 183 192 192 GLN GLN A . n A 1 184 ALA 184 193 193 ALA ALA A . n A 1 185 VAL 185 194 194 VAL VAL A . n A 1 186 GLU 186 195 195 GLU GLU A . n A 1 187 PRO 187 196 196 PRO PRO A . n A 1 188 ASP 188 197 197 ASP ASP A . n A 1 189 PRO 189 198 198 PRO PRO A . n A 1 190 ARG 190 199 199 ARG ARG A . n A 1 191 VAL 191 200 200 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 301 MN MN A . C 2 MN 1 302 302 MN MN A . D 2 MN 1 303 303 MN MN A . E 3 HOH 1 401 98 HOH HOH A . E 3 HOH 2 402 91 HOH HOH A . E 3 HOH 3 403 86 HOH HOH A . E 3 HOH 4 404 53 HOH HOH A . E 3 HOH 5 405 67 HOH HOH A . E 3 HOH 6 406 83 HOH HOH A . E 3 HOH 7 407 78 HOH HOH A . E 3 HOH 8 408 77 HOH HOH A . E 3 HOH 9 409 44 HOH HOH A . E 3 HOH 10 410 76 HOH HOH A . E 3 HOH 11 411 49 HOH HOH A . E 3 HOH 12 412 92 HOH HOH A . E 3 HOH 13 413 62 HOH HOH A . E 3 HOH 14 414 74 HOH HOH A . E 3 HOH 15 415 55 HOH HOH A . E 3 HOH 16 416 54 HOH HOH A . E 3 HOH 17 417 89 HOH HOH A . E 3 HOH 18 418 14 HOH HOH A . E 3 HOH 19 419 32 HOH HOH A . E 3 HOH 20 420 71 HOH HOH A . E 3 HOH 21 421 58 HOH HOH A . E 3 HOH 22 422 87 HOH HOH A . E 3 HOH 23 423 19 HOH HOH A . E 3 HOH 24 424 85 HOH HOH A . E 3 HOH 25 425 37 HOH HOH A . E 3 HOH 26 426 17 HOH HOH A . E 3 HOH 27 427 29 HOH HOH A . E 3 HOH 28 428 28 HOH HOH A . E 3 HOH 29 429 3 HOH HOH A . E 3 HOH 30 430 40 HOH HOH A . E 3 HOH 31 431 1 HOH HOH A . E 3 HOH 32 432 75 HOH HOH A . E 3 HOH 33 433 9 HOH HOH A . E 3 HOH 34 434 50 HOH HOH A . E 3 HOH 35 435 66 HOH HOH A . E 3 HOH 36 436 34 HOH HOH A . E 3 HOH 37 437 27 HOH HOH A . E 3 HOH 38 438 8 HOH HOH A . E 3 HOH 39 439 6 HOH HOH A . E 3 HOH 40 440 23 HOH HOH A . E 3 HOH 41 441 73 HOH HOH A . E 3 HOH 42 442 15 HOH HOH A . E 3 HOH 43 443 24 HOH HOH A . E 3 HOH 44 444 69 HOH HOH A . E 3 HOH 45 445 21 HOH HOH A . E 3 HOH 46 446 7 HOH HOH A . E 3 HOH 47 447 20 HOH HOH A . E 3 HOH 48 448 36 HOH HOH A . E 3 HOH 49 449 10 HOH HOH A . E 3 HOH 50 450 38 HOH HOH A . E 3 HOH 51 451 56 HOH HOH A . E 3 HOH 52 452 16 HOH HOH A . E 3 HOH 53 453 41 HOH HOH A . E 3 HOH 54 454 63 HOH HOH A . E 3 HOH 55 455 5 HOH HOH A . E 3 HOH 56 456 45 HOH HOH A . E 3 HOH 57 457 39 HOH HOH A . E 3 HOH 58 458 81 HOH HOH A . E 3 HOH 59 459 11 HOH HOH A . E 3 HOH 60 460 47 HOH HOH A . E 3 HOH 61 461 94 HOH HOH A . E 3 HOH 62 462 64 HOH HOH A . E 3 HOH 63 463 33 HOH HOH A . E 3 HOH 64 464 57 HOH HOH A . E 3 HOH 65 465 25 HOH HOH A . E 3 HOH 66 466 13 HOH HOH A . E 3 HOH 67 467 65 HOH HOH A . E 3 HOH 68 468 52 HOH HOH A . E 3 HOH 69 469 18 HOH HOH A . E 3 HOH 70 470 61 HOH HOH A . E 3 HOH 71 471 26 HOH HOH A . E 3 HOH 72 472 22 HOH HOH A . E 3 HOH 73 473 70 HOH HOH A . E 3 HOH 74 474 35 HOH HOH A . E 3 HOH 75 475 43 HOH HOH A . E 3 HOH 76 476 42 HOH HOH A . E 3 HOH 77 477 95 HOH HOH A . E 3 HOH 78 478 31 HOH HOH A . E 3 HOH 79 479 93 HOH HOH A . E 3 HOH 80 480 2 HOH HOH A . E 3 HOH 81 481 68 HOH HOH A . E 3 HOH 82 482 46 HOH HOH A . E 3 HOH 83 483 30 HOH HOH A . E 3 HOH 84 484 4 HOH HOH A . E 3 HOH 85 485 82 HOH HOH A . E 3 HOH 86 486 48 HOH HOH A . E 3 HOH 87 487 97 HOH HOH A . E 3 HOH 88 488 79 HOH HOH A . E 3 HOH 89 489 59 HOH HOH A . E 3 HOH 90 490 60 HOH HOH A . E 3 HOH 91 491 99 HOH HOH A . E 3 HOH 92 492 12 HOH HOH A . E 3 HOH 93 493 90 HOH HOH A . E 3 HOH 94 494 84 HOH HOH A . E 3 HOH 95 495 72 HOH