data_6YRR # _entry.id 6YRR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YRR pdb_00006yrr 10.2210/pdb6yrr/pdb WWPDB D_1292108159 ? ? BMRB 50190 ? 10.13018/BMR50190 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-11-03 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Other 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_status 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 2 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6YRR _pdbx_database_status.recvd_initial_deposition_date 2020-04-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 50190 _pdbx_database_related.content_type unspecified # _audit_author.name 'Celestine, C.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-4154-2378 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Heimdallarchaea encodes profilin with eukaryotic-like actin regulation and polyproline binding' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Celestine, C.' _citation_author.ordinal 1 _citation_author.identifier_ORCID 0000-0003-4154-2378 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Profilin _entity.formula_weight 16494.904 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKDGFILKKKKIPKNIFRIGNKEMSYSDDLNSLIQSQYVSYVVILDPNGAIYWTNNENWQVNGSEVLRQWMGSAPSITVA GTKFSSFRNEPGVSFVGRNMAGGGLIILQKAPNGYVFLSWTSHEFLTTSGLPPLNIHAEIAMMAAKFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MKDGFILKKKKIPKNIFRIGNKEMSYSDDLNSLIQSQYVSYVVILDPNGAIYWTNNENWQVNGSEVLRQWMGSAPSITVA GTKFSSFRNEPGVSFVGRNMAGGGLIILQKAPNGYVFLSWTSHEFLTTSGLPPLNIHAEIAMMAAKFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ASP n 1 4 GLY n 1 5 PHE n 1 6 ILE n 1 7 LEU n 1 8 LYS n 1 9 LYS n 1 10 LYS n 1 11 LYS n 1 12 ILE n 1 13 PRO n 1 14 LYS n 1 15 ASN n 1 16 ILE n 1 17 PHE n 1 18 ARG n 1 19 ILE n 1 20 GLY n 1 21 ASN n 1 22 LYS n 1 23 GLU n 1 24 MET n 1 25 SER n 1 26 TYR n 1 27 SER n 1 28 ASP n 1 29 ASP n 1 30 LEU n 1 31 ASN n 1 32 SER n 1 33 LEU n 1 34 ILE n 1 35 GLN n 1 36 SER n 1 37 GLN n 1 38 TYR n 1 39 VAL n 1 40 SER n 1 41 TYR n 1 42 VAL n 1 43 VAL n 1 44 ILE n 1 45 LEU n 1 46 ASP n 1 47 PRO n 1 48 ASN n 1 49 GLY n 1 50 ALA n 1 51 ILE n 1 52 TYR n 1 53 TRP n 1 54 THR n 1 55 ASN n 1 56 ASN n 1 57 GLU n 1 58 ASN n 1 59 TRP n 1 60 GLN n 1 61 VAL n 1 62 ASN n 1 63 GLY n 1 64 SER n 1 65 GLU n 1 66 VAL n 1 67 LEU n 1 68 ARG n 1 69 GLN n 1 70 TRP n 1 71 MET n 1 72 GLY n 1 73 SER n 1 74 ALA n 1 75 PRO n 1 76 SER n 1 77 ILE n 1 78 THR n 1 79 VAL n 1 80 ALA n 1 81 GLY n 1 82 THR n 1 83 LYS n 1 84 PHE n 1 85 SER n 1 86 SER n 1 87 PHE n 1 88 ARG n 1 89 ASN n 1 90 GLU n 1 91 PRO n 1 92 GLY n 1 93 VAL n 1 94 SER n 1 95 