data_6YQQ # _entry.id 6YQQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YQQ pdb_00006yqq 10.2210/pdb6yqq/pdb WWPDB D_1292107198 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-05-20 2 'Structure model' 1 1 2020-07-29 3 'Structure model' 1 2 2020-12-02 4 'Structure model' 1 3 2021-06-30 5 'Structure model' 1 4 2024-05-01 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' 8 4 'Structure model' 'Source and taxonomy' 9 4 'Structure model' 'Structure summary' 10 5 'Structure model' 'Data collection' 11 5 'Structure model' 'Database references' 12 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' entity 3 2 'Structure model' pdbx_chem_comp_identifier 4 2 'Structure model' pdbx_entity_nonpoly 5 2 'Structure model' struct_site 6 2 'Structure model' struct_site_gen 7 3 'Structure model' chem_comp 8 3 'Structure model' citation 9 3 'Structure model' citation_author 10 4 'Structure model' entity 11 4 'Structure model' entity_name_com 12 4 'Structure model' entity_src_gen 13 4 'Structure model' entity_src_nat 14 4 'Structure model' pdbx_refine_tls 15 4 'Structure model' pdbx_refine_tls_group 16 4 'Structure model' struct_ref 17 4 'Structure model' struct_ref_seq 18 5 'Structure model' chem_comp_atom 19 5 'Structure model' chem_comp_bond 20 5 'Structure model' database_2 21 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.mon_nstd_flag' 2 2 'Structure model' '_chem_comp.name' 3 2 'Structure model' '_chem_comp.type' 4 2 'Structure model' '_entity.pdbx_description' 5 2 'Structure model' '_pdbx_entity_nonpoly.name' 6 3 'Structure model' '_chem_comp.pdbx_synonyms' 7 3 'Structure model' '_citation.country' 8 3 'Structure model' '_citation.journal_abbrev' 9 3 'Structure model' '_citation.journal_id_CSD' 10 3 'Structure model' '_citation.journal_id_ISSN' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation.pdbx_database_id_DOI' 15 3 'Structure model' '_citation.pdbx_database_id_PubMed' 16 3 'Structure model' '_citation.title' 17 3 'Structure model' '_citation.year' 18 4 'Structure model' '_entity.src_method' 19 4 'Structure model' '_struct_ref.db_code' 20 4 'Structure model' '_struct_ref.db_name' 21 4 'Structure model' '_struct_ref.pdbx_db_accession' 22 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 23 4 'Structure model' '_struct_ref_seq.pdbx_db_accession' 24 5 'Structure model' '_database_2.pdbx_DOI' 25 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YQQ _pdbx_database_status.recvd_initial_deposition_date 2020-04-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Naismith, J.H.' 1 0000-0001-6744-5061 'Gao, S.' 2 0000-0002-6124-6018 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem.Commun.(Camb.)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1364-548X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 56 _citation.language ? _citation.page_first 7617 _citation.page_last 7620 _citation.title ;Uncovering the chemistry of C-C bond formation in C-nucleoside biosynthesis: crystal structure of a C-glycoside synthase/PRPP complex. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d0cc02834g _citation.pdbx_database_id_PubMed 32515440 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gao, S.' 1 ? primary 'Radadiya, A.' 2 ? primary 'Li, W.' 3 ? primary 'Liu, H.' 4 ? primary 'Zhu, W.' 5 ? primary 'de Crecy-Lagard, V.' 6 ? primary 'Richards, N.G.J.' 7 ? primary 'Naismith, J.H.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ForT-PRPP complex' 36627.324 1 ? ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose 390.070 1 ? ? ? ? 