data_6YQY # _entry.id 6YQY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YQY pdb_00006yqy 10.2210/pdb6yqy/pdb WWPDB D_1292108116 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-21 2 'Structure model' 1 1 2021-07-28 3 'Structure model' 1 2 2021-08-04 4 'Structure model' 1 3 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_last' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.title' 6 3 'Structure model' '_citation_author.name' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YQY _pdbx_database_status.recvd_initial_deposition_date 2020-04-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Romero-Romero, S.' 1 0000-0003-2144-7912 'Wiese, G.J.' 2 ? 'Kordes, S.' 3 0000-0001-7489-3380 'Shanmugaratnam, S.' 4 0000-0002-2614-6046 'Fernandez-Velasco, D.A.' 5 0000-0003-2368-6378 'Hocker, B.' 6 0000-0002-8250-9462 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 433 _citation.language ? _citation.page_first 167153 _citation.page_last 167153 _citation.title 'The Stability Landscape of de novo TIM Barrels Explored by a Modular Design Approach.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2021.167153 _citation.pdbx_database_id_PubMed 34271011 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Romero-Romero, S.' 1 ? primary 'Costas, M.' 2 ? primary 'Silva Manzano, D.A.' 3 ? primary 'Kordes, S.' 4 ? primary 'Rojas-Ortega, E.' 5 ? primary 'Tapia, C.' 6 ? primary 'Guerra, Y.' 7 ? primary 'Shanmugaratnam, S.' 8 ? primary 'Rodriguez-Romero, A.' 9 ? primary 'Baker, D.' 10 ? primary 'Hocker, B.' 11 ? primary 'Fernandez-Velasco, D.A.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'de novo designed TIM barrel sTIM11noCys' 22917.422 1 ? ? ? 'M (N-terminal) and GLEHHHHHH (C-terminal) come from the expresion vector.' 2 water nat water 18.015 49 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEAWKKGADILIVDATDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEA WKKGADILIVDATDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEAWKKGADILIVDATDKDEAWKQVEQLRREGATQIA YRSDDWRDLKEAWKKGADILIVDATGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEAWKKGADILIVDATDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEA WKKGADILIVDATDKDEAWKQVEQLRREGATQIAYRSDDWRDLKEAWKKGADILIVDATDKDEAWKQVEQLRREGATQIA YRSDDWRDLKEAWKKGADILIVDATGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 ASP n 1 5 GLU n 1 6 ALA n 1 7 TRP n 1 8 LYS n 1 9 GLN n 1 10 VAL n 1 11 GLU n 1 12 GLN n 1 13 LEU n 1 14 ARG n 1 15 ARG n 1 16 GLU n 1 17 GLY n 1 18 ALA n 1 19 THR n 1 20 GLN n 1 21 ILE n 1 22 ALA n 1 23 TYR n 1 24 ARG n 1 25 SER n 1 26 ASP n 1 27 ASP n 1 28 TRP n 1 29 ARG n 1 30 ASP n 1 31 LEU n 1 32 LYS n 1 33 GLU n 1 34 ALA n 1 35 TRP n 1 36 LYS n 1 37 LYS n 1 38 GLY n 1 39 ALA n 1 40 ASP n 1 41 ILE n 1 42 LEU n 1 43 ILE n 1 44 VAL n 1 45 ASP n 1 46 ALA n 1 47 THR n 1 48 ASP n 1 49 LYS n 1 50 ASP n 1 51 GLU n 1 52 ALA n 1 53 TRP n 1 54 LYS n 1 55 GLN n 1 56 VAL n 1 57 GLU n 1 58 GLN n 1 59 LEU n 1 60 ARG n 1 61 ARG n 1 62 GLU n 1 63 GLY n 1 64 ALA n 1 65 THR n 1 66 GLN n 1 67 ILE n 1 68 ALA n 1 69 TYR n 1 70 ARG n 1 71 SER n 1 72 ASP n 1 73 ASP n 1 74 TRP n 1 75 ARG n 1 76 ASP n 1 77 LEU n 1 78 LYS n 1 79 GLU n 1 80 ALA n 1 81 TRP n 1 82 LYS n 1 83 LYS n 1 84 GLY n 1 85 ALA n 1 86 ASP n 1 87 ILE n 1 88 LEU n 1 89 ILE n 1 90 VAL n 1 91 ASP n 1 92 ALA n 1 93 THR n 1 94 ASP n 1 95 LYS n 1 96 ASP n 1 97 GLU n 1 98 ALA n 1 99 TRP n 1 100 LYS n 1 101 GLN n 1 102 VAL n 1 103 GLU n 1 104 GLN n 1 105 LEU n 1 106 ARG n 1 107 ARG n 1 108 GLU n 1 109 GLY n 1 110 ALA n 1 111 THR n 1 112 GLN n 1 113 ILE n 1 114 ALA n 1 115 TYR n 1 116 ARG n 1 117 SER n 1 118 ASP n 1 119 ASP n 1 120 TRP n 1 121 ARG n 1 122 ASP n 1 123 LEU n 1 124 LYS n 1 125 GLU n 1 126 ALA n 1 127 TRP n 1 128 LYS n 1 129 LYS n 1 130 GLY n 1 131 ALA n 1 132 ASP