data_6YQW # _entry.id 6YQW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YQW pdb_00006yqw 10.2210/pdb6yqw/pdb WWPDB D_1292108130 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-14 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YQW _pdbx_database_status.recvd_initial_deposition_date 2020-04-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Chung, C.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-2480-3110 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 5816 _citation.page_last 5840 _citation.title ;Application of Atypical Acetyl-lysine Methyl Mimetics in the Development of Selective Inhibitors of the Bromodomain-Containing Protein 7 (BRD7)/Bromodomain-Containing Protein 9 (BRD9) Bromodomains. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.0c00075 _citation.pdbx_database_id_PubMed 32410449 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clegg, M.A.' 1 ? primary 'Bamborough, P.' 2 0000-0001-9479-2894 primary 'Chung, C.W.' 3 0000-0002-2480-3110 primary 'Craggs, P.D.' 4 ? primary 'Gordon, L.' 5 ? primary 'Grandi, P.' 6 ? primary 'Leveridge, M.' 7 ? primary 'Lindon, M.' 8 ? primary 'Liwicki, G.M.' 9 0000-0003-3508-8711 primary 'Michon, A.M.' 10 ? primary 'Molnar, J.' 11 ? primary 'Rioja, I.' 12 ? primary 'Soden, P.E.' 13 ? primary 'Theodoulou, N.H.' 14 ? primary 'Werner, T.' 15 ? primary 'Tomkinson, N.C.O.' 16 0000-0002-5509-0133 primary 'Prinjha, R.K.' 17 ? primary 'Humphreys, P.G.' 18 0000-0002-8614-7155 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 9' 12228.203 1 ? ? ? ? 2 non-polymer syn '4-chloranyl-2-methyl-5-(methylamino)pyridazin-3-one' 173.600 1 ? ? ? ? 3 water nat water 18.015 208 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Rhabdomyosarcoma antigen MU-RMS-40.8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNA MTYNRPDTVYYKLAKKILHAGFKMMS ; _entity_poly.pdbx_seq_one_letter_code_can ;GAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNA MTYNRPDTVYYKLAKKILHAGFKMMS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-chloranyl-2-methyl-5-(methylamino)pyridazin-3-one' 82I 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 GLU n 1 4 ASN n 1 5 GLU n 1 6 SER n 1 7 THR n 1 8 PRO n 1 9 ILE n 1 10 GLN n 1 11 GLN n 1 12 LEU n 1 13 LEU n 1 14 GLU n 1 15 HIS n 1 16 PHE n 1 17 LEU n 1 18 ARG n 1 19 GLN n 1 20 LEU n 1 21 GLN n 1 22 ARG n 1 23 LYS n 1 24 ASP n 1 25 PRO n 1 26 HIS n 1 27 GLY n 1 28 PHE n 1 29 PHE n 1 30 ALA n 1 31 PHE n 1 32 PRO n 1 33 VAL n 1 34 THR n 1 35 ASP n 1 36 ALA n 1 37 ILE n 1 38 ALA n 1 39 PRO n 1 40 GLY n 1 41 TYR n 1 42 SER n 1 43 MET n 1 44 ILE n 1 45 ILE n 1 46 LYS n 1 47 HIS n 1 48 PRO n 1 49 MET n 1 50 ASP n 1 51 PHE n 1 52 GLY n 1 53 THR n 1 54 MET n 1 55 LYS n 1 56 ASP n 1 57 LYS n 1 58 ILE n 1 59 VAL n 1 60 ALA n 1 61 ASN n 1 62 GLU n 1 63 TYR n 1 64 LYS n 1 65 SER n 1 66 VAL n 1 67 THR n 1 68 GLU n 1 69 PHE n 1 70 LYS n 1 71 ALA n 1 72 ASP n 1 73 PHE n 1 74 LYS n 1 75 LEU n 1 76 MET n 1 77 CYS n 1 78 ASP n 1 79 ASN n 1 80 ALA n 1 81 MET n 1 82 THR n 1 83 TYR n 1 84 ASN n 1 85 ARG n 1 86 PRO n 1 87 ASP n 1 88 THR n 1 89 VAL n 1 90 TYR n 1 91 TYR n 1 92 LYS n 1 93 LEU n 1 94 ALA n 1 95 LYS n 1 96 LYS n 1 97 ILE n 1 98 LEU n 1 99 HIS n 1 100 ALA n 1 101 GLY n 1 102 PHE n 1 103 LYS n 1 104 MET n 1 105 MET n 1 106 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 106 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD9, UNQ3040/PRO9856' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 82I non-polymer . '4-chloranyl-2-methyl-5-(methylamino)pyridazin-3-one' ? 