5 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;ForT-PRPP complex,Beta-ribofuranosylaminobenzene 5'-phosphate synthase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MALDRPDRSGAVRVSAPARLSFTLISLDGSSLRRNGIAAMAVDRPGLTAEVREAADGIVAVTGTAEETARELAAALEALR KLWDGPAARVDVLEALPQHSGFGSKTSTLLAVGHAYGRLCGVEPDLRELARTLGRGRTSGASTGLSAYGGFLVDGGHVNP PDFAEAPQKYLRPSRFAQQVAPPKPVVRLDFPDWPVLVLLTHGRHLGGQEELEWFHSVAPIPAEESWRTSHLVFMGLAPA VLEQDFDAFCAAVNEITFTGHFKQAQIAFQGDAVADVLEAGRAAPSVDAIALSVTGPACFAFTKRPEDAERWAWELKNRG LIRDFWFTRANNQGLATTVVS ; _entity_poly.pdbx_seq_one_letter_code_can ;MALDRPDRSGAVRVSAPARLSFTLISLDGSSLRRNGIAAMAVDRPGLTAEVREAADGIVAVTGTAEETARELAAALEALR KLWDGPAARVDVLEALPQHSGFGSKTSTLLAVGHAYGRLCGVEPDLRELARTLGRGRTSGASTGLSAYGGFLVDGGHVNP PDFAEAPQKYLRPSRFAQQVAPPKPVVRLDFPDWPVLVLLTHGRHLGGQEELEWFHSVAPIPAEESWRTSHLVFMGLAPA VLEQDFDAFCAAVNEITFTGHFKQAQIAFQGDAVADVLEAGRAAPSVDAIALSVTGPACFAFTKRPEDAERWAWELKNRG LIRDFWFTRANNQGLATTVVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 'CHLORIDE ION' CL 4 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose PRP 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LEU n 1 4 ASP n 1 5 ARG n 1 6 PRO n 1 7 ASP n 1 8 ARG n 1 9 SER n 1 10 GLY n 1 11 ALA n 1 12 VAL n 1 13 ARG n 1 14 VAL n 1 15 SER n 1 16 ALA n 1 17 PRO n 1 18 ALA n 1 19 ARG n 1 20 LEU n 1 21 SER n 1 22 PHE n 1 23 THR n 1 24 LEU n 1 25 ILE n 1 26 SER n 1 27 LEU n 1 28 ASP n 1 29 GLY n 1 30 SER n 1 31 SER n 1 32 LEU n 1 33 ARG n 1 34 ARG n 1 35 ASN n 1 36 GLY n 1 37 ILE n 1 38 ALA n 1 39 ALA n 1 40 MET n 1 41 ALA n 1 42 VAL n 1 43 ASP n 1 44 ARG n 1 45 PRO n 1 46 GLY n 1 47 LEU n 1 48 THR n 1 49 ALA n 1 50 GLU n 1 51 VAL n 1 52 ARG n 1 53 GLU n 1 54 ALA n 1 55 ALA n 1 56 ASP n 1 57 GLY n 1 58 ILE n 1 59 VAL n 1 60 ALA n 1 61 VAL n 1 62 THR n 1 63 GLY n 1 64 THR n 1 65 ALA n 1 66 GLU n 1 67 GLU n 1 68 THR n 1 69 ALA n 1 70 ARG n 1 71 GLU n 1 72 LEU n 1 73 ALA n 1 74 ALA n 1 75 ALA n 1 76 LEU n 1 77 GLU n 1 78 ALA n 1 79 LEU n 1 80 ARG n 1 81 LYS n 1 82 LEU n 1 83 TRP n 1 84 ASP n 1 85 GLY n 1 86 PRO n 1 87 ALA n 1 88 ALA n 1 89 ARG n 1 90 VAL n 1 91 ASP n 1 92 VAL n 1 93 LEU n 1 94 GLU n 1 95 ALA n 1 96 LEU n 1 97 PRO n 1 98 GLN n 1 99 HIS n 1 100 SER n 1 101 GLY n 1 102 PHE n 1 103 GLY n 1 104 SER n 1 105 LYS n 1 106 THR n 1 107 SER n 1 108 THR n 1 109 LEU n 1 110 LEU n 1 111 ALA n 1 112 VAL n 1 113 GLY n 1 114 HIS n 1 115 ALA n 1 116 TYR n 1 117 GLY n 1 118 ARG n 1 119 LEU n 1 120 CYS n 1 121 GLY n 1 122 VAL n 1 123 GLU n 1 124 PRO n 1 125 ASP n 1 126 LEU n 1 127 ARG n 1 128 GLU n 1 129 LEU n 1 130 ALA n 1 131 ARG n 1 132 THR n 1 133 LEU n 1 134 GLY n 1 135 ARG n 1 136 GLY n 1 137 ARG n 1 138 THR n 1 139 SER n 1 140 GLY n 1 141 ALA n 1 142 SER n 1 143 THR n 1 144 GLY n 1 145 LEU n 1 146 SER n 1 147 ALA n 1 148 TYR n 1 149 GLY n 1 150 GLY n 1 151 PHE n 1 152 LEU n 1 153 VAL n 1 154 ASP n 1 155 GLY n 1 156 GLY n 1 157 HIS n 1 158 VAL n 1 159 ASN n 1 160 PRO n 1 161 PRO n 1 162 ASP n 1 163 PHE n 1 164 ALA n 1 165 GLU n 1 166 ALA n 1 167 PRO n 1 168 GLN n 1 169 LYS n 1 170 TYR n 1 171 LEU n 1 172 ARG n 1 173 PRO n 1 174 SER n 1 175 ARG n 1 176 PHE n 1 177 ALA n 1 178 GLN n 1 179 GLN n 1 180 VAL n 1 181 ALA n 1 182 PRO n 1 183 PRO n 1 184 LYS n 1 185 PRO n 1 186 VAL n 1 187 VAL n 1 188 ARG n 1 189 LEU n 1 190 ASP n 1 191 PHE n 1 192 PRO n 1 193 ASP n 1 194 TRP n 1 195 PRO n 1 196 VAL n 1 197 LEU n 1 198 VAL n 1 199 LEU n 1 200 LEU n 1 201 THR n 1 202 HIS n 1 203 GLY n 1 204 ARG n 1 205 HIS n 1 206 LEU n 1 207 GLY n 1 208 GLY n 1 209 GLN n 1 210 GLU n 1 211 GLU n 1 212 LEU n 1 213 GLU n 1 214 TRP n 1 215 PHE n 1 216 HIS n 1 217 SER n 1 218 VAL n 1 219 ALA n 1 220 PRO n 1 221 ILE n 1 222 PRO n 1 223 ALA n 1 224 GLU n 1 225 GLU n 1 226 SER n 1 227 TRP n 1 228 ARG n 1 229 THR n 1 230 SER n 1 231 HIS n 1 232 LEU n 1 233 VAL n 1 234 PHE n 1 235 MET n 1 236 GLY n 1 237 LEU n 1 238 ALA n 1 239 PRO n 1 240 ALA n 1 241 VAL n 1 242 LEU n 1 243 GLU n 1 244 GLN n 1 245 ASP n 1 246 PHE n 1 247 ASP n 1 248 ALA n 1 249 PHE n 1 250 CYS n 1 251 ALA n 1 252 ALA n 1 253 VAL n 1 254 ASN n 1 255 GLU n 1 256 ILE n 1 257 THR n 1 258 PHE n 1 259 THR n 1 260 GLY n 1 261 HIS n 1 262 PHE n 1 263 LYS n 1 264 GLN n 1 265 ALA n 1 266 GLN n 1 267 ILE n 1 268 ALA n 1 269 PHE n 1 270 GLN n 1 271 GLY n 1 272 ASP n 1 273 ALA n 1 274 VAL n 1 275 ALA n 1 276 ASP n 1 277 VAL n 1 278 LEU n 1 279 GLU n 1 280 ALA n 1 