n 1 133 ILE n 1 134 LEU n 1 135 ILE n 1 136 VAL n 1 137 ASP n 1 138 ALA n 1 139 THR n 1 140 ASP n 1 141 LYS n 1 142 ASP n 1 143 GLU n 1 144 ALA n 1 145 TRP n 1 146 LYS n 1 147 GLN n 1 148 VAL n 1 149 GLU n 1 150 GLN n 1 151 LEU n 1 152 ARG n 1 153 ARG n 1 154 GLU n 1 155 GLY n 1 156 ALA n 1 157 THR n 1 158 GLN n 1 159 ILE n 1 160 ALA n 1 161 TYR n 1 162 ARG n 1 163 SER n 1 164 ASP n 1 165 ASP n 1 166 TRP n 1 167 ARG n 1 168 ASP n 1 169 LEU n 1 170 LYS n 1 171 GLU n 1 172 ALA n 1 173 TRP n 1 174 LYS n 1 175 LYS n 1 176 GLY n 1 177 ALA n 1 178 ASP n 1 179 ILE n 1 180 LEU n 1 181 ILE n 1 182 VAL n 1 183 ASP n 1 184 ALA n 1 185 THR n 1 186 GLY n 1 187 LEU n 1 188 GLU n 1 189 HIS n 1 190 HIS n 1 191 HIS n 1 192 HIS n 1 193 HIS n 1 194 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 194 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET21b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 ASP 2 1 ? ? ? A . n A 1 3 LYS 3 2 ? ? ? A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 TRP 7 6 6 TRP TRP A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 GLN 9 8 8 GLN GLN A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 GLN 12 11 11 GLN GLN A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 ARG 15 14 14 ARG ARG A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 GLY 17 16 ? ? ? A . n A 1 18 ALA 18 17 17 ALA ALA A . n A 1 19 THR 19 18 18 THR THR A . n A 1 20 GLN 20 19 19 GLN GLN A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 ALA 22 21 21 ALA ALA A . n A 1 23 TYR 23 22 22 TYR TYR A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 ASP 26 25 25 ASP ASP A . n A 1 27 ASP 27 26 26 ASP ASP A . n A 1 28 TRP 28 27 27 TRP TRP A . n A 1 29 ARG 29 28 28 ARG ARG A . n A 1 30 ASP 30 29 29 ASP ASP A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 LYS 32 31 31 LYS LYS A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 TRP 35 34 34 TRP TRP A . n A 1 36 LYS 36 35 35 LYS LYS A . n A 1 37 LYS 37 36 36 LYS LYS A . n A 1 38 GLY 38 37 37 GLY GLY A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 ASP 40 39 39 ASP ASP A . n A 1 41 ILE 41 40 40 ILE ILE A . n A 1 42 LEU 42 41 41 LEU LEU A . n A 1 43 ILE 43 42 42 ILE ILE A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ALA 46 45 45 ALA ALA A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 ASP 48 47 47 ASP ASP A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 GLU 51 50 50 GLU GLU A . n A 1 52 ALA 52 51 51 ALA ALA A . n A 1 53 TRP 53 52 52 TRP TRP A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 GLN 55 54 54 GLN GLN A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 GLU 57 56 56 GLU GLU A . n A 1 58 GLN 58 57 57 GLN GLN A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 ARG 60 59 59 ARG ARG A . n A 1 61 ARG 61 60 60 ARG ARG A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 GLY 63 62 62 GLY GLY A . n A 1 64 ALA 64 63 63 ALA ALA A . n A 1 65 THR 65 64 64 THR THR A . n A 1 66 GLN 66 65 65 GLN GLN A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 TYR 69 68 68 TYR TYR A . n A 1 70 ARG 70 69 69 ARG ARG A . n A 1 71 SER 71 70 70 SER SER A . n A 1 72 ASP 72 71 71 ASP ASP A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 TRP 74 73 73 TRP TRP A . n A 1 75 ARG 75 74 74 ARG ARG A . n A 1 76 ASP 76 75 75 ASP ASP A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 ALA 80 79 79 ALA ALA A . n A 1 81 TRP 81 80 80 TRP TRP A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 ASP 86 85 85 ASP ASP A . n A 1 87 ILE 87 86 86 ILE ILE A . n A 1 88 LEU 88 87 87 LEU LEU A . n A 1 89 ILE 89 88 88 ILE ILE A . n A 1 90 VAL 90 89 89 VAL VAL A . n A 1 91 ASP 91 90 90 ASP ASP A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 ASP 94 93 93 ASP ASP A . n A 1 95 LYS 95 94 94 LYS LYS A . n A 1 96 ASP 96 95 95 ASP ASP