'C6 H8 Cl N3 O' 173.600 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 17 ? ? ? A . n A 1 2 ALA 2 18 ? ? ? A . n A 1 3 GLU 3 19 ? ? ? A . n A 1 4 ASN 4 20 ? ? ? A . n A 1 5 GLU 5 21 ? ? ? A . n A 1 6 SER 6 22 22 SER SER A . n A 1 7 THR 7 23 23 THR THR A . n A 1 8 PRO 8 24 24 PRO PRO A . n A 1 9 ILE 9 25 25 ILE ILE A . n A 1 10 GLN 10 26 26 GLN GLN A . n A 1 11 GLN 11 27 27 GLN GLN A . n A 1 12 LEU 12 28 28 LEU LEU A . n A 1 13 LEU 13 29 29 LEU LEU A . n A 1 14 GLU 14 30 30 GLU GLU A . n A 1 15 HIS 15 31 31 HIS HIS A . n A 1 16 PHE 16 32 32 PHE PHE A . n A 1 17 LEU 17 33 33 LEU LEU A . n A 1 18 ARG 18 34 34 ARG ARG A . n A 1 19 GLN 19 35 35 GLN GLN A . n A 1 20 LEU 20 36 36 LEU LEU A . n A 1 21 GLN 21 37 37 GLN GLN A . n A 1 22 ARG 22 38 38 ARG ARG A . n A 1 23 LYS 23 39 39 LYS LYS A . n A 1 24 ASP 24 40 40 ASP ASP A . n A 1 25 PRO 25 41 41 PRO PRO A . n A 1 26 HIS 26 42 42 HIS HIS A . n A 1 27 GLY 27 43 43 GLY GLY A . n A 1 28 PHE 28 44 44 PHE PHE A . n A 1 29 PHE 29 45 45 PHE PHE A . n A 1 30 ALA 30 46 46 ALA ALA A . n A 1 31 PHE 31 47 47 PHE PHE A . n A 1 32 PRO 32 48 48 PRO PRO A . n A 1 33 VAL 33 49 49 VAL VAL A . n A 1 34 THR 34 50 50 THR THR A . n A 1 35 ASP 35 51 51 ASP ASP A . n A 1 36 ALA 36 52 52 ALA ALA A . n A 1 37 ILE 37 53 53 ILE ILE A . n A 1 38 ALA 38 54 54 ALA ALA A . n A 1 39 PRO 39 55 55 PRO PRO A . n A 1 40 GLY 40 56 56 GLY GLY A . n A 1 41 TYR 41 57 57 TYR TYR A . n A 1 42 SER 42 58 58 SER SER A . n A 1 43 MET 43 59 59 MET MET A . n A 1 44 ILE 44 60 60 ILE ILE A . n A 1 45 ILE 45 61 61 ILE ILE A . n A 1 46 LYS 46 62 62 LYS LYS A . n A 1 47 HIS 47 63 63 HIS HIS A . n A 1 48 PRO 48 64 64 PRO PRO A . n A 1 49 MET 49 65 65 MET MET A . n A 1 50 ASP 50 66 66 ASP ASP A . n A 1 51 PHE 51 67 67 PHE PHE A . n A 1 52 GLY 52 68 68 GLY GLY A . n A 1 53 THR 53 69 69 THR THR A . n A 1 54 MET 54 70 70 MET MET A . n A 1 55 LYS 55 71 71 LYS LYS A . n A 1 56 ASP 56 72 72 ASP ASP A . n A 1 57 LYS 57 73 73 LYS LYS A . n A 1 58 ILE 58 74 74 ILE ILE A . n A 1 59 VAL 59 75 75 VAL VAL A . n A 1 60 ALA 60 76 76 ALA ALA A . n A 1 61 ASN 61 77 77 ASN ASN A . n A 1 62 GLU 62 78 78 GLU GLU A . n A 1 63 TYR 63 79 79 TYR TYR A . n A 1 64 LYS 64 80 80 LYS LYS A . n A 1 65 SER 65 81 81 SER SER A . n A 1 66 VAL 66 82 82 VAL VAL A . n A 1 67 THR 67 83 83 THR THR A . n A 1 68 GLU 68 84 84 GLU GLU A . n A 1 69 PHE 69 85 85 PHE PHE A . n A 1 70 LYS 70 86 86 LYS LYS A . n A 1 71 ALA 71 87 87 ALA ALA A . n A 1 72 ASP 72 88 88 ASP ASP A . n A 1 73 PHE 73 89 89 PHE PHE A . n A 1 74 LYS 74 90 90 LYS LYS A . n A 1 75 LEU 75 91 91 LEU LEU A . n A 1 76 MET 76 92 92 MET MET A . n A 1 77 CYS 77 93 93 CYS CYS A . n A 1 78 ASP 78 94 94 ASP ASP A . n A 1 79 ASN 79 95 95 ASN ASN A . n A 1 80 ALA 80 96 96 ALA ALA A . n A 1 81 MET 81 97 97 MET MET A . n A 1 82 THR 82 98 98 THR THR A . n A 1 83 TYR 83 99 99 TYR TYR A . n A 1 84 ASN 84 100 100 ASN ASN A . n A 1 85 ARG 85 101 101 ARG ARG A . n A 1 86 PRO 86 102 102 PRO PRO A . n A 1 87 ASP 87 103 103 ASP ASP A . n A 1 88 THR 88 104 104 THR THR A . n A 1 89 VAL 89 105 105 VAL VAL A . n A 1 90 TYR 90 106 106 TYR TYR A . n A 1 91 TYR 91 107 107 TYR TYR A . n A 1 92 LYS 92 108 108 LYS LYS A . n A 1 93 LEU 93 109 109 LEU LEU A . n A 1 94 ALA 94 110 110 ALA ALA A . n A 1 95 LYS 95 111 111 LYS LYS A . n A 1 96 LYS 96 112 112 LYS LYS A . n A 1 97 ILE 97 113 113 ILE ILE A . n A 1 98 LEU 98 114 114 LEU LEU A . n A 1 99 HIS 99 115 115 HIS HIS A . n A 1 100 ALA 100 116 116 ALA ALA A . n A 1 101 GLY 101 117 117 GLY GLY A . n A 1 102 PHE 102 118 118 PHE PHE A . n A 1 103 LYS 103 119 119 LYS LYS A . n A 1 104 MET 104 120 120 MET MET A . n A 1 105 MET 105 121 121 MET MET A . n A 1 106 SER 106 122 122 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 82I 1 201 1 82I LIG A . C 3 HOH 1 301 70 HOH HOH A . C 3 HOH 2 302 43 HOH HOH A . C 3 HOH 3 303 9 HOH HOH A . C 3 HOH 4 304 77 HOH HOH A . C 3 HOH 5 305 178 HOH HOH A . C 3 HOH 6 306 59 HOH HOH A . C 3 HOH 7 307 31 HOH HOH A . C 3 HOH 8 308 72 HOH HOH A . C 3 HOH 9 309 25 HOH HOH A . C 3 HOH 10 310 196 HOH HOH A . C 3 HOH 11 311 165 HOH HOH A . C 3 HOH 12 312 76 HOH HOH A . C 3 HOH 13 313 101 HOH HOH A . C 3 HOH 14 314 37 HOH HOH A . C 3 HOH 15 315 15 HOH HOH A . C 3 HOH 16 316 69 HOH HOH A . C 3 HOH 