281 GLY n 1 282 ARG n 1 283 ALA n 1 284 ALA n 1 285 PRO n 1 286 SER n 1 287 VAL n 1 288 ASP n 1 289 ALA n 1 290 ILE n 1 291 ALA n 1 292 LEU n 1 293 SER n 1 294 VAL n 1 295 THR n 1 296 GLY n 1 297 PRO n 1 298 ALA n 1 299 CYS n 1 300 PHE n 1 301 ALA n 1 302 PHE n 1 303 THR n 1 304 LYS n 1 305 ARG n 1 306 PRO n 1 307 GLU n 1 308 ASP n 1 309 ALA n 1 310 GLU n 1 311 ARG n 1 312 TRP n 1 313 ALA n 1 314 TRP n 1 315 GLU n 1 316 LEU n 1 317 LYS n 1 318 ASN n 1 319 ARG n 1 320 GLY n 1 321 LEU n 1 322 ILE n 1 323 ARG n 1 324 ASP n 1 325 PHE n 1 326 TRP n 1 327 PHE n 1 328 THR n 1 329 ARG n 1 330 ALA n 1 331 ASN n 1 332 ASN n 1 333 GLN n 1 334 GLY n 1 335 LEU n 1 336 ALA n 1 337 THR n 1 338 THR n 1 339 VAL n 1 340 VAL n 1 341 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 341 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cof6, F7Q99_03185' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces kaniharaensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 212423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PRP D-saccharide n 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose ;ALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID; 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribose; 1-O-pyrophosphono-5-O-phosphono-D-ribose; 1-O-pyrophosphono-5-O-phosphono-ribose ; 'C5 H13 O14 P3' 390.070 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_chem_comp_identifier.comp_id PRP _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier a-D-Ribf1PO35PO3 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 ASP 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 GLY 10 10 ? ? ? A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 GLU 165 165 165 GLU ALA A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PRO 167 167 167 PRO ALA A . n A 1 168 GLN 168 168 168 GLN ALA A . n A 1 169 LYS 169 169 169 LYS ALA A . n A 1 170 TYR 170 170 170 TYR ALA A . n A 1 171 LEU 171 171 171 LEU ALA A . n A 1 172 ARG 172 172 ? ? ? A . n A 1 173 PRO 173 173 ? ? ? A . n A 1 174 SER 174 174 ? ? ? A . n A 1 175 ARG 175 175 ? ? ? A . n A 1 176 PHE 176 176 ? ? ? A . n A 1 177 ALA 177 177 ? ? ? A . n A 1 178 GLN 178 178 ? ? ? A . n A 1 179 GLN 179 179 ? ? ? A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 TRP 194 194 194 TRP TRP A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 HIS 202 202 202 HIS HIS A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 LEU 206 206 ? ? ? A . n A 1 207 GLY 207 207 ? ? ? A . n A 1 208 GLY 208 208 ? ? ? A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 TRP 214 214 214 TRP TRP A . n A 1 215 PHE 215 215 215 PHE PHE A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 TRP 227 227 227 TRP TRP A . n A 1 228 ARG 228 228 228 ARG ARG A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 SER 230 230 230 SER SER A . n A 1 231 HIS 231 231 231 HIS HIS A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 PHE 234 234 234 PHE PHE A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 GLN 244 244 244 GLN GLN A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 PHE 249 249 249 PHE PHE A . n A 1 250 CYS 250 250 250 CYS CYS A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 PHE 258 258 258 PHE PHE A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 HIS 261 261 261 HIS HIS A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 GLN 270 270 270 GLN GLN A . n A 1 271 GLY 271 271 271 GLY GLY A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 ALA 275 275 275 ALA ALA A . n A 1 276 ASP 276 276 276 ASP ASP A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 GLU 279 279 279 GLU GLU A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 ALA 283 283 283 ALA ALA A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 PRO 285 285 285 PRO PRO A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 ASP 288 288 288 ASP ASP A . n A 1 289 ALA 289 289 289 ALA ALA A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 SER 293 293 293 SER