A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 TRP 99 98 98 TRP TRP A . n A 1 100 LYS 100 99 99 LYS LYS A . n A 1 101 GLN 101 100 100 GLN GLN A . n A 1 102 VAL 102 101 101 VAL VAL A . n A 1 103 GLU 103 102 102 GLU GLU A . n A 1 104 GLN 104 103 103 GLN GLN A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 ARG 107 106 106 ARG ARG A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 GLY 109 108 108 GLY GLY A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 THR 111 110 110 THR THR A . n A 1 112 GLN 112 111 111 GLN GLN A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 ALA 114 113 113 ALA ALA A . n A 1 115 TYR 115 114 114 TYR TYR A . n A 1 116 ARG 116 115 115 ARG ARG A . n A 1 117 SER 117 116 116 SER SER A . n A 1 118 ASP 118 117 117 ASP ASP A . n A 1 119 ASP 119 118 118 ASP ASP A . n A 1 120 TRP 120 119 119 TRP TRP A . n A 1 121 ARG 121 120 120 ARG ARG A . n A 1 122 ASP 122 121 121 ASP ASP A . n A 1 123 LEU 123 122 122 LEU LEU A . n A 1 124 LYS 124 123 123 LYS LYS A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 TRP 127 126 126 TRP TRP A . n A 1 128 LYS 128 127 127 LYS LYS A . n A 1 129 LYS 129 128 128 LYS LYS A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 ILE 133 132 132 ILE ILE A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 ILE 135 134 134 ILE ILE A . n A 1 136 VAL 136 135 135 VAL VAL A . n A 1 137 ASP 137 136 136 ASP ASP A . n A 1 138 ALA 138 137 137 ALA ALA A . n A 1 139 THR 139 138 138 THR THR A . n A 1 140 ASP 140 139 ? ? ? A . n A 1 141 LYS 141 140 ? ? ? A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 TRP 145 144 144 TRP TRP A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 GLN 147 146 146 GLN GLN A . n A 1 148 VAL 148 147 147 VAL VAL A . n A 1 149 GLU 149 148 148 GLU GLU A . n A 1 150 GLN 150 149 149 GLN GLN A . n A 1 151 LEU 151 150 150 LEU LEU A . n A 1 152 ARG 152 151 151 ARG ARG A . n A 1 153 ARG 153 152 152 ARG ARG A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 GLY 155 154 154 GLY GLY A . n A 1 156 ALA 156 155 155 ALA ALA A . n A 1 157 THR 157 156 156 THR THR A . n A 1 158 GLN 158 157 157 GLN GLN A . n A 1 159 ILE 159 158 158 ILE ILE A . n A 1 160 ALA 160 159 159 ALA ALA A . n A 1 161 TYR 161 160 160 TYR TYR A . n A 1 162 ARG 162 161 161 ARG ARG A . n A 1 163 SER 163 162 162 SER SER A . n A 1 164 ASP 164 163 163 ASP ASP A . n A 1 165 ASP 165 164 164 ASP ASP A . n A 1 166 TRP 166 165 165 TRP TRP A . n A 1 167 ARG 167 166 166 ARG ARG A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 LEU 169 168 168 LEU LEU A . n A 1 170 LYS 170 169 169 LYS LYS A . n A 1 171 GLU 171 170 170 GLU GLU A . n A 1 172 ALA 172 171 171 ALA ALA A . n A 1 173 TRP 173 172 172 TRP TRP A . n A 1 174 LYS 174 173 173 LYS LYS A . n A 1 175 LYS 175 174 174 LYS LYS A . n A 1 176 GLY 176 175 175 GLY GLY A . n A 1 177 ALA 177 176 176 ALA ALA A . n A 1 178 ASP 178 177 177 ASP ASP A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 ILE 181 180 180 ILE ILE A . n A 1 182 VAL 182 181 181 VAL VAL A . n A 1 183 ASP 183 182 182 ASP ASP A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 THR 185 184 ? ? ? A . n A 1 186 GLY 186 185 ? ? ? A . n A 1 187 LEU 187 186 ? ? ? A . n A 1 188 GLU 188 187 ? ? ? A . n A 1 189 HIS 189 188 ? ? ? A . n A 1 190 HIS 190 189 ? ? ? A . n A 1 191 HIS 191 190 ? ? ? A . n A 1 192 HIS 192 191 ? ? ? A . n A 1 193 HIS 193 192 ? ? ? A . n A 1 194 HIS 194 193 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 66 HOH HOH A . B 2 HOH 2 202 70 HOH HOH A . B 2 HOH 3 203 74 HOH HOH A . B 2 HOH 4 204 34 HOH HOH A . B 2 HOH 5 205 38 HOH HOH A . B 2 HOH 6 206 80 HOH HOH A . B 2 HOH 7 207 57 HOH HOH A . B 2 HOH 8 208 28 HOH HOH A . B 2 HOH 9 209 83 HOH HOH A . B 2 HOH 10 210 27 HOH HOH A . B 2 HOH 11 211 67 HOH HOH A . B 2 HOH 12 212 5 HOH HOH A . B 2 HOH 13 213 