17 317 10 HOH HOH A . C 3 HOH 18 318 193 HOH HOH A . C 3 HOH 19 319 116 HOH HOH A . C 3 HOH 20 320 117 HOH HOH A . C 3 HOH 21 321 34 HOH HOH A . C 3 HOH 22 322 54 HOH HOH A . C 3 HOH 23 323 22 HOH HOH A . C 3 HOH 24 324 16 HOH HOH A . C 3 HOH 25 325 171 HOH HOH A . C 3 HOH 26 326 134 HOH HOH A . C 3 HOH 27 327 5 HOH HOH A . C 3 HOH 28 328 152 HOH HOH A . C 3 HOH 29 329 42 HOH HOH A . C 3 HOH 30 330 29 HOH HOH A . C 3 HOH 31 331 3 HOH HOH A . C 3 HOH 32 332 26 HOH HOH A . C 3 HOH 33 333 40 HOH HOH A . C 3 HOH 34 334 102 HOH HOH A . C 3 HOH 35 335 82 HOH HOH A . C 3 HOH 36 336 114 HOH HOH A . C 3 HOH 37 337 156 HOH HOH A . C 3 HOH 38 338 12 HOH HOH A . C 3 HOH 39 339 28 HOH HOH A . C 3 HOH 40 340 11 HOH HOH A . C 3 HOH 41 341 89 HOH HOH A . C 3 HOH 42 342 21 HOH HOH A . C 3 HOH 43 343 20 HOH HOH A . C 3 HOH 44 344 55 HOH HOH A . C 3 HOH 45 345 100 HOH HOH A . C 3 HOH 46 346 52 HOH HOH A . C 3 HOH 47 347 169 HOH HOH A . C 3 HOH 48 348 113 HOH HOH A . C 3 HOH 49 349 18 HOH HOH A . C 3 HOH 50 350 4 HOH HOH A . C 3 HOH 51 351 24 HOH HOH A . C 3 HOH 52 352 179 HOH HOH A . C 3 HOH 53 353 56 HOH HOH A . C 3 HOH 54 354 19 HOH HOH A . C 3 HOH 55 355 173 HOH HOH A . C 3 HOH 56 356 63 HOH HOH A . C 3 HOH 57 357 202 HOH HOH A . C 3 HOH 58 358 194 HOH HOH A . C 3 HOH 59 359 192 HOH HOH A . C 3 HOH 60 360 106 HOH HOH A . C 3 HOH 61 361 74 HOH HOH A . C 3 HOH 62 362 186 HOH HOH A . C 3 HOH 63 363 6 HOH HOH A . C 3 HOH 64 364 75 HOH HOH A . C 3 HOH 65 365 66 HOH HOH A . C 3 HOH 66 366 129 HOH HOH A . C 3 HOH 67 367 67 HOH HOH A . C 3 HOH 68 368 123 HOH HOH A . C 3 HOH 69 369 160 HOH HOH A . C 3 HOH 70 370 161 HOH HOH A . C 3 HOH 71 371 8 HOH HOH A . C 3 HOH 72 372 7 HOH HOH A . C 3 HOH 73 373 187 HOH HOH A . C 3 HOH 74 374 158 HOH HOH A . C 3 HOH 75 375 146 HOH HOH A . C 3 HOH 76 376 88 HOH HOH A . C 3 HOH 77 377 38 HOH HOH A . C 3 HOH 78 378 118 HOH HOH A . C 3 HOH 79 379 48 HOH HOH A . C 3 HOH 80 380 64 HOH HOH A . C 3 HOH 81 381 181 HOH HOH A . C 3 HOH 82 382 205 HOH HOH A . C 3 HOH 83 383 73 HOH HOH A . C 3 HOH 84 384 53 HOH HOH A . C 3 HOH 85 385 97 HOH HOH A . C 3 HOH 86 386 17 HOH HOH A . C 3 HOH 87 387 57 HOH HOH A . C 3 HOH 88 388 130 HOH HOH A . C 3 HOH 89 389 172 HOH HOH A . C 3 HOH 90 390 71 HOH HOH A . C 3 HOH 91 391 112 HOH HOH A . C 3 HOH 92 392 149 HOH HOH A . C 3 HOH 93 393 79 HOH HOH A . C 3 HOH 94 394 200 HOH HOH A . C 3 HOH 95 395 131 HOH HOH A . C 3 HOH 96 396 135 HOH HOH A . C 3 HOH 97 397 2 HOH HOH A . C 3 HOH 98 398 49 HOH HOH A . C 3 HOH 99 399 13 HOH HOH A . C 3 HOH 100 400 145 HOH HOH A . C 3 HOH 101 401 1 HOH HOH A . C 3 HOH 102 402 168 HOH HOH A . C 3 HOH 103 403 180 HOH HOH A . C 3 HOH 104 404 46 HOH HOH A . C 3 HOH 105 405 203 HOH HOH A . C 3 HOH 106 406 141 HOH HOH A . C 3 HOH 107 407 170 HOH HOH A . C 3 HOH 108 408 153 HOH HOH A . C 3 HOH 109 409 157 HOH HOH A . C 3 HOH 110 410 132 HOH HOH A . C 3 HOH 111 411 148 HOH HOH A . C 3 HOH 112 412 80 HOH HOH A . C 3 HOH 113 413 159 HOH HOH A . C 3 HOH 114 414 62 HOH HOH A . C 3 HOH 115 415 189 HOH HOH A . C 3 HOH 116 416 167 HOH HOH A . C 3 HOH 117 417 35 HOH HOH A . C 3 HOH 118 418 105 HOH HOH A . C 3 HOH 119 419 115 HOH HOH A . C 3 HOH 120 420 138 HOH HOH A . C 3 HOH 121 421 87 HOH HOH A . C 3 HOH 122 422 150 HOH HOH A . C 3 HOH 123 423 183 HOH HOH A . C 3 HOH 124 424 39 HOH HOH A . C 3 HOH 125 425 50 HOH HOH A . C 3 HOH 126 426 174 HOH HOH A . C 3 HOH 127 427 136 HOH HOH A . C 3 HOH 128 428 41 HOH HOH A . C 3 HOH 129 429 128 HOH HOH A . C 3 HOH 130 430 124 HOH HOH A . C 3 HOH 131 431 177 HOH HOH A . C 3 HOH 132 432 137 HOH HOH A . C 3 HOH 133 433 142 HOH HOH A . C 3 HOH 134 434 163 HOH HOH A . C 3 HOH 135 435 127 HOH HOH A . C 3 HOH 136 436 61 HOH HOH A . C 3 HOH 137 437 104 HOH HOH A . C 3 HOH 138 438 23 HOH HOH A . C 3 HOH 139 439 184 HOH HOH A . C 3 HOH 140 440 86 HOH HOH A . C 3 HOH 141 441 58 HOH HOH A . C 3 HOH 142 442 125 HOH HOH A . C 3 