SER A . n A 1 294 VAL 294 294 294 VAL VAL A . n A 1 295 THR 295 295 295 THR THR A . n A 1 296 GLY 296 296 296 GLY GLY A . n A 1 297 PRO 297 297 297 PRO PRO A . n A 1 298 ALA 298 298 298 ALA ALA A . n A 1 299 CYS 299 299 299 CYS CYS A . n A 1 300 PHE 300 300 300 PHE PHE A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 PHE 302 302 302 PHE PHE A . n A 1 303 THR 303 303 303 THR THR A . n A 1 304 LYS 304 304 304 LYS LYS A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 ASP 308 308 308 ASP ASP A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 GLU 310 310 310 GLU GLU A . n A 1 311 ARG 311 311 311 ARG ARG A . n A 1 312 TRP 312 312 312 TRP TRP A . n A 1 313 ALA 313 313 313 ALA ALA A . n A 1 314 TRP 314 314 314 TRP TRP A . n A 1 315 GLU 315 315 315 GLU GLU A . n A 1 316 LEU 316 316 316 LEU LEU A . n A 1 317 LYS 317 317 317 LYS LYS A . n A 1 318 ASN 318 318 318 ASN ASN A . n A 1 319 ARG 319 319 319 ARG ARG A . n A 1 320 GLY 320 320 320 GLY GLY A . n A 1 321 LEU 321 321 321 LEU LEU A . n A 1 322 ILE 322 322 322 ILE ILE A . n A 1 323 ARG 323 323 323 ARG ARG A . n A 1 324 ASP 324 324 324 ASP ASP A . n A 1 325 PHE 325 325 325 PHE PHE A . n A 1 326 TRP 326 326 326 TRP TRP A . n A 1 327 PHE 327 327 327 PHE PHE A . n A 1 328 THR 328 328 328 THR THR A . n A 1 329 ARG 329 329 329 ARG ARG A . n A 1 330 ALA 330 330 330 ALA ALA A . n A 1 331 ASN 331 331 331 ASN ASN A . n A 1 332 ASN 332 332 332 ASN ASN A . n A 1 333 GLN 333 333 333 GLN GLN A . n A 1 334 GLY 334 334 334 GLY GLY A . n A 1 335 LEU 335 335 335 LEU LEU A . n A 1 336 ALA 336 336 336 ALA ALA A . n A 1 337 THR 337 337 337 THR THR A . n A 1 338 THR 338 338 338 THR THR A . n A 1 339 VAL 339 339 339 VAL VAL A . n A 1 340 VAL 340 340 340 VAL VAL A . n A 1 341 SER 341 341 341 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 401 1 NA NA A . C 3 CL 1 402 1 CL CL A . D 4 PRP 1 403 4 PRP PRP A . E 5 HOH 1 501 10 HOH HOH A . E 5 HOH 2 502 11 HOH HOH A . E 5 HOH 3 503 9 HOH HOH A . E 5 HOH 4 504 13 HOH HOH A . E 5 HOH 5 505 3 HOH HOH A . E 5 HOH 6 506 7 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 165 ? CG ? A GLU 165 CG 2 1 Y 1 A GLU 165 ? CD ? A GLU 165 CD 3 1 Y 1 A GLU 165 ? OE1 ? A GLU 165 OE1 4 1 Y 1 A GLU 165 ? OE2 ? A GLU 165 OE2 5 1 Y 1 A PRO 167 ? CG ? A PRO 167 CG 6 1 Y 1 A PRO 167 ? CD ? A PRO 167 CD 7 1 Y 1 A GLN 168 ? CG ? A GLN 168 CG 8 1 Y 1 A GLN 168 ? CD ? A GLN 168 CD 9 1 Y 1 A GLN 168 ? OE1 ? A GLN 168 OE1 10 1 Y 1 A GLN 168 ? NE2 ? A GLN 168 NE2 11 1 Y 1 A LYS 169 ? CG ? A LYS 169 CG 12 1 Y 1 A LYS 169 ? CD ? A LYS 169 CD 13 1 Y 1 A LYS 169 ? CE ? A LYS 169 CE 14 1 Y 1 A LYS 169 ? NZ ? A LYS 169 NZ 15 1 Y 1 A TYR 170 ? CG ? A TYR 170 CG 16 1 Y 1 A TYR 170 ? CD1 ? A TYR 170 CD1 17 1 Y 1 A TYR 170 ? CD2 ? A TYR 170 CD2 18 1 Y 1 A TYR 170 ? CE1 ? A TYR 170 CE1 19 1 Y 1 A TYR 170 ? CE2 ? A TYR 170 CE2 20 1 Y 1 A TYR 170 ? CZ ? A TYR 170 CZ 21 1 Y 1 A TYR 170 ? OH ? A TYR 170 OH 22 1 Y 1 A LEU 171 ? CG ? A LEU 171 CG 23 1 Y 1 A LEU 171 ? CD1 ? A LEU 171 CD1 24 1 Y 1 A LEU 171 ? CD2 ? A LEU 171 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6YQQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.084 _cell.length_a_esd ? _cell.length_b 81.084 _cell.length_b_esd ? _cell.length_c 110.975 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YQQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YQQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'potassium dihydrogen phosphate, glycerol, PEG 8000, Bis-tris Propane' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-06-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.916 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.916 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6YQQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.08 _reflns.d_resolution_low 110.