2 HOH HOH A . B 2 HOH 14 214 32 HOH HOH A . B 2 HOH 15 215 77 HOH HOH A . B 2 HOH 16 216 73 HOH HOH A . B 2 HOH 17 217 9 HOH HOH A . B 2 HOH 18 218 81 HOH HOH A . B 2 HOH 19 219 82 HOH HOH A . B 2 HOH 20 220 12 HOH HOH A . B 2 HOH 21 221 1 HOH HOH A . B 2 HOH 22 222 69 HOH HOH A . B 2 HOH 23 223 55 HOH HOH A . B 2 HOH 24 224 85 HOH HOH A . B 2 HOH 25 225 24 HOH HOH A . B 2 HOH 26 226 84 HOH HOH A . B 2 HOH 27 227 6 HOH HOH A . B 2 HOH 28 228 42 HOH HOH A . B 2 HOH 29 229 10 HOH HOH A . B 2 HOH 30 230 3 HOH HOH A . B 2 HOH 31 231 15 HOH HOH A . B 2 HOH 32 232 39 HOH HOH A . B 2 HOH 33 233 78 HOH HOH A . B 2 HOH 34 234 50 HOH HOH A . B 2 HOH 35 235 87 HOH HOH A . B 2 HOH 36 236 68 HOH HOH A . B 2 HOH 37 237 79 HOH HOH A . B 2 HOH 38 238 51 HOH HOH A . B 2 HOH 39 239 75 HOH HOH A . B 2 HOH 40 240 76 HOH HOH A . B 2 HOH 41 241 72 HOH HOH A . B 2 HOH 42 242 54 HOH HOH A . B 2 HOH 43 243 88 HOH HOH A . B 2 HOH 44 244 29 HOH HOH A . B 2 HOH 45 245 53 HOH HOH A . B 2 HOH 46 246 18 HOH HOH A . B 2 HOH 47 247 31 HOH HOH A . B 2 HOH 48 248 63 HOH HOH A . B 2 HOH 49 249 71 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 4 ? CG ? A GLU 5 CG 2 1 Y 1 A GLU 4 ? CD ? A GLU 5 CD 3 1 Y 1 A GLU 4 ? OE1 ? A GLU 5 OE1 4 1 Y 1 A GLU 4 ? OE2 ? A GLU 5 OE2 5 1 Y 1 A TRP 6 ? CG ? A TRP 7 CG 6 1 Y 1 A TRP 6 ? CD1 ? A TRP 7 CD1 7 1 Y 1 A TRP 6 ? CD2 ? A TRP 7 CD2 8 1 Y 1 A TRP 6 ? NE1 ? A TRP 7 NE1 9 1 Y 1 A TRP 6 ? CE2 ? A TRP 7 CE2 10 1 Y 1 A TRP 6 ? CE3 ? A TRP 7 CE3 11 1 Y 1 A TRP 6 ? CZ2 ? A TRP 7 CZ2 12 1 Y 1 A TRP 6 ? CZ3 ? A TRP 7 CZ3 13 1 Y 1 A TRP 6 ? CH2 ? A TRP 7 CH2 14 1 Y 1 A LYS 7 ? CG ? A LYS 8 CG 15 1 Y 1 A LYS 7 ? CD ? A LYS 8 CD 16 1 Y 1 A LYS 7 ? CE ? A LYS 8 CE 17 1 Y 1 A LYS 7 ? NZ ? A LYS 8 NZ 18 1 Y 1 A GLN 8 ? CG ? A GLN 9 CG 19 1 Y 1 A GLN 8 ? CD ? A GLN 9 CD 20 1 Y 1 A GLN 8 ? OE1 ? A GLN 9 OE1 21 1 Y 1 A GLN 8 ? NE2 ? A GLN 9 NE2 22 1 Y 1 A GLU 10 ? CG ? A GLU 11 CG 23 1 Y 1 A GLU 10 ? CD ? A GLU 11 CD 24 1 Y 1 A GLU 10 ? OE1 ? A GLU 11 OE1 25 1 Y 1 A GLU 10 ? OE2 ? A GLU 11 OE2 26 1 Y 1 A LYS 31 ? CG ? A LYS 32 CG 27 1 Y 1 A LYS 31 ? CD ? A LYS 32 CD 28 1 Y 1 A LYS 31 ? CE ? A LYS 32 CE 29 1 Y 1 A LYS 31 ? NZ ? A LYS 32 NZ 30 1 Y 1 A GLU 32 ? CG ? A GLU 33 CG 31 1 Y 1 A GLU 32 ? CD ? A GLU 33 CD 32 1 Y 1 A GLU 32 ? OE1 ? A GLU 33 OE1 33 1 Y 1 A GLU 32 ? OE2 ? A GLU 33 OE2 34 1 Y 1 A GLU 50 ? CD ? A GLU 51 CD 35 1 Y 1 A GLU 50 ? OE1 ? A GLU 51 OE1 36 1 Y 1 A GLU 50 ? OE2 ? A GLU 51 OE2 37 1 Y 1 A LYS 94 ? CG ? A LYS 95 CG 38 1 Y 1 A LYS 94 ? CD ? A LYS 95 CD 39 1 Y 1 A LYS 94 ? CE ? A LYS 95 CE 40 1 Y 1 A LYS 94 ? NZ ? A LYS 95 NZ 41 1 Y 1 A ASP 141 ? CG ? A ASP 142 CG 42 1 Y 1 A ASP 141 ? OD1 ? A ASP 142 OD1 43 1 Y 1 A ASP 141 ? OD2 ? A ASP 142 OD2 44 1 Y 1 A GLU 142 ? CG ? A GLU 143 CG 45 1 Y 1 A GLU 142 ? CD ? A GLU 143 CD 46 1 Y 1 A GLU 142 ? OE1 ? A GLU 143 OE1 47 1 Y 1 A GLU 142 ? OE2 ? A GLU 143 OE2 48 1 Y 1 A LYS 145 ? CG ? A LYS 146 CG 49 1 Y 1 A LYS 145 ? CD ? A LYS 146 CD 50 1 Y 1 A LYS 145 ? CE ? A LYS 146 CE 51 1 Y 1 A LYS 145 ? NZ ? A LYS 146 NZ 52 1 Y 1 A GLU 148 ? CG ? A GLU 149 CG 53 1 Y 1 A GLU 148 ? CD ? A GLU 149 CD 54 1 Y 1 A GLU 148 ? OE1 ? A GLU 149 OE1 55 1 Y 1 A GLU 148 ? OE2 ? A GLU 149 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15_3459 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15_3459 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6YQY _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.452 _cell.length_a_esd ? _cell.length_b 50.452 _cell.length_b_esd ? _cell.length_c 132.412 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YQY _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YQY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium sulfate, 0.1 M Trisodium citrate pH: 5.6, 25% w/v PEG 4000.