HOH 143 443 107 HOH HOH A . C 3 HOH 144 444 139 HOH HOH A . C 3 HOH 145 445 68 HOH HOH A . C 3 HOH 146 446 47 HOH HOH A . C 3 HOH 147 447 111 HOH HOH A . C 3 HOH 148 448 30 HOH HOH A . C 3 HOH 149 449 44 HOH HOH A . C 3 HOH 150 450 188 HOH HOH A . C 3 HOH 151 451 96 HOH HOH A . C 3 HOH 152 452 33 HOH HOH A . C 3 HOH 153 453 206 HOH HOH A . C 3 HOH 154 454 92 HOH HOH A . C 3 HOH 155 455 78 HOH HOH A . C 3 HOH 156 456 190 HOH HOH A . C 3 HOH 157 457 81 HOH HOH A . C 3 HOH 158 458 126 HOH HOH A . C 3 HOH 159 459 36 HOH HOH A . C 3 HOH 160 460 103 HOH HOH A . C 3 HOH 161 461 120 HOH HOH A . C 3 HOH 162 462 84 HOH HOH A . C 3 HOH 163 463 90 HOH HOH A . C 3 HOH 164 464 143 HOH HOH A . C 3 HOH 165 465 144 HOH HOH A . C 3 HOH 166 466 45 HOH HOH A . C 3 HOH 167 467 60 HOH HOH A . C 3 HOH 168 468 51 HOH HOH A . C 3 HOH 169 469 185 HOH HOH A . C 3 HOH 170 470 32 HOH HOH A . C 3 HOH 171 471 27 HOH HOH A . C 3 HOH 172 472 91 HOH HOH A . C 3 HOH 173 473 155 HOH HOH A . C 3 HOH 174 474 121 HOH HOH A . C 3 HOH 175 475 93 HOH HOH A . C 3 HOH 176 476 83 HOH HOH A . C 3 HOH 177 477 166 HOH HOH A . C 3 HOH 178 478 14 HOH HOH A . C 3 HOH 179 479 147 HOH HOH A . C 3 HOH 180 480 119 HOH HOH A . C 3 HOH 181 481 133 HOH HOH A . C 3 HOH 182 482 164 HOH HOH A . C 3 HOH 183 483 175 HOH HOH A . C 3 HOH 184 484 95 HOH HOH A . C 3 HOH 185 485 154 HOH HOH A . C 3 HOH 186 486 108 HOH HOH A . C 3 HOH 187 487 65 HOH HOH A . C 3 HOH 188 488 162 HOH HOH A . C 3 HOH 189 489 94 HOH HOH A . C 3 HOH 190 490 197 HOH HOH A . C 3 HOH 191 491 199 HOH HOH A . C 3 HOH 192 492 122 HOH HOH A . C 3 HOH 193 493 98 HOH HOH A . C 3 HOH 194 494 207 HOH HOH A . C 3 HOH 195 495 191 HOH HOH A . C 3 HOH 196 496 204 HOH HOH A . C 3 HOH 197 497 195 HOH HOH A . C 3 HOH 198 498 110 HOH HOH A . C 3 HOH 199 499 99 HOH HOH A . C 3 HOH 200 500 151 HOH HOH A . C 3 HOH 201 501 140 HOH HOH A . C 3 HOH 202 502 109 HOH HOH A . C 3 HOH 203 503 208 HOH HOH A . C 3 HOH 204 504 176 HOH HOH A . C 3 HOH 205 505 85 HOH HOH A . C 3 HOH 206 506 201 HOH HOH A . C 3 HOH 207 507 198 HOH HOH A . C 3 HOH 208 508 182 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.1 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 # _cell.angle_alpha 70.450 _cell.angle_alpha_esd ? _cell.angle_beta 73.630 _cell.angle_beta_esd ? _cell.angle_gamma 74.390 _cell.angle_gamma_esd ? _cell.entry_id 6YQW _cell.details ? _cell.formula_units_Z ? _cell.length_a 24.566 _cell.length_a_esd ? _cell.length_b 33.928 _cell.length_b_esd ? _cell.length_c 39.623 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YQW _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YQW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M morpheus buffer 3, pH 8.5, 30% morpheus_EDO_p8K, 0.1M morpheus alcohol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-10-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97630 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97630 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 8.260 _reflns.entry_id 6YQW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.500 _reflns.d_resolution_low 27.980 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17167 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.700 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.095 _reflns.pdbx_netI_over_av_sigmaI 3.800 _reflns.pdbx_netI_over_sigmaI 5.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.134 _reflns.pdbx_Rpim_I_all 0.095 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.500 1.580 ? 3.400 4211 ? ? ? 2490 92.800 ? ? ? ? 0.172 ? ? ? ? ? ? ? ? 1.700 0.172 ? ? 4.500 0.243 0.172 ? 1 1 ? ? ? 1.580 1.680 ? 3.900 4151 ? ? ? 2343 93.600 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 1.800 0.091 ? ? 4.500 0.129 0.091 ? 2 1 ? ? ? 1.680 1.790 ? 5.700 3723 ? ? ? 2205 93.500 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 1.700 0.110 ? ? 4.900 0.155 0.110 ? 3 1 ? ? ? 