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22946 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.08 _reflns_shell.d_res_low 2.12 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1102 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.9 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.7400 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -2.7400 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 5.4900 _refine.B_iso_max 185.050 _refine.B_iso_mean 112.9250 _refine.B_iso_min 69.020 _refine.correlation_coeff_Fo_to_Fc 0.9470 _refine.correlation_coeff_Fo_to_Fc_free 0.9320 _refine.details 'U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : RESIDUAL ONLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YQQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 65.4700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12700 _refine.ls_number_reflns_R_free 670 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2273 _refine.ls_R_factor_R_free 0.2653 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2252 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'an undeposited protein' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.5170 _refine.pdbx_overall_ESU_R_Free 0.2950 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.7000 _refine.pdbx_solvent_shrinkage_radii 0.7000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 30.1000 _refine.overall_SU_ML 0.2860 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 65.4700 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 2430 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 320 _refine_hist.pdbx_B_iso_mean_ligand 96.89 _refine_hist.pdbx_B_iso_mean_solvent 72.11 _refine_hist.pdbx_number_atoms_protein 2400 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.018 2477 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 2294 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.129 1.876 3382 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.995 2.934 5272 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.925 5.000 317 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.129 22.547 106 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.738 15.000 355 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.901 15.000 23 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.063 0.200 383 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2802 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 537 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5000 _refine_ls_shell.d_res_low 2.5650 _refine_ls_shell.number_reflns_all 948 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_R_work 896 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4640 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.4150 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YQQ _struct.title 'ForT-PRPP complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YQQ _struct_keywords.text 'C-glycosidic bond, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5S9CYM0_9ACTN _struct_ref.pdbx_db_accession A0A5S9CYM0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MALDRPDRSGAVRVSAPARLSFTLISLDGSSLRRNGIAAMAVDRPGLTAEVREAADGIVAVTGTAEETARELAAALEALR KLWDGPAARVDVLEALPQHSGFGSKTSTLLAVGHAYGRLCGVEPDLRELARTLGRGRTSGASTGLSAYGGFLVDGGHVNP PDFAEAPQKYLRPSRFAQQVAPPKPVVRLDFPDWPVLVLLTHGRHLGGQEELEWFHSVAPIPAEESWRTSHLVFMGLAPA VLEQDFDAFCAAVNEITFTGHFKQAQIAFQGDAVADVLEAGRAAPSVDAIALSVTGPACFAFTKRPEDAERWAWELKNRG LIRDFWFTRANNQGLATTVVS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YQQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 341 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A5S9CYM0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 341 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 341 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4180 ? 1 MORE -70 ? 1 'SSA (A^2)' 25060 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 65 ? ASP A 84 ? ALA A 65 ASP A 84 1 ? 20 HELX_P HELX_P2 AA2 GLY A 103 ? CYS A 120 ? GLY A 103 CYS A 120 1 ? 18 HELX_P HELX_P3 AA3 ASP A 125 ? LEU A 133 ? ASP A 125 LEU A 133 1 ? 