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 41 _reflns.entry_id 6YQY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.876 _reflns.d_resolution_low 47.15 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14703 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.3 _reflns.pdbx_Rmerge_I_obs 0.061 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.876 _reflns_shell.d_res_low 1.940 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1410 _reflns_shell.percent_possible_all 99.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.281 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 23.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.810 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 115.300 _refine.B_iso_mean 54.2617 _refine.B_iso_min 21.900 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YQY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8760 _refine.ls_d_res_low 47.1460 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14703 _refine.ls_number_reflns_R_free 708 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7400 _refine.ls_percent_reflns_R_free 4.8200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2226 _refine.ls_R_factor_R_free 0.2701 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2202 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5BVL _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.2800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8760 _refine_hist.d_res_low 47.1460 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 1478 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 178 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 62.75 _refine_hist.pdbx_number_atoms_protein 1429 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.876 2.0207 . . 146 2685 99.0000 . . . 0.3428 0.0000 0.2571 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0207 2.2240 . . 129 2738 100.0000 . . . 0.3160 0.0000 0.2209 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2240 2.5458 . . 139 2778 100.0000 . . . 0.3145 0.0000 0.2269 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5458 3.2074 . . 144 2801 100.0000 . . . 0.2883 0.0000 0.2543 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2074 10 . . 150 2993 100.0000 . . . 0.2452 0.0000 0.2047 . . . . . . . . . . . # _struct.entry_id 6YQY _struct.title 'Crystal structure of sTIM11noCys, a de novo designed TIM barrel' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YQY _struct_keywords.text 'de novo protein design, epistasis, stability landscape, TIM barrel, (beta/alfa)8 barrel, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6YQY _struct_ref.pdbx_db_accession 6YQY _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YQY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 194 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6YQY _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 193 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 193 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8880 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 6 ? ARG A 14 ? ALA A 5 ARG A 13 1 ? 9 HELX_P HELX_P2 AA2 ASP A 27 ? LYS A 37 ? ASP A 26 LYS A 36 1 ? 11 HELX_P HELX_P3 AA3 ASP A 48 ? GLU A 62 ? ASP A 47 GLU A 61 1 ? 15 HELX_P HELX_P4 AA4 ASP A 73 ? LYS A 83 ? ASP A 72 LYS A 82 1 ? 11 HELX_P HELX_P5 AA5 ASP A 94 ? GLY A 109 ? ASP A 93 GLY A 108 1 ? 16 HELX_P HELX_P6 AA6 ASP A 119 ? GLY A 130 ? ASP A 118 GLY A 129 1 ? 12 HELX_P HELX_P7 AA7 ALA A 144 ? GLY A 155 ? ALA A 143 GLY A 154 1 ? 