1.790 1.940 ? 3.300 3524 ? ? ? 2060 93.700 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 1.700 0.127 ? ? 5.700 0.179 0.127 ? 4 1 ? ? ? 1.940 2.120 ? 3.000 3433 ? ? ? 1929 94.600 ? ? ? ? 0.148 ? ? ? ? ? ? ? ? 1.800 0.148 ? ? 6.000 0.209 0.148 ? 5 1 ? ? ? 2.120 2.370 ? 2.700 2969 ? ? ? 1739 95.900 ? ? ? ? 0.134 ? ? ? ? ? ? ? ? 1.700 0.134 ? ? 6.100 0.190 0.134 ? 6 1 ? ? ? 2.370 2.740 ? 6.400 2746 ? ? ? 1562 96.500 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 1.800 0.069 ? ? 6.400 0.098 0.069 ? 7 1 ? ? ? 2.740 3.350 ? 11.400 2271 ? ? ? 1322 97.200 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 1.700 0.050 ? ? 6.500 0.071 0.050 ? 8 1 ? ? ? 3.350 4.740 ? 9.500 1742 ? ? ? 1011 96.100 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 1.700 0.056 ? ? 6.600 0.080 0.056 ? 9 1 ? ? ? 4.740 27.975 ? 11.400 819 ? ? ? 506 88.500 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 1.600 0.042 ? ? 6.400 0.059 0.042 ? 10 1 ? ? ? # _refine.aniso_B[1][1] -0.1271 _refine.aniso_B[1][2] -0.0696 _refine.aniso_B[1][3] -1.0247 _refine.aniso_B[2][2] -0.3296 _refine.aniso_B[2][3] 0.7635 _refine.aniso_B[3][3] 0.4566 _refine.B_iso_max 93.810 _refine.B_iso_mean 12.0000 _refine.B_iso_min 3.000 _refine.correlation_coeff_Fo_to_Fc 0.8573 _refine.correlation_coeff_Fo_to_Fc_free 0.8255 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YQW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5000 _refine.ls_d_res_low 27.9800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17133 _refine.ls_number_reflns_R_free 874 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.1700 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2407 _refine.ls_R_factor_R_free 0.2763 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2388 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'In house model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1050 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1110 _refine.pdbx_overall_SU_R_Blow_DPI 0.1140 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1040 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6YQW _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.264 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.5000 _refine_hist.d_res_low 27.9800 _refine_hist.number_atoms_solvent 208 _refine_hist.number_atoms_total 1040 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 101 _refine_hist.pdbx_B_iso_mean_ligand 6.25 _refine_hist.pdbx_B_iso_mean_solvent 23.89 _refine_hist.pdbx_number_atoms_protein 821 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.5000 _refine_ls_shell.d_res_low 1.5900 _refine_ls_shell.number_reflns_all 2705 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 134 _refine_ls_shell.number_reflns_R_work 2571 _refine_ls_shell.percent_reflns_obs 94.1700 _refine_ls_shell.percent_reflns_R_free 4.9500 _refine_ls_shell.R_factor_all 0.3748 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4116 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3730 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YQW _struct.title 'BRD9 with 4-chloro-2-methyl-methylamino-pyridazinone' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YQW _struct_keywords.text 'BRD9, INHIBITOR, HISTONE, EPIGENETIC READER, BROMODOMAIN, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD9_HUMAN _struct_ref.pdbx_db_accession Q9H8M2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAM TYNRPDTVYYKLAKKILHAGFKMMS ; _struct_ref.pdbx_align_begin 134 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YQW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H8M2 _struct_ref_seq.db_align_beg 134 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 18 _struct_ref_seq.pdbx_auth_seq_align_end 122 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6YQW _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9H8M2 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 17 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6130 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? LYS A 23 ? THR A 23 LYS A 39 1 ? 