9 HELX_P HELX_P4 AA4 GLY A 140 ? GLY A 149 ? GLY A 140 GLY A 149 1 ? 10 HELX_P HELX_P5 AA5 PRO A 160 ? ALA A 164 ? PRO A 160 ALA A 164 5 ? 5 HELX_P HELX_P6 AA6 GLU A 210 ? ALA A 219 ? GLU A 210 ALA A 219 1 ? 10 HELX_P HELX_P7 AA7 PRO A 222 ? MET A 235 ? PRO A 222 MET A 235 1 ? 14 HELX_P HELX_P8 AA8 GLY A 236 ? GLN A 244 ? GLY A 236 GLN A 244 1 ? 9 HELX_P HELX_P9 AA9 ASP A 245 ? PHE A 258 ? ASP A 245 PHE A 258 1 ? 14 HELX_P HELX_P10 AB1 GLY A 260 ? GLY A 271 ? GLY A 260 GLY A 271 1 ? 12 HELX_P HELX_P11 AB2 GLY A 271 ? ALA A 284 ? GLY A 271 ALA A 284 1 ? 14 HELX_P HELX_P12 AB3 ARG A 305 ? GLY A 320 ? ARG A 305 GLY A 320 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLY 281 O ? ? ? 1_555 B NA . NA ? ? A GLY 281 A NA 401 1_555 ? ? ? ? ? ? ? 2.919 ? ? metalc2 metalc ? ? A ARG 282 O ? ? ? 1_555 B NA . NA ? ? A ARG 282 A NA 401 1_555 ? ? ? ? ? ? ? 2.835 ? ? metalc3 metalc ? ? A ALA 284 O ? ? ? 1_555 B NA . NA ? ? A ALA 284 A NA 401 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc4 metalc ? ? A VAL 287 O ? ? ? 1_555 B NA . NA ? ? A VAL 287 A NA 401 1_555 ? ? ? ? ? ? ? 2.254 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLY 281 ? A GLY 281 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? A ARG 282 ? A ARG 282 ? 1_555 75.2 ? 2 O ? A GLY 281 ? A GLY 281 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? A ALA 284 ? A ALA 284 ? 1_555 73.8 ? 3 O ? A ARG 282 ? A ARG 282 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? A ALA 284 ? A ALA 284 ? 1_555 98.2 ? 4 O ? A GLY 281 ? A GLY 281 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? A VAL 287 ? A VAL 287 ? 1_555 82.3 ? 5 O ? A ARG 282 ? A ARG 282 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? A VAL 287 ? A VAL 287 ? 1_555 154.6 ? 6 O ? A ALA 284 ? A ALA 284 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? A VAL 287 ? A VAL 287 ? 1_555 86.4 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 44 A . ? ARG 44 A PRO 45 A ? PRO 45 A 1 6.32 2 ALA 219 A . ? ALA 219 A PRO 220 A ? PRO 220 A 1 5.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 60 ? THR A 62 ? ALA A 60 THR A 62 AA1 2 ALA A 88 ? GLU A 94 ? ALA A 88 GLU A 94 AA1 3 ARG A 33 ? GLU A 53 ? ARG A 33 GLU A 53 AA1 4 PHE A 151 ? ASP A 154 ? PHE A 151 ASP A 154 AA1 5 PRO A 185 ? LEU A 189 ? PRO A 185 LEU A 189 AA2 1 HIS A 157 ? VAL A 158 ? HIS A 157 VAL A 158 AA2 2 ARG A 33 ? GLU A 53 ? ARG A 33 GLU A 53 AA2 3 VAL A 12 ? SER A 26 ? VAL A 12 SER A 26 AA2 4 ALA A 336 ? VAL A 339 ? ALA A 336 VAL A 339 AA3 1 ALA A 289 ? LEU A 292 ? ALA A 289 LEU A 292 AA3 2 ALA A 298 ? PHE A 302 ? ALA A 298 PHE A 302 AA3 3 VAL A 196 ? THR A 201 ? VAL A 196 THR A 201 AA3 4 ILE A 322 ? THR A 328 ? ILE A 322 THR A 328 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 62 ? N THR A 62 O VAL A 92 ? O VAL A 92 AA1 2 3 O ARG A 89 ? O ARG A 89 N ARG A 52 ? N ARG A 52 AA1 3 4 N ALA A 39 ? N ALA A 39 O LEU A 152 ? O LEU A 152 AA1 4 5 N PHE A 151 ? N PHE A 151 O LEU A 189 ? O LEU A 189 AA2 1 2 O HIS A 157 ? O HIS A 157 N ARG A 34 ? N ARG A 34 AA2 2 3 O VAL A 51 ? O VAL A 51 N VAL A 12 ? N VAL A 12 AA2 3 4 N ARG A 13 ? N ARG A 13 O THR A 338 ? O THR A 338 AA3 1 2 N ALA A 289 ? N ALA A 289 O PHE A 302 ? O PHE A 302 AA3 2 3 O CYS A 299 ? O CYS A 299 N LEU A 199 ? N LEU A 199 AA3 3 4 N LEU A 200 ? N LEU A 200 O ARG A 323 ? O ARG A 323 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PRO _pdbx_validate_rmsd_angle.auth_seq_id_1 167 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 167 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CB _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 167 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 111.69 _pdbx_validate_rmsd_angle.angle_target_value 103.30 _pdbx_validate_rmsd_angle.angle_deviation 8.39 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 25 ? ? -105.09 -73.13 2 1 ASN A 35 ? ? 62.21 -139.30 3 1 THR A 64 ? ? 58.09 157.84 4 1 CYS A 120 ? ? -69.22 -151.11 5 1 GLU A 123 ? ? -118.21 78.47 6 1 ALA A 147 ? ? 