12 HELX_P HELX_P8 AA8 ASP A 165 ? GLY A 176 ? ASP A 164 GLY A 175 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 20 ? SER A 25 ? GLN A 19 SER A 24 AA1 2 ILE A 41 ? VAL A 44 ? ILE A 40 VAL A 43 AA1 3 ILE A 67 ? SER A 71 ? ILE A 66 SER A 70 AA1 4 ILE A 87 ? ASP A 91 ? ILE A 86 ASP A 90 AA1 5 ILE A 113 ? SER A 117 ? ILE A 112 SER A 116 AA1 6 ILE A 133 ? ASP A 137 ? ILE A 132 ASP A 136 AA1 7 GLN A 158 ? ARG A 162 ? GLN A 157 ARG A 161 AA1 8 ILE A 179 ? ASP A 183 ? ILE A 178 ASP A 182 AA1 9 GLN A 20 ? SER A 25 ? GLN A 19 SER A 24 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 23 ? N TYR A 22 O ILE A 41 ? O ILE A 40 AA1 2 3 N VAL A 44 ? N VAL A 43 O ALA A 68 ? O ALA A 67 AA1 3 4 N TYR A 69 ? N TYR A 68 O ILE A 89 ? O ILE A 88 AA1 4 5 N LEU A 88 ? N LEU A 87 O ALA A 114 ? O ALA A 113 AA1 5 6 N TYR A 115 ? N TYR A 114 O ILE A 135 ? O ILE A 134 AA1 6 7 N LEU A 134 ? N LEU A 133 O ALA A 160 ? O ALA A 159 AA1 7 8 N TYR A 161 ? N TYR A 160 O ILE A 181 ? O ILE A 180 AA1 8 9 O VAL A 182 ? O VAL A 181 N ALA A 22 ? N ALA A 21 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 65 ? ? 61.07 65.43 2 1 THR A 92 ? ? -136.49 -52.94 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 230 ? B HOH . 2 1 A HOH 236 ? B HOH . 3 1 A HOH 246 ? B HOH . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -15.6478 _pdbx_refine_tls.origin_y 7.9733 _pdbx_refine_tls.origin_z 4.9850 _pdbx_refine_tls.T[1][1] 0.2405 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0126 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0351 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.2322 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0707 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2302 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 4.4350 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.3082 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.3105 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.0029 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.5135 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.7595 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0221 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.2764 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1445 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0746 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0222 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0075 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1235 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0019 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0033 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 3 ? ? A 183 ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 1 ? ? B 88 ? all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A ASP 1 ? A ASP 2 3 1 Y 1 A LYS 2 ? A LYS 3 4 1 Y 1 A GLY 16 ? A GLY 17 5 1 Y 1 A ASP 139 ? A ASP 140 6 1 Y 1 A LYS 140 ? A LYS 141 7 1 Y 1 A THR 184 ? A THR 185 8 1 Y 1 A GLY 185 ? A GLY 186 9 1 Y 1 A LEU 186 ? A LEU 187 10 1 Y 1 A GLU 187 ? A GLU 188 11 1 Y 1 A HIS 188 ? A HIS 189 12 1 Y 1 A HIS 189 ? A HIS 190 13 1 Y 1 A HIS 190 ? A HIS 191 14 1 Y 1 A HIS 191 ? A HIS 192 15 1 Y 1 A HIS 192 ? A HIS 193 16 1 Y 1 A HIS 193 ? A HIS 194 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 HOH O O N N 127 HOH H1 H N N 128 HOH H2 H N N 129 ILE N N N N 130 ILE CA C N S 131 ILE C C N N 132 ILE O O N N 133 ILE CB C N S 134 ILE CG1 C N N 135 ILE CG2 C N N 136 ILE CD1 C N N 137 ILE OXT O N N 138 ILE H H N N 139 ILE H2 H N N 140 ILE HA H N N 141 ILE HB H N N 142 ILE HG12 H N N 143 ILE HG13 H N N 144 ILE HG21 H N N 145 ILE HG22 H N N 146 ILE HG23 H N N 147 ILE HD11 H N N 148 ILE HD12 H N N 149 ILE HD13 H N N 150 ILE HXT H N N 151 LEU N N N N 152 LEU CA C N S 153 LEU C C N N 154 LEU O O N N 155 LEU CB C N N 156 LEU CG C N N 157 LEU CD1 C N N 158 LEU CD2 C N N 159 LEU OXT O N N 160 LEU H H N N 161 LEU H2 H N N 162 LEU HA H N N 163 LEU HB2 H N N 164 LEU HB3 H N N 165 LEU HG H N N 166 LEU HD11 H N N 167 LEU HD12 H N N 168 LEU HD13 H N N 169 LEU HD21 H N N 170 LEU HD22 H N N 171 LEU HD23 H N N 172 LEU HXT H N N 173 