HOH A . E 3 HOH 96 496 80 HOH HOH A . E 3 HOH 97 497 88 HOH HOH A . E 3 HOH 98 498 96 HOH HOH A . E 3 HOH 99 499 51 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6YJH _cell.details ? _cell.formula_units_Z ? _cell.length_a 112.130 _cell.length_a_esd ? _cell.length_b 112.130 _cell.length_b_esd ? _cell.length_c 112.130 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YJH _symmetry.cell_setting ? _symmetry.Int_Tables_number 207 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YJH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.80 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method COUNTER-DIFFUSION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG1500, 0.2 M sodium citrate tribasic dehydrate, 0.1 M Tris pH 7.5, 5 mM MnCl2, 0.04% NaN3' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6YJH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.61 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31512 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.09 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 27.56 _reflns.pdbx_Rmerge_I_obs 0.099 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.9569 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.100 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.61 _reflns_shell.d_res_low 1.70 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4235 _reflns_shell.percent_possible_all 93.86 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.38 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.44 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.428 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 83.080 _refine.B_iso_mean 16.0330 _refine.B_iso_min 5.570 _refine.correlation_coeff_Fo_to_Fc 0.9700 _refine.correlation_coeff_Fo_to_Fc_free 0.9610 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YJH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6100 _refine.ls_d_res_low 29.9700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 29932 _refine.ls_number_reflns_R_free 1574 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.9600 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1524 _refine.ls_R_factor_R_free 0.1748 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1512 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4GQU _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0650 _refine.pdbx_overall_ESU_R_Free 0.0670 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.1370 _refine.overall_SU_ML 0.0400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.6100 _refine_hist.d_res_low 29.9700 _refine_hist.number_atoms_solvent 99 _refine_hist.number_atoms_total 1578 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 191 _refine_hist.pdbx_B_iso_mean_ligand 11.77 _refine_hist.pdbx_B_iso_mean_solvent 23.18 _refine_hist.pdbx_number_atoms_protein 1476 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.013 1546 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1432 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.795 1.644 2110 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.588 1.576 3291 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.963 5.000 200 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.356 19.468 94 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.650 