65.49 -6.60 7 1 ASP A 162 ? ? -94.50 35.13 8 1 ALA A 164 ? ? -57.95 85.26 9 1 GLU A 165 ? ? 158.51 -42.34 10 1 ALA A 166 ? ? 71.14 -163.91 11 1 PRO A 167 ? ? 79.46 -3.24 12 1 ALA A 181 ? ? 167.31 99.32 13 1 HIS A 202 ? ? -91.19 36.01 14 1 GLU A 210 ? ? 52.39 -64.70 15 1 THR A 259 ? ? -167.28 -30.72 16 1 VAL A 294 ? ? 60.14 -121.82 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 402 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -12.771 14.438 9.650 0.4021 0.3045 0.2578 0.1360 -0.0181 0.0856 2.2158 1.1898 4.3516 0.3784 -1.1752 0.4723 0.1599 0.1569 -0.3168 0.1328 0.5736 0.3435 -0.2372 -0.9931 -0.8340 'X-RAY DIFFRACTION' 2 ? refined -22.979 14.920 7.991 0.2842 0.4151 0.2187 0.2469 -0.0312 0.0504 7.9806 4.5025 7.8964 2.1852 3.6976 0.9704 -0.0951 0.0868 0.0083 0.1143 0.4590 0.6384 -0.2297 -0.3886 -1.2834 'X-RAY DIFFRACTION' 3 ? refined -13.760 12.665 0.508 0.5937 0.6325 0.2021 0.0765 -0.0697 0.0781 11.7324 1.7790 10.1773 -3.6390 0.8470 2.2810 0.3735 -0.2803 -0.0932 0.5870 0.4401 -0.1776 -0.3537 -0.8955 -0.6478 'X-RAY DIFFRACTION' 4 ? refined 2.548 15.184 14.215 0.3280 0.0779 0.0476 -0.0867 0.0275 -0.0259 1.8582 1.2664 5.2528 0.1284 -0.5992 0.1833 0.1152 0.0245 -0.1397 -0.0215 0.2668 0.0519 -0.1753 -1.1438 0.2313 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 11 A 68 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 69 A 121 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 122 A 147 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 148 A 341 ? ? ? ? ? ? # _pdbx_entry_details.entry_id 6YQQ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A ASP 7 ? A ASP 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A GLY 10 ? A GLY 10 11 1 Y 1 A ARG 172 ? A ARG 172 12 1 Y 1 A PRO 173 ? A PRO 173 13 1 Y 1 A SER 174 ? A SER 174 14 1 Y 1 A ARG 175 ? A ARG 175 15 1 Y 1 A PHE 176 ? A PHE 176 16 1 Y 1 A ALA 177 ? A ALA 177 17 1 Y 1 A GLN 178 ? A GLN 178 18 1 Y 1 A GLN 179 ? A GLN 179 19 1 Y 1 A LEU 206 ? A LEU 206 20 1 Y 1 A GLY 207 ? A GLY 207 21 1 Y 1 A GLY 208 ? A GLY 208 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 NA NA NA N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 PRP C1 C N R 292 PRP C2 C N R 293 PRP C3 C N S 294 PRP C4 C N R 295 PRP C5 C N N 296 PRP O1 O N N 297 PRP O2 O N N 298 PRP O3 O N N 299 PRP O4 O N N 300 PRP O5 O N N 301 PRP P P N N 302 PRP O1P O N N 303 PRP O2P O N N 304 PRP O3P O N N 305 PRP PA P N R 306 PRP O1A O N N 307 PRP O2A O N N 308 PRP O3A O N N 309 PRP PB P N N 310 PRP O1B O N N 311 PRP O2B O N N 312 PRP O3B O N N 313 PRP H1 H N N 314 PRP H2 H N N 315 PRP H3 H N N 316 PRP H4 H N N 317 PRP H51 H N N 318 PRP H52 H N N 319 PRP HO2 H N N 320 PRP HO3 H N N 321 PRP HOP2 H N N 322 PRP HOP3 H N N 323 PRP HOA2 H N N 324 PRP HOB2 H N N 325 PRP HOB3 H N N 326 SER N N N N 327 SER CA C N S 328 SER C C N N 329 SER O O N N 330 SER CB C N N 331 SER OG O N N 332 SER OXT O N N 333 SER H H N N 334 SER H2 H N N 335 SER HA H N N 336 SER HB2 H N N 337 SER HB3 H N N 338 SER HG H N N 339 SER HXT H N N 340 THR N N N N 341 THR CA C N S 342 THR C C N N 343 THR O O N N 344 THR CB C N R 345 THR OG1 O N N 346 THR CG2 C N N 347 THR OXT O N N 348 THR H H N N 349 THR H2 H N N 350 THR HA H N N 351 THR HB H N N 352 THR HG1 H N N 353 THR HG21 H N N 354 THR HG22 H N N 355 THR HG23 H N N 356 THR HXT H N N 357 TRP N N N N 358 TRP CA C N S 359 TRP C C N N 360 TRP O O N N 361 TRP CB C N N 362 TRP CG C Y N 363 TRP CD1 C Y N 364 TRP CD2 C Y N 365 TRP NE1 N Y N 366 TRP CE2 C Y N 367 TRP CE3 C Y N 368 TRP CZ2 C Y N 369 TRP CZ3 C Y N 370 TRP CH2 C Y N 371 TRP OXT O N N 372 TRP H H N N 373 TRP H2 H N N 374 TRP HA H N N 375 TRP HB2 H N N 376 TRP HB3 H N N 377 TRP HD1 H N N 378 TRP HE1 H N N 379 TRP HE3 H N N 380 TRP HZ2 H N N 381 TRP HZ3 H N N 382 TRP HH2 H N N 383 TRP HXT H N N 384 TYR N N N N 385 TYR CA C N S 386 TYR C C N N 387 TYR O O N N 388 TYR CB C N N 389 TYR CG C Y N 390 TYR CD1 C Y N 391 TYR CD2 C Y N 392 TYR CE1 C Y N 393 TYR CE2 C Y N 394 