LYS N N N N 174 LYS CA C N S 175 LYS C C N N 176 LYS O O N N 177 LYS CB C N N 178 LYS CG C N N 179 LYS CD C N N 180 LYS CE C N N 181 LYS NZ N N N 182 LYS OXT O N N 183 LYS H H N N 184 LYS H2 H N N 185 LYS HA H N N 186 LYS HB2 H N N 187 LYS HB3 H N N 188 LYS HG2 H N N 189 LYS HG3 H N N 190 LYS HD2 H N N 191 LYS HD3 H N N 192 LYS HE2 H N N 193 LYS HE3 H N N 194 LYS HZ1 H N N 195 LYS HZ2 H N N 196 LYS HZ3 H N N 197 LYS HXT H N N 198 MET N N N N 199 MET CA C N S 200 MET C C N N 201 MET O O N N 202 MET CB C N N 203 MET CG C N N 204 MET SD S N N 205 MET CE C N N 206 MET OXT O N N 207 MET H H N N 208 MET H2 H N N 209 MET HA H N N 210 MET HB2 H N N 211 MET HB3 H N N 212 MET HG2 H N N 213 MET HG3 H N N 214 MET HE1 H N N 215 MET HE2 H N N 216 MET HE3 H N N 217 MET HXT H N N 218 SER N N N N 219 SER CA C N S 220 SER C C N N 221 SER O O N N 222 SER CB C N N 223 SER OG O N N 224 SER OXT O N N 225 SER H H N N 226 SER H2 H N N 227 SER HA H N N 228 SER HB2 H N N 229 SER HB3 H N N 230 SER HG H N N 231 SER HXT H N N 232 THR N N N N 233 THR CA C N S 234 THR C C N N 235 THR O O N N 236 THR CB C N R 237 THR OG1 O N N 238 THR CG2 C N N 239 THR OXT O N N 240 THR H H N N 241 THR H2 H N N 242 THR HA H N N 243 THR HB H N N 244 THR HG1 H N N 245 THR HG21 H N N 246 THR HG22 H N N 247 THR HG23 H N N 248 THR HXT H N N 249 TRP N N N N 250 TRP CA C N S 251 TRP C C N N 252 TRP O O N N 253 TRP CB C N N 254 TRP CG C Y N 255 TRP CD1 C Y N 256 TRP CD2 C Y N 257 TRP NE1 N Y N 258 TRP CE2 C Y N 259 TRP CE3 C Y N 260 TRP CZ2 C Y N 261 TRP CZ3 C Y N 262 TRP CH2 C Y N 263 TRP OXT O N N 264 TRP H H N N 265 TRP H2 H N N 266 TRP HA H N N 267 TRP HB2 H N N 268 TRP HB3 H N N 269 TRP HD1 H N N 270 TRP HE1 H N N 271 TRP HE3 H N N 272 TRP HZ2 H N N 273 TRP HZ3 H N N 274 TRP HH2 H N N 275 TRP HXT H N N 276 TYR N N N N 277 TYR CA C N S 278 TYR C C N N 279 TYR O O N N 280 TYR CB C N N 281 TYR CG C Y N 282 TYR CD1 C Y N 283 TYR CD2 C Y N 284 TYR CE1 C Y N 285 TYR CE2 C Y N 286 TYR CZ C Y N 287 TYR OH O N N 288 TYR OXT O N N 289 TYR H H N N 290 TYR H2 H N N 291 TYR HA H N N 292 TYR HB2 H N N 293 TYR HB3 H N N 294 TYR HD1 H N N 295 TYR HD2 H N N 296 TYR HE1 H N N 297 TYR HE2 H N N 298 TYR HH H N N 299 TYR HXT H N N 300 VAL N N N N 301 VAL CA C N S 302 VAL C C N N 303 VAL O O N N 304 VAL CB C N N 305 VAL CG1 C N N 306 VAL CG2 C N N 307 VAL OXT O N N 308 VAL H H N N 309 VAL H2 H N N 310 VAL HA H N N 311 VAL HB H N N 312 VAL HG11 H N N 313 VAL HG12 H N N 314 VAL HG13 H N N 315 VAL HG21 H N N 316 VAL HG22 H N N 317 VAL HG23 H N N 318 VAL HXT H N N 319 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 HOH O H1 sing N N 121 HOH O H2 sing N N 122 ILE N CA sing N N 123 ILE N H sing N N 124 ILE N H2 sing N N 125 ILE CA C sing N N 126 ILE CA CB sing N N 127 ILE CA HA sing N N 128 ILE C O doub N N 129 ILE C OXT sing N N 130 ILE CB CG1 sing N N 131 ILE CB CG2 sing N N 132 ILE CB HB sing N N 133 ILE CG1 CD1 sing N N 134 ILE CG1 HG12 sing N N 135 ILE CG1 HG13 sing N N 136 ILE CG2 HG21 sing N N 137 ILE CG2 HG22 sing N N 138 ILE CG2 HG23 sing N N 139 ILE CD1 HD11 sing N N 140 ILE CD1 HD12 sing N N 141 ILE CD1 HD13 sing N N 142 ILE OXT HXT sing N N 143 LEU N CA sing N N 144 LEU N H sing N N 145 LEU N H2 sing N N 146 LEU CA C sing N N 147 LEU CA CB sing N N 148 LEU CA HA sing N N 149 LEU C O doub N N 150 LEU C OXT sing N N 151 LEU CB CG sing N N 152 LEU CB HB2 sing N N 153 LEU CB HB3 sing N N 154 LEU CG CD1 sing N N 155 LEU CG CD2 sing N N 156 LEU CG HG sing N N 157 LEU CD1 HD11 sing N N 158 LEU CD1 HD12 sing N N 159 LEU CD1 HD13 sing N N 160 LEU CD2 HD21 sing N N 161 LEU CD2 HD22 sing N N 162 LEU CD2 HD23 sing N N 163 LEU OXT HXT sing N N 164 LYS N CA sing N N 165 LYS N H sing N N 166 LYS N H2 sing N N 167 LYS CA C sing N N 168 LYS CA CB sing N N 169 LYS CA HA sing N N 170 LYS