PHE n 1 96 VAL n 1 97 GLY n 1 98 ARG n 1 99 ASN n 1 100 MET n 1 101 ALA n 1 102 GLY n 1 103 GLY n 1 104 GLY n 1 105 LEU n 1 106 ILE n 1 107 ILE n 1 108 LEU n 1 109 GLN n 1 110 LYS n 1 111 ALA n 1 112 PRO n 1 113 ASN n 1 114 GLY n 1 115 TYR n 1 116 VAL n 1 117 PHE n 1 118 LEU n 1 119 SER n 1 120 TRP n 1 121 THR n 1 122 SER n 1 123 HIS n 1 124 GLU n 1 125 PHE n 1 126 LEU n 1 127 THR n 1 128 THR n 1 129 SER n 1 130 GLY n 1 131 LEU n 1 132 PRO n 1 133 PRO n 1 134 LEU n 1 135 ASN n 1 136 ILE n 1 137 HIS n 1 138 ALA n 1 139 GLU n 1 140 ILE n 1 141 ALA n 1 142 MET n 1 143 MET n 1 144 ALA n 1 145 ALA n 1 146 LYS n 1 147 PHE n 1 148 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 148 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HeimC3_27980 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Candidatus Heimdallarchaeota archaeon LC_3' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1841598 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 GLN 148 148 148 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YRR _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6YRR _struct.title 'Heimdallarchaeota profilin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YRR _struct_keywords.text 'Eukaryogenesis, profilin, Heimdallarchaeota, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1Q9NL85_9ARCH _struct_ref.pdbx_db_accession A0A1Q9NL85 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKDGFILKKKKIPKNIFRIGNKEMSYSDDLNSLIQSQYVSYVVILDPNGAIYWTNNENWQVNGSEVLRQWMGSAPSITVA GTKFSSFRNEPGVSFVGRNMAGGGLIILQKAPNGYVFLSWTSHEFLTTSGLPPLNIHAEIAMMAAKFQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YRR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1Q9NL85 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 30 ? GLN A 35 ? LEU A 30 GLN A 35 1 ? 6 HELX_P HELX_P2 AA2 ASN A 62 ? GLN A 69 ? ASN A 62 GLN A 69 1 ? 8 HELX_P HELX_P3 AA3 TRP A 70 ? SER A 73 ? TRP A 70 SER A 73 5 ? 4 HELX_P HELX_P4 AA4 HIS A 137 ? MET A 142 ? HIS A 137 MET A 142 1 ? 6 HELX_P HELX_P5 AA5 MET A 142 ? PHE A 147 ? MET A 142 PHE A 147 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 51 ? TRP A 53 ? ILE A 51 TRP A 53 AA1 2 VAL A 39 ? LEU A 45 ? VAL A 39 LEU A 45 AA1 3 VAL A 116 ? THR A 121 ? VAL A 116 THR A 121 AA1 4 LEU A 105 ? LYS A 110 ? LEU A 105 LYS A 110 AA1 5 PHE A 95 ? ASN A 99 ? PHE A 95 ASN A 99 AA1 6 THR A 82 ? ARG A 88 ? THR A 82 ARG A 88 AA1 7 SER A 76 ? VAL A 79 ? SER A 76 VAL A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 52 ? O TYR A 52 N ILE A 44 ? N ILE A 44 AA1 2 3 N VAL A 43 ? N VAL A 43 O LEU A 118 ? O LEU A 118 AA1 3 4 O SER A 119 ? O SER A 119 N ILE A 107 ? N ILE A 107 AA1 4 5 O ILE A 106 ? O ILE A 106 N GLY A 97 ? N GLY A 97 AA1 5 6 O VAL A 96 ? O VAL A 96 N PHE A 87 ? N PHE A 87 AA1 6 7 O PHE A 84 ? O PHE A 84 N ILE A 77 ? N ILE A 77 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HZ2 A LYS 22 ? ? OE1 A GLU 23 ? ? 