17 HELX_P HELX_P2 AA2 GLY A 40 ? ILE A 45 ? GLY A 56 ILE A 61 1 ? 6 HELX_P HELX_P3 AA3 ASP A 50 ? ALA A 60 ? ASP A 66 ALA A 76 1 ? 11 HELX_P HELX_P4 AA4 SER A 65 ? ASN A 84 ? SER A 81 ASN A 100 1 ? 20 HELX_P HELX_P5 AA5 THR A 88 ? SER A 106 ? THR A 104 SER A 122 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 82I _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue 82I A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 PHE A 28 ? PHE A 44 . ? 1_555 ? 2 AC1 9 PHE A 29 ? PHE A 45 . ? 1_555 ? 3 AC1 9 VAL A 33 ? VAL A 49 . ? 1_555 ? 4 AC1 9 ILE A 37 ? ILE A 53 . ? 1_555 ? 5 AC1 9 ALA A 38 ? ALA A 54 . ? 1_555 ? 6 AC1 9 TYR A 83 ? TYR A 99 . ? 1_555 ? 7 AC1 9 ASN A 84 ? ASN A 100 . ? 1_555 ? 8 AC1 9 TYR A 90 ? TYR A 106 . ? 1_555 ? 9 AC1 9 HOH C . ? HOH A 311 . ? 1_555 ? # _pdbx_entry_details.entry_id 6YQW _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 505 ? 6.05 . 2 1 O ? A HOH 506 ? 6.09 . 3 1 O ? A HOH 507 ? 6.35 . 4 1 O ? A HOH 508 ? 8.13 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 17 ? A GLY 1 2 1 Y 1 A ALA 18 ? A ALA 2 3 1 Y 1 A GLU 19 ? A GLU 3 4 1 Y 1 A ASN 20 ? A ASN 4 5 1 Y 1 A GLU 21 ? A GLU 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 82I C01 C N N 1 82I N05 N N N 2 82I C07 C N N 3 82I C08 C N N 4 82I N10 N N N 5 82I N11 N N N 6 82I C12 C N N 7 82I C16 C N N 8 82I O17 O N N 9 82I C18 C N N 10 82I CL1 CL N N 11 82I H1 H N N 12 82I H2 H N N 13 82I H3 H N N 14 82I H4 H N N 15 82I H5 H N N 16 82I H6 H N N 17 82I H7 H N N 18 82I H9 H N N 19 ALA N N N N 20 ALA CA C N S 21 ALA C C N N 22 ALA O O N N 23 ALA CB C N N 24 ALA OXT O N N 25 ALA H H N N 26 ALA H2 H N N 27 ALA HA H N N 28 ALA HB1 H N N 29 ALA HB2 H N N 30 ALA HB3 H N N 31 ALA HXT H N N 32 ARG N N N N 33 ARG CA C N S 34 ARG C C N N 35 ARG O O N N 36 ARG CB C N N 37 ARG CG C N N 38 ARG CD C N N 39 ARG NE N N N 40 ARG CZ C N N 41 ARG NH1 N N N 42 ARG NH2 N N N 43 ARG OXT O N N 44 ARG H H N N 45 ARG H2 H N N 46 ARG HA H N N 47 ARG HB2 H N N 48 ARG HB3 H N N 49 ARG HG2 H N N 50 ARG HG3 H N N 51 ARG HD2 H N N 52 ARG HD3 H N N 53 ARG HE H N N 54 ARG HH11 H N N 55 ARG HH12 H N N 56 ARG HH21 H N N 57 ARG HH22 H N N 58 ARG HXT H N N 59 ASN N N N N 60 ASN CA C N S 61 ASN C C N N 62 ASN O O N N 63 ASN CB C N N 64 ASN CG C N N 65 ASN OD1 O N N 66 ASN ND2 N N N 67 ASN OXT O N N 68 ASN H H N N 69 ASN H2 H N N 70 ASN HA H N N 71 ASN HB2 H N N 72 ASN HB3 H N N 73 ASN HD21 H N N 74 ASN HD22 H N N 75 ASN HXT H N N 76 ASP N N N N 77 ASP CA C N S 78 ASP C C N N 79 ASP O O N N 80 ASP CB C N N 81 ASP CG C N N 82 ASP OD1 O N N 83 ASP OD2 O N N 84 ASP OXT O N N 85 ASP H H N N 86 ASP H2 H N N 87 ASP HA H N N 88 ASP HB2 H N N 89 ASP HB3 H N N 90 ASP HD2 H N N 91 ASP HXT H N N 92 CYS N N N N 93 CYS CA C N R 94 CYS C C N N 95 CYS O O N N 96 CYS CB C N N 97 CYS SG S N N 98 CYS OXT O N N 99 CYS H H N N 100 CYS H2 H N N 101 CYS HA H N N 102 CYS HB2 H N N 103 CYS HB3 H N N 104 CYS HG H N N 105 CYS HXT H N N 106 GLN N N N N 107 GLN CA C N S 108 GLN C C N N 109 GLN O O N N 110 GLN CB C N N 111 GLN CG C N N 112 GLN CD C N N 113 GLN OE1 O N N 114 GLN NE2 N N N 115 GLN OXT O N N 116 GLN H H N N 117 GLN H2 H N N 118 GLN HA H N N 119 GLN HB2 H N N 120 GLN HB3 H N N 121 GLN HG2 H N N 122 GLN HG3 H N N 123 GLN HE21 H N N 124 GLN HE22 H N N 125 GLN HXT H N N 126 GLU N N N N 127 GLU CA C N S 128 GLU C C N N 129 GLU O O N N 130 GLU CB C N N 131 GLU CG C N N 132 GLU CD C N N 133 GLU OE1 O N N 134 GLU OE2 O N N 135 GLU OXT O N N 136 GLU H H N N 137 GLU H2 H N N 138 GLU HA H N N 139 GLU HB2 H N N 140 GLU HB3 H N N 141 GLU HG2 H N N 142 GLU HG3 H N N 143 GLU HE2 H N N 144 GLU HXT H N N 145 GLY N N N N 146 GLY CA C N N 147 GLY C C N N 148 GLY O O N N 149 GLY OXT O N N 150 GLY H H N N 151 GLY H2 H N N 152 GLY HA2 H N N 153 