C O doub N N 171 LYS C OXT sing N N 172 LYS CB CG sing N N 173 LYS CB HB2 sing N N 174 LYS CB HB3 sing N N 175 LYS CG CD sing N N 176 LYS CG HG2 sing N N 177 LYS CG HG3 sing N N 178 LYS CD CE sing N N 179 LYS CD HD2 sing N N 180 LYS CD HD3 sing N N 181 LYS CE NZ sing N N 182 LYS CE HE2 sing N N 183 LYS CE HE3 sing N N 184 LYS NZ HZ1 sing N N 185 LYS NZ HZ2 sing N N 186 LYS NZ HZ3 sing N N 187 LYS OXT HXT sing N N 188 MET N CA sing N N 189 MET N H sing N N 190 MET N H2 sing N N 191 MET CA C sing N N 192 MET CA CB sing N N 193 MET CA HA sing N N 194 MET C O doub N N 195 MET C OXT sing N N 196 MET CB CG sing N N 197 MET CB HB2 sing N N 198 MET CB HB3 sing N N 199 MET CG SD sing N N 200 MET CG HG2 sing N N 201 MET CG HG3 sing N N 202 MET SD CE sing N N 203 MET CE HE1 sing N N 204 MET CE HE2 sing N N 205 MET CE HE3 sing N N 206 MET OXT HXT sing N N 207 SER N CA sing N N 208 SER N H sing N N 209 SER N H2 sing N N 210 SER CA C sing N N 211 SER CA CB sing N N 212 SER CA HA sing N N 213 SER C O doub N N 214 SER C OXT sing N N 215 SER CB OG sing N N 216 SER CB HB2 sing N N 217 SER CB HB3 sing N N 218 SER OG HG sing N N 219 SER OXT HXT sing N N 220 THR N CA sing N N 221 THR N H sing N N 222 THR N H2 sing N N 223 THR CA C sing N N 224 THR CA CB sing N N 225 THR CA HA sing N N 226 THR C O doub N N 227 THR C OXT sing N N 228 THR CB OG1 sing N N 229 THR CB CG2 sing N N 230 THR CB HB sing N N 231 THR OG1 HG1 sing N N 232 THR CG2 HG21 sing N N 233 THR CG2 HG22 sing N N 234 THR CG2 HG23 sing N N 235 THR OXT HXT sing N N 236 TRP N CA sing N N 237 TRP N H sing N N 238 TRP N H2 sing N N 239 TRP CA C sing N N 240 TRP CA CB sing N N 241 TRP CA HA sing N N 242 TRP C O doub N N 243 TRP C OXT sing N N 244 TRP CB CG sing N N 245 TRP CB HB2 sing N N 246 TRP CB HB3 sing N N 247 TRP CG CD1 doub Y N 248 TRP CG CD2 sing Y N 249 TRP CD1 NE1 sing Y N 250 TRP CD1 HD1 sing N N 251 TRP CD2 CE2 doub Y N 252 TRP CD2 CE3 sing Y N 253 TRP NE1 CE2 sing Y N 254 TRP NE1 HE1 sing N N 255 TRP CE2 CZ2 sing Y N 256 TRP CE3 CZ3 doub Y N 257 TRP CE3 HE3 sing N N 258 TRP CZ2 CH2 doub Y N 259 TRP CZ2 HZ2 sing N N 260 TRP CZ3 CH2 sing Y N 261 TRP CZ3 HZ3 sing N N 262 TRP CH2 HH2 sing N N 263 TRP OXT HXT sing N N 264 TYR N CA sing N N 265 TYR N H sing N N 266 TYR N H2 sing N N 267 TYR CA C sing N N 268 TYR CA CB sing N N 269 TYR CA HA sing N N 270 TYR C O doub N N 271 TYR C OXT sing N N 272 TYR CB CG sing N N 273 TYR CB HB2 sing N N 274 TYR CB HB3 sing N N 275 TYR CG CD1 doub Y N 276 TYR CG CD2 sing Y N 277 TYR CD1 CE1 sing Y N 278 TYR CD1 HD1 sing N N 279 TYR CD2 CE2 doub Y N 280 TYR CD2 HD2 sing N N 281 TYR CE1 CZ doub Y N 282 TYR CE1 HE1 sing N N 283 TYR CE2 CZ sing Y N 284 TYR CE2 HE2 sing N N 285 TYR CZ OH sing N N 286 TYR OH HH sing N N 287 TYR OXT HXT sing N N 288 VAL N CA sing N N 289 VAL N H sing N N 290 VAL N H2 sing N N 291 VAL CA C sing N N 292 VAL CA CB sing N N 293 VAL CA HA sing N N 294 VAL C O doub N N 295 VAL C OXT sing N N 296 VAL CB CG1 sing N N 297 VAL CB CG2 sing N N 298 VAL CB HB sing N N 299 VAL CG1 HG11 sing N N 300 VAL CG1 HG12 sing N N 301 VAL CG1 HG13 sing N N 302 VAL CG2 HG21 sing N N 303 VAL CG2 HG22 sing N N 304 VAL CG2 HG23 sing N N 305 VAL OXT HXT sing N N 306 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Consejo Nacional de Ciencia y Tecnologia (CONACYT)' Mexico 254514 1 'Programa de Apoyo a Proyectos de Investigacion e Innovacion Tecnologica (PAPIIT)' Mexico IN220516 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5BVL _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YQY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019821 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019821 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007552 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O # loop_