1.60 2 19 O A ASP 46 ? ? H A ASN 48 ? ? 1.58 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 17 C A ASP 46 ? ? N A PRO 47 ? ? CA A PRO 47 ? ? 129.17 119.30 9.87 1.50 Y 2 19 C A ASP 46 ? ? N A PRO 47 ? ? CA A PRO 47 ? ? 128.72 119.30 9.42 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 11 ? ? -72.56 30.82 2 1 SER A 27 ? ? 72.48 85.79 3 1 ASP A 28 ? ? -166.97 -56.20 4 1 TRP A 53 ? ? -170.17 138.58 5 1 ASN A 58 ? ? 69.88 76.92 6 1 VAL A 93 ? ? -96.54 30.77 7 1 SER A 94 ? ? 77.00 126.57 8 1 MET A 100 ? ? -39.61 -26.43 9 1 PRO A 112 ? ? -64.76 12.87 10 1 LEU A 134 ? ? -157.00 41.61 11 2 LYS A 14 ? ? -103.35 -67.57 12 2 ASN A 15 ? ? -117.53 75.39 13 2 ILE A 19 ? ? -102.75 52.44 14 2 TYR A 38 ? ? 80.51 57.16 15 2 ASN A 55 ? ? -106.46 71.06 16 2 ASN A 56 ? ? -151.04 62.85 17 2 ASN A 58 ? ? 75.53 35.56 18 2 PHE A 87 ? ? -99.68 -61.05 19 2 SER A 94 ? ? -179.03 132.01 20 2 ASN A 99 ? ? -69.18 87.93 21 2 MET A 100 ? ? 54.95 -78.24 22 2 ALA A 101 ? ? -104.98 -68.83 23 2 TYR A 115 ? ? -58.85 102.08 24 2 PRO A 133 ? ? -47.21 101.28 25 2 ILE A 140 ? ? -106.57 -64.61 26 3 ASP A 29 ? ? -44.45 -72.90 27 3 PRO A 47 ? ? -56.33 -5.91 28 3 ASN A 56 ? ? -116.29 68.84 29 3 ASN A 58 ? ? 74.70 75.72 30 3 ASN A 99 ? ? -68.31 73.88 31 3 MET A 100 ? ? 66.97 -75.21 32 3 ALA A 101 ? ? -147.25 -5.79 33 3 PRO A 133 ? ? -37.73 91.29 34 3 ILE A 136 ? ? 167.16 -53.17 35 4 GLU A 23 ? ? 42.94 86.64 36 4 SER A 25 ? ? -51.84 106.83 37 4 SER A 27 ? ? -54.45 90.38 38 4 ASP A 28 ? ? -166.64 -52.11 39 4 GLN A 37 ? ? 77.83 55.22 40 4 ASN A 58 ? ? 81.59 52.23 41 4 PHE A 87 ? ? -90.27 -61.90 42 4 VAL A 93 ? ? -99.93 -67.16 43 4 MET A 100 ? ? -64.14 73.83 44 4 ALA A 101 ? ? -171.27 -50.68 45 4 PRO A 112 ? ? -17.85 -59.75 46 4 TYR A 115 ? ? -55.96 95.96 47 4 PRO A 132 ? ? -70.62 -164.01 48 4 PRO A 133 ? ? -56.20 2.38 49 5 SER A 27 ? ? 69.25 -66.62 50 5 ASN A 55 ? ? -117.93 58.98 51 5 ASN A 58 ? ? 72.02 44.08 52 5 ASN A 62 ? ? -77.49 47.01 53 5 MET A 71 ? ? -96.18 36.63 54 5 VAL A 93 ? ? -126.06 -61.46 55 5 ASN A 99 ? ? -68.51 85.25 56 5 MET A 100 ? ? -64.55 79.71 57 5 ALA A 101 ? ? 179.83 -80.47 58 5 PRO A 133 ? ? -33.26 91.26 59 6 ASP A 3 ? ? 69.15 104.35 60 6 TYR A 26 ? ? -69.49 86.96 61 6 SER A 27 ? ? 