TYR CZ C Y N 395 TYR OH O N N 396 TYR OXT O N N 397 TYR H H N N 398 TYR H2 H N N 399 TYR HA H N N 400 TYR HB2 H N N 401 TYR HB3 H N N 402 TYR HD1 H N N 403 TYR HD2 H N N 404 TYR HE1 H N N 405 TYR HE2 H N N 406 TYR HH H N N 407 TYR HXT H N N 408 VAL N N N N 409 VAL CA C N S 410 VAL C C N N 411 VAL O O N N 412 VAL CB C N N 413 VAL CG1 C N N 414 VAL CG2 C N N 415 VAL OXT O N N 416 VAL H H N N 417 VAL H2 H N N 418 VAL HA H N N 419 VAL HB H N N 420 VAL HG11 H N N 421 VAL HG12 H N N 422 VAL HG13 H N N 423 VAL HG21 H N N 424 VAL HG22 H N N 425 VAL HG23 H N N 426 VAL HXT H N N 427 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 PRP C1 C2 sing N N 277 PRP C1 O1 sing N N 278 PRP C1 O4 sing N N 279 PRP C1 H1 sing N N 280 PRP C2 C3 sing N N 281 PRP C2 O2 sing N N 282 PRP C2 H2 sing N N 283 PRP C3 C4 sing N N 284 PRP C3 O3 sing N N 285 PRP C3 H3 sing N N 286 PRP C4 C5 sing N N 287 PRP C4 O4 sing N N 288 PRP C4 H4 sing N N 289 PRP C5 O5 sing N N 290 PRP C5 H51 sing N N 291 PRP C5 H52 sing N N 292 PRP O1 PA sing N N 293 PRP O2 HO2 sing N N 294 PRP O3 HO3 sing N N 295 PRP O5 P sing N N 296 PRP P O1P doub N N 297 PRP P O2P sing N N 298 PRP P O3P sing N N 299 PRP O2P HOP2 sing N N 300 PRP O3P HOP3 sing N N 301 PRP PA O1A doub N N 302 PRP PA O2A sing N N 303 PRP PA O3A sing N N 304 PRP O2A HOA2 sing N N 305 PRP O3A PB sing N N 306 PRP PB O1B doub N N 307 PRP PB O2B sing N N 308 PRP PB O3B sing N N 309 PRP O2B HOB2 sing N N 310 PRP O3B HOB3 sing N N 311 SER N CA sing N N 312 SER N H sing N N 313 SER N H2 sing N N 314 SER CA C sing N N 315 SER CA CB sing N N 316 SER CA HA sing N N 317 SER C O doub N N 318 SER C OXT sing N N 319 SER CB OG sing N N 320 SER CB HB2 sing N N 321 SER CB HB3 sing N N 322 SER OG HG sing N N 323 SER OXT HXT sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TRP N CA sing N N 341 TRP N H sing N N 342 TRP N H2 sing N N 343 TRP CA C sing N N 344 TRP CA CB sing N N 345 TRP CA HA sing N N 346 TRP C O doub N N 347 TRP C OXT sing N N 348 TRP CB CG sing N N 349 TRP CB HB2 sing N N 350 TRP CB HB3 sing N N 351 TRP CG CD1 doub Y N 352 TRP CG CD2 sing Y N 353 TRP CD1 NE1 sing Y N 354 TRP CD1 HD1 sing N N 355 TRP CD2 CE2 doub Y N 356 TRP CD2 CE3 sing Y N 357 TRP NE1 CE2 sing Y N 358 TRP NE1 HE1 sing N N 359 TRP CE2 CZ2 sing Y N 360 TRP CE3 CZ3 doub Y N 361 TRP CE3 HE3 sing N N 362 TRP CZ2 CH2 doub Y N 363 TRP CZ2 HZ2 sing N N 364 TRP CZ3 CH2 sing Y N 365 TRP CZ3 HZ3 sing N N 366 TRP CH2 HH2 sing N N 367 TRP OXT HXT sing N N 368 TYR N CA sing N N 369 TYR N H sing N N 370 TYR N H2 sing N N 371 TYR CA C sing N N 372 TYR CA CB sing N N 373 TYR CA HA sing N N 374 TYR C O doub N N 375 TYR C OXT sing N N 376 TYR CB CG sing N N 377 TYR CB HB2 sing N N 378 TYR CB HB3 sing N N 379 TYR CG CD1 doub Y N 380 TYR CG CD2 sing Y N 381 TYR CD1 CE1 sing Y N 382 TYR CD1 HD1 sing N N 383 TYR CD2 CE2 doub Y N 384 TYR CD2 HD2 sing N N 385 TYR CE1 CZ doub Y N 386 TYR CE1 HE1 sing N N 387 TYR CE2 CZ sing Y N 388 TYR CE2 HE2 sing N N 389 TYR CZ OH sing N N 390 TYR OH HH sing N N 391 TYR OXT HXT sing N N 392 VAL N CA sing N N 393 VAL N H sing N N 394 VAL N H2 sing N N 395 VAL CA C sing N N 396 VAL CA CB sing N N 397 VAL CA HA sing N N 398 VAL C O doub N N 399 VAL C OXT sing N N 400 VAL CB CG1 sing N N 401 VAL CB CG2 sing N N 402 VAL CB HB sing N N 403 VAL CG1 HG11 sing N N 404 VAL CG1 HG12 sing N N 405 VAL CG1 HG13 sing N N 406 VAL CG2 HG21 sing N N 407 VAL CG2 HG22 sing N N 408 VAL CG2 HG23 sing N N 409 VAL OXT HXT sing N N 410 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PRP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PRP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'an undeposited protein' # _atom_sites.entry_id 6YQQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012333 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012333 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009011 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N NA O P S # loop_