15.000 242 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.695 15.000 19 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.089 0.200 209 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.020 1800 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 357 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.6100 _refine_ls_shell.d_res_low 1.6520 _refine_ls_shell.number_reflns_all 2022 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 99 _refine_ls_shell.number_reflns_R_work 1923 _refine_ls_shell.percent_reflns_obs 87.1600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2630 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2310 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YJH _struct.title 'Crystal structure of Imidazole Glycerol Phosphate Dehydratase from Mycobacterium tuberculosis at 1.61 A resolution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YJH _struct_keywords.text LYASE _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6YJH _struct_ref.pdbx_db_accession 6YJH _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YJH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 191 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6YJH _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 200 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 23-meric _pdbx_struct_assembly.oligomeric_count 23 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E 1 2 A,B,C,D,E 1 3 A,B,C,D,E 1 4 A,B,C,D,E 1 5 A,B,C,D,E 1 6 A,B,C,D,E 1 7 A,B,C,D,E 1 8 A,B,C,D,E 1 9 A,B,C,D,E 1 10 A,B,C,D,E 1 11 A,B,C,D,E 1 12 A,B,C,D,E 1 13 A,B,C,D,E 1 14 A,B,C,D,E 1 15 A,B,C,D,E 1 16 A,B,C,D,E 1 17 A,B,C,D,E 1 18 A,B,C,D,E 1 19 A,B,C,D,E 1 20 A,B,C,D,E 1 21 A,B,C,D,E 1 22 A,B,C,D,E 1 23 A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 33 ? ALA A 47 ? VAL A 42 ALA A 56 1 ? 15 HELX_P HELX_P2 AA2 ALA A 63 ? GLY A 83 ? ALA A 72 GLY A 92 1 ? 21 HELX_P HELX_P3 AA3 PRO A 121 ? HIS A 126 ? PRO A 130 HIS A 135 5 ? 6 HELX_P HELX_P4 AA4 VAL A 139 ? ARG A 153 ? VAL A 148 ARG A 162 1 ? 15 HELX_P HELX_P5 AA5 ASP A 165 ? GLU A 186 ? ASP A 174 GLU A 195 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 38 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 47 A MN 302 1_555 ? ? ? ? ? ? ? 2.219 ? ? metalc2 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 73 A MN 301 1_555 ? ? ? ? ? ? ? 2.186 ? ? metalc3 metalc ? ? A HIS 65 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 74 A MN 302 16_555 ? ? ? ? ? ? ? 2.232 ? ? metalc4 metalc ? ? A GLU 68 OE1 ? ? ? 1_555 B MN . MN ? ? A GLU 77 A MN 301 1_555 ? ? ? ? ? ? ? 2.222 ? ? metalc5 metalc ? ? A HIS 143 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 152 A MN 301 1_555 ? ? ? ? ? ? ? 2.190 ? ? metalc6 metalc ? ? A HIS 167 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 176 A MN 302 1_555 ? ? ? ? ? ? ? 2.195 ? ? metalc7 metalc ? ? A HIS 168 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 177 A MN 301 15_555 ? ? ? ? ? ? ? 2.219 ? ? metalc8 metalc ? ? A GLU 171 OE1 ? ? ? 1_555 C MN . MN ? ? A GLU 180 A MN 302 1_555 ? ? ? ? ? ? ? 2.167 ? ? metalc9 metalc ? ? B MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 301 A HOH 431 1_555 ? ? ? ? ? ? ? 2.188 ? ? metalc10 metalc ? ? B MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 301 A HOH 480 1_555 ? ? ? ? ? ? ? 