GLY HA3 H N N 154 GLY HXT H N N 155 HIS N N N N 156 HIS CA C N S 157 HIS C C N N 158 HIS O O N N 159 HIS CB C N N 160 HIS CG C Y N 161 HIS ND1 N Y N 162 HIS CD2 C Y N 163 HIS CE1 C Y N 164 HIS NE2 N Y N 165 HIS OXT O N N 166 HIS H H N N 167 HIS H2 H N N 168 HIS HA H N N 169 HIS HB2 H N N 170 HIS HB3 H N N 171 HIS HD1 H N N 172 HIS HD2 H N N 173 HIS HE1 H N N 174 HIS HE2 H N N 175 HIS HXT H N N 176 HOH O O N N 177 HOH H1 H N N 178 HOH H2 H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TYR N N N N 340 TYR CA C N S 341 TYR C C N N 342 TYR O O N N 343 TYR CB C N N 344 TYR CG C Y N 345 TYR CD1 C Y N 346 TYR CD2 C Y N 347 TYR CE1 C Y N 348 TYR CE2 C Y N 349 TYR CZ C Y N 350 TYR OH O N N 351 TYR OXT O N N 352 TYR H H N N 353 TYR H2 H N N 354 TYR HA H N N 355 TYR HB2 H N N 356 TYR HB3 H N N 357 TYR HD1 H N N 358 TYR HD2 H N N 359 TYR HE1 H N N 360 TYR HE2 H N N 361 TYR HH H N N 362 TYR HXT H N N 363 VAL N N N N 364 VAL CA C N S 365 VAL C C N N 366 VAL O O N N 367 VAL CB C N N 368 VAL CG1 C N N 369 VAL CG2 C N N 370 VAL OXT O N N 371 VAL H H N N 372 VAL H2 H N N 373 VAL HA H N N 374 VAL HB H N N 375 VAL HG11 H N N 376 VAL HG12 H N N 377 VAL HG13 H N N 378 VAL HG21 H N N 379 VAL HG22 H N N 380 VAL HG23 H N N 381 VAL HXT H N N 382 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 82I C12 N11 sing N N 1 82I O17 C16 doub N N 2 82I N11 C16 sing N N 3 82I N11 N10 sing N N 4 82I C16 C18 sing N N 5 82I N10 C08 doub N N 6 82I C18 CL1 sing N N 7 82I C18 C07 doub N N 8 82I C08 C07 sing N N 9 82I C07 N05 sing N N 10 82I N05 C01 sing N N 11 82I C01 H1 sing N N 12 82I C01 H2 sing N N 13 82I C01 H3 sing N N 14 82I C08 H4 sing N N 15 82I C12 H5 sing N N 16 82I C12 H6 sing N N 17 82I C12 H7 sing N N 18 82I N05 H9 sing N N 19 ALA N CA sing N N 20 ALA N H sing N N 21 ALA N H2 sing N N 22 ALA CA C sing N N 23 ALA CA CB sing N N 24 ALA CA HA sing N N 25 ALA C O doub N N 26 ALA C OXT sing N N 27 ALA CB HB1 sing N N 28 ALA CB HB2 sing N N 29 ALA CB HB3 sing N N 30 ALA OXT HXT sing N N 31 ARG N CA sing N N 32 ARG N H sing N N 33 ARG N H2 sing N N 34 ARG CA C sing N N 35 ARG CA CB sing N N 36 ARG CA HA sing N N 37 ARG C O doub N N 38 ARG C OXT sing N N 39 ARG CB CG sing N N 40 ARG CB HB2 sing N N 41 ARG CB HB3 sing N N 42 ARG CG CD sing N N 43 ARG CG HG2 sing N N 44 ARG CG HG3 sing N N 45 ARG CD NE sing N N 46 ARG CD HD2 sing N N 47 ARG CD HD3 sing N N 48 ARG NE CZ sing N N 49 ARG NE HE sing N N 50 ARG CZ NH1 sing N N 51 ARG CZ NH2 doub N N 52 ARG NH1 HH11 sing N N 53 ARG NH1 HH12 sing N N 54 ARG NH2 HH21 sing N N 55 ARG NH2 HH22 sing N N 56 ARG OXT HXT sing N N 57 ASN N CA sing N N 58 ASN N H sing N N 59 ASN N H2 sing N N 60 ASN CA C sing N N 61 ASN CA CB sing N N 62 ASN CA HA sing N N 63 ASN C O doub N N 64 ASN C OXT sing N N 65 ASN CB CG sing N N 66 ASN CB HB2 sing N N 67 ASN CB HB3 sing N N 68 ASN CG OD1 doub N N 69 ASN CG ND2 sing N N 70 ASN ND2 HD21 sing N N 71 ASN ND2 HD22 sing N N 72 ASN OXT HXT sing N N 73 ASP N CA sing N N 74 ASP N H sing N N 75 ASP N H2 sing N N 76 ASP CA C sing N N 77 ASP CA CB sing N N 78 ASP CA HA sing N N 79 ASP C O doub N N 80 ASP C OXT sing N N 81 ASP CB CG sing N N 82 ASP CB HB2 sing N N 83 ASP CB HB3 sing N N 84 ASP CG OD1 doub N N 85 ASP CG OD2 sing N N 86 ASP OD2 HD2 sing N N 87 ASP OXT HXT sing N N 88 CYS N CA sing N N 89 CYS N H sing N N 90 CYS N H2 sing N N 91 CYS CA C sing N N 92 CYS CA CB sing N N 93 CYS CA HA sing N N 94 CYS C O doub N N 95 CYS C OXT sing N N 96 CYS CB SG sing N N 97 CYS CB HB2 sing N N 98 CYS CB HB3 sing N N 99 CYS SG HG sing N N 100 CYS OXT HXT sing N N 101 GLN N CA sing N N 102 GLN N H sing N N 103 GLN N H2 sing N N 104 GLN CA C sing N N 105 GLN CA CB sing N N 106 GLN CA HA sing N N 107 GLN C O doub N N 108 GLN C OXT sing N N 109 GLN CB CG sing N N 110 GLN CB HB2 sing N N 111 GLN CB HB3 sing N N 112 GLN CG CD sing N N 113 GLN CG HG2 sing N N 114 GLN CG HG3 sing N N 115 GLN CD OE1 doub N N 116 GLN CD NE2 sing N N 117 GLN NE2 HE21 sing N N 118 GLN NE2 HE22 sing N N 119 GLN OXT HXT sing N N 120 GLU N CA sing N N 121 GLU N H sing N N 122 GLU N H2 sing N N 123 GLU CA C sing N N 124 GLU CA CB sing N N 125 GLU CA HA sing N N 126 GLU C O doub N N 127 GLU C OXT sing N N 128 GLU CB CG sing N N 129 GLU CB HB2 sing N N 130 GLU CB HB3 sing N N 131 GLU CG CD sing N N 132 GLU CG HG2 sing N N 133 GLU CG HG3 sing N N 134 GLU CD OE1 doub N N 135 GLU CD OE2 sing N N 136 GLU OE2 HE2 sing N N 137 GLU OXT HXT sing N N 138 GLY N CA sing N N 139 GLY N H sing N N 140 GLY N H2 sing N N 141 GLY CA C sing N N 142 GLY CA HA2 sing N N 143 GLY CA HA3 sing N N 144 GLY C O doub N N 145 GLY C OXT sing N N 146 GLY OXT HXT sing N N 147 HIS N CA sing N N 148 HIS N H sing N N 149 HIS N H2 sing N N 150 HIS CA C sing N N 151 HIS CA CB sing N N 152 HIS CA HA sing N N 153 HIS C O doub N N 154 HIS C OXT sing N N 155 HIS CB CG sing N N 156 HIS CB HB2 sing N N 157 HIS CB HB3 sing N N 158 HIS CG ND1 sing Y N 159 HIS CG CD2 doub Y N 160 HIS ND1 CE1 doub Y N 161 HIS ND1 HD1 sing N N 162 HIS CD2 NE2 sing Y N 163 HIS CD2 HD2 sing N N 164 HIS CE1 NE2 sing Y N 165 HIS CE1 HE1 sing N N 166 HIS NE2 HE2 sing N N 167 HIS OXT HXT sing N N 168 HOH O H1 sing N N 169 HOH O H2 sing N N 170 ILE N CA sing N N 171 ILE N H sing N N 172 ILE N H2 sing N N 173 ILE CA C sing N N 174 ILE CA CB sing N N 175 ILE CA HA sing N N 176 ILE C O doub N N 177 ILE C OXT sing N N 178 ILE CB CG1 sing N N 179 ILE CB CG2 sing N N 180 ILE CB HB sing N N 181 ILE CG1 CD1 sing N N 182 ILE CG1 HG12 sing N N 183 ILE CG1 HG13 sing N N 184 ILE CG2 HG21 sing N N 185 ILE CG2 HG22 sing N N 186 ILE CG2 HG23 sing N N 187 ILE CD1 HD11 sing N N 188 ILE CD1 HD12 sing N N 189 ILE CD1 HD13 sing N N 190 ILE OXT HXT sing N N 191 LEU N CA sing N N 192 LEU N H sing N N 193 LEU N H2 sing N N 194 LEU CA C sing N N 195 LEU CA CB sing N N 196 LEU CA HA sing N N 197 LEU C O doub N N 198 LEU C OXT sing N N 199 LEU CB CG sing N N 200 LEU CB HB2 sing N N 201 LEU CB HB3 sing N N 202 LEU CG CD1 sing N N 203 LEU CG CD2 sing N N 204 LEU CG HG sing N N 205 LEU CD1 HD11 sing N N 206 LEU CD1 HD12 sing N N 207 LEU CD1 HD13 sing N N 208 LEU CD2 HD21 sing N N 209 LEU CD2 HD22 sing N N 210 LEU CD2 HD23 sing N N 211 LEU OXT HXT sing N N 212 LYS N CA sing N N 213 LYS N H sing N N 214 LYS N H2 sing N N 215 LYS CA C sing N N 216 LYS CA CB sing N N 217 LYS CA HA sing N N 218 LYS C O doub N N 219 LYS C OXT sing N N 220 LYS CB CG sing N N 221 LYS CB HB2 sing N N 222 LYS CB HB3 sing N N 223 LYS CG CD sing N N 224 LYS CG HG2 sing N N 225 LYS CG HG3 sing N N 226 LYS CD CE sing N N 227 LYS CD HD2 sing N N 228 LYS CD HD3 sing N N 229 LYS CE NZ sing N N 230 LYS CE HE2 sing N N 231 LYS CE HE3 sing N N 232 LYS NZ HZ1 sing N N 233 LYS NZ HZ2 sing N N 234 LYS NZ HZ3 sing N N 235 LYS OXT HXT sing N N 236 MET N CA sing N N 237 MET N H sing N N 238 MET N H2 sing N N 239 MET CA C sing N N 240 MET CA CB sing N N 241 MET CA HA sing N N 242 MET C O doub N N 243 MET C OXT sing N N 244 MET CB CG sing N N 245 MET CB HB2 sing N N 246 MET CB HB3 sing N N 247 MET CG SD sing N N 248 MET CG HG2 sing N N 249 MET CG HG3 sing N N 250 MET SD CE sing N N 251 MET CE HE1 sing N N 252 MET CE HE2 sing N N 253 MET CE HE3 sing N N 254 MET OXT HXT sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 82I _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 82I _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'In house model' # _atom_sites.entry_id 6YQW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.040707 _atom_sites.fract_transf_matrix[1][2] -0.011373 _atom_sites.fract_transf_matrix[1][3] -0.009138 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.030603 _atom_sites.fract_transf_matrix[2][3] -0.008928 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027401 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_