2.216 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 302 A HOH 429 1_555 ? ? ? ? ? ? ? 2.245 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 302 A HOH 484 1_555 ? ? ? ? ? ? ? 2.377 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 38 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 NE2 ? A HIS 65 ? A HIS 74 ? 1_555 50.9 ? 2 NE2 ? A HIS 38 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 NE2 ? A HIS 167 ? A HIS 176 ? 1_555 102.6 ? 3 NE2 ? A HIS 65 ? A HIS 74 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 NE2 ? A HIS 167 ? A HIS 176 ? 1_555 54.1 ? 4 NE2 ? A HIS 38 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 171 ? A GLU 180 ? 1_555 91.1 ? 5 NE2 ? A HIS 65 ? A HIS 74 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 171 ? A GLU 180 ? 1_555 75.1 ? 6 NE2 ? A HIS 167 ? A HIS 176 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 171 ? A GLU 180 ? 1_555 86.8 ? 7 NE2 ? A HIS 38 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 429 ? 1_555 87.6 ? 8 NE2 ? A HIS 65 ? A HIS 74 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 429 ? 1_555 134.0 ? 9 NE2 ? A HIS 167 ? A HIS 176 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 429 ? 1_555 169.1 ? 10 OE1 ? A GLU 171 ? A GLU 180 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 429 ? 1_555 88.9 ? 11 NE2 ? A HIS 38 ? A HIS 47 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 484 ? 1_555 169.8 ? 12 NE2 ? A HIS 65 ? A HIS 74 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 484 ? 1_555 139.1 ? 13 NE2 ? A HIS 167 ? A HIS 176 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 484 ? 1_555 87.6 ? 14 OE1 ? A GLU 171 ? A GLU 180 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 484 ? 1_555 90.7 ? 15 O ? E HOH . ? A HOH 429 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 484 ? 1_555 82.5 ? 16 NE2 ? A HIS 64 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE1 ? A GLU 68 ? A GLU 77 ? 1_555 94.1 ? 17 NE2 ? A HIS 64 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 143 ? A HIS 152 ? 1_555 94.4 ? 18 OE1 ? A GLU 68 ? A GLU 77 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 143 ? A HIS 152 ? 1_555 85.9 ? 19 NE2 ? A HIS 64 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 168 ? A HIS 177 ? 1_555 48.8 ? 20 OE1 ? A GLU 68 ? A GLU 77 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 168 ? A HIS 177 ? 1_555 90.9 ? 21 NE2 ? A HIS 143 ? A HIS 152 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 NE2 ? A HIS 168 ? A HIS 177 ? 1_555 45.6 ? 22 NE2 ? A HIS 64 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 431 ? 1_555 175.0 ? 23 OE1 ? A GLU 68 ? A GLU 77 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 431 ? 1_555 83.4 ? 24 NE2 ? A HIS 143 ? A HIS 152 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 431 ? 1_555 89.7 ? 25 NE2 ? A HIS 168 ? A HIS 177 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 431 ? 1_555 135.3 ? 26 NE2 ? A HIS 64 ? A HIS 73 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 480 ? 1_555 87.0 ? 27 OE1 ? A GLU 68 ? A GLU 77 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 480 ? 1_555 88.3 ? 28 NE2 ? A HIS 143 ? A HIS 152 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 480 ? 1_555 174.1 ? 29 NE2 ? A HIS 168 ? A HIS 177 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 480 ? 1_555 135.6 ? 30 O ? E HOH . ? A HOH 431 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? E HOH . ? A HOH 480 ? 1_555 88.6 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 3 ? ARG A 9 ? ARG A 12 ARG A 18 AA1 2 SER A 13 ? ASP A 20 ? SER A 22 ASP A 29 AA1 3 ASP A 50 ? GLY A 57 ? ASP A 59 GLY A 66 AA1 4 VAL A 27 ? ASP A 30 ? VAL A 36 ASP A 39 AA2 1 PHE A 91 ? MET A 98 ? PHE A 100 MET A 107 AA2 2 THR A 101 ? ASP A 108 ? THR A 110 ASP A 117 AA2 3 ALA A 155 ? TYR A 162 ? ALA A 164 TYR A 171 AA2 4 TYR A 114 ? THR A 118 ? TYR A 123 THR A 127 AA3 1 THR A 128 ? ILE A 129 ? THR A 137 ILE A 138 AA3 2 TYR A 136 ? HIS A 137 ? TYR A 145 HIS A 146 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 6 ? N ILE A 15 O ILE A 17 ? O ILE A 26 AA1 2 3 N GLU A 18 ? N GLU A 27 O THR A 52 ? O THR A 61 AA1 3 4 O ALA A 55 ? O ALA A 64 N ASP A 30 ? N ASP A 39 AA2 1 2 N MET A 98 ? N MET A 107 O THR A 101 ? O THR A 110 AA2 2 3 N HIS A 104 ? N HIS A 113 O ARG A 159 ? O ARG A 168 AA2 3 4 O LEU A 156 ? O LEU A 165 N TYR A 114 ? N TYR A 123 AA3 1 2 N ILE A 129 ? N ILE A 138 O TYR A 136 ? O TYR A 145 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 301 ? 6 'binding site for residue MN A 301' AC2 Software A MN 302 ? 6 'binding site for residue MN A 302' AC3 Software A MN 303 ? 3 'binding site for residue MN A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 64 ? HIS A 73 . ? 1_555 ? 2 AC1 6 GLU A 68 ? GLU A 77 . ? 1_555 ? 3 AC1 6 HIS A 143 ? HIS A 152 . ? 1_555 ? 4 AC1 6 HIS A 168 ? HIS A 177 . ? 16_555 ? 5 AC1 6 HOH E . ? HOH A 431 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 480 . ? 1_555 ? 7 AC2 6 HIS A 38 ? HIS A 47 . ? 1_555 ? 8 AC2 6 HIS A 65 ? HIS A 74 . ? 15_555 ? 9 AC2 6 HIS A 167 ? HIS A 176 . ? 1_555 ? 10 AC2 6 GLU A 171 ? GLU A 180 . ? 1_555 ? 11 AC2 6 HOH E . ? HOH A 429 . ? 1_555 ? 12 AC2 6 HOH E . ? HOH A 484 . ? 1_555 ? 13 AC3 3 ARG A 159 ? ARG A 168 . ? 1_555 ? 14 AC3 3 ARG A 159 ? ARG A 168 . ? 7_555 ? 15 AC3 3 ARG A 159 ? ARG A 168 . ? 10_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH1 A ARG 98 ? B O A HOH 401 ? ? 1.12 2 1 CZ A ARG 98 ? B O A HOH 401 ? ? 1.82 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 102 ? ? CG A ASP 102 ? ? OD1 A ASP 102 ? ? 112.52 118.30 -5.78 0.90 N 2 1 NE A ARG 191 ? ? CZ A ARG 191 ? ? NH1 A ARG 191 ? ? 116.92 120.30 -3.38 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 31 ? ? -101.13 52.60 2 1 GLU A 71 ? ? 170.44 179.85 3 1 ARG A 99 ? ? 79.62 -51.33 4 1 ARG A 99 ? ? 79.89 -51.33 5 1 ASP A 108 ? ? 54.40 -122.65 6 1 HIS A 135 ? ? -143.70 23.79 7 1 SER A 142 ? ? -124.65 -147.62 8 1 ARG A 173 ? ? -132.51 -49.03 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MN 303 ? D MN . 2 1 A HOH 462 ? E HOH . # _phasing.method MR # _pdbx_entry_details.entry_id 6YJH _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MN MN MN N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4GQU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YJH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008918 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008918 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008918 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MN N O S # loop_