57.29 19.18 62 6 ASP A 28 ? ? -92.15 -109.82 63 6 ASN A 55 ? ? -103.57 75.84 64 6 ASN A 56 ? ? -167.57 -22.63 65 6 MET A 71 ? ? -87.39 38.34 66 6 PHE A 87 ? ? -106.22 -76.21 67 6 VAL A 93 ? ? -100.83 -86.04 68 6 SER A 94 ? ? -167.06 110.25 69 6 MET A 100 ? ? 34.71 -78.69 70 6 PRO A 133 ? ? -12.72 -72.65 71 6 LEU A 134 ? ? -148.01 43.68 72 7 GLU A 23 ? ? -170.06 135.98 73 7 ASP A 28 ? ? 70.76 -8.20 74 7 TYR A 38 ? ? 72.96 55.15 75 7 ASN A 55 ? ? -112.43 64.22 76 7 ASN A 58 ? ? 111.84 3.59 77 7 MET A 71 ? ? -86.28 37.62 78 7 PHE A 87 ? ? -109.22 -66.97 79 7 SER A 94 ? ? 172.15 130.08 80 7 MET A 100 ? ? 67.08 -82.43 81 7 ALA A 101 ? ? -143.64 -75.55 82 7 TYR A 115 ? ? -58.07 100.23 83 7 PHE A 125 ? ? -89.53 37.24 84 7 PRO A 133 ? ? -62.59 92.17 85 7 LEU A 134 ? ? 49.85 72.46 86 8 ASP A 3 ? ? -96.89 -75.29 87 8 LYS A 10 ? ? -66.72 99.73 88 8 LYS A 22 ? ? -171.10 147.27 89 8 SER A 25 ? ? -113.24 51.05 90 8 ASN A 56 ? ? -159.17 -45.45 91 8 ASN A 62 ? ? -80.97 46.55 92 8 MET A 71 ? ? -92.00 37.37 93 8 SER A 94 ? ? 177.82 121.51 94 8 ALA A 101 ? ? -175.29 -56.22 95 8 PRO A 133 ? ? -68.71 91.66 96 8 ILE A 136 ? ? 160.27 -52.81 97 9 LYS A 11 ? ? -48.45 104.48 98 9 ASP A 29 ? ? -76.20 -72.46 99 9 TRP A 53 ? ? -171.87 136.48 100 9 ASN A 56 ? ? -143.06 -7.29 101 9 ASN A 58 ? ? -141.55 -38.65 102 9 GLN A 60 ? ? -157.89 50.61 103 9 ASN A 62 ? ? -92.79 45.54 104 9 PHE A 87 ? ? -114.82 -71.30 105 9 SER A 94 ? ? -171.98 113.63 106 9 MET A 100 ? ? 63.98 -58.91 107 9 ALA A 101 ? ? -173.86 -72.55 108 9 PRO A 133 ? ? -64.15 99.51 109 10 ILE A 19 ? ? -105.56 54.50 110 10 GLU A 23 ? ? -146.25 20.28 111 10 SER A 25 ? ? -93.47 52.82 112 10 SER A 27 ? ? 177.11 -47.57 113 10 GLN A 35 ? ? -76.29 44.63 114 10 SER A 36 ? ? -92.45 57.59 115 10 GLN A 37 ? ? 72.02 56.54 116 10 TYR A 38 ? ? 79.89 34.61 117 10 PRO A 47 ? ? -38.30 -36.58 118 10 TRP A 53 ? ? -171.87 141.59 119 10 ASN A 55 ? ? -106.82 62.44 120 10 ASN A 56 ? ? -158.26 87.17 121 10 GLU A 57 ? ? 42.09 27.83 122 10 ASN A 58 ? ? 74.29 48.30 123 10 GLN A 60 ? ? -68.72 53.06 124 10 MET A 71 ? ? -85.18 37.94 125 10 VAL A 93 ? ? -129.61 -56.92 126 10 SER A 94 ? ? -160.54 110.18 127 10 PRO A 112 ? ? -67.55 8.23 128 10 PRO A 133 ? ? -44.29 103.72 129 11 ASN A 21 ? ? 63.81 -0.19 130 11 TYR A 38 ? ? 70.88 55.52 131 11 PRO A 47 ? ? -48.24 -15.59 132 11 ASN A 56 ? ? -152.07 -2.88 133 11 MET A 71 ? ? -90.02 36.09 134 11 VAL A 93 ? ? -102.53 -72.86 135 11 SER A 94 ? ? -179.76 119.12 136 11 PRO A 133 ? ? -25.60 83.70 137 11 LEU A 134 ? ? 39.10 37.17 138 12 ASP A 3 ? ? -160.38 108.18 139 12 LYS A 22 ? ? -65.67 94.70 140 12 SER A 25 ? ? -108.07 72.96 141 12 GLN A 35 ? ? -82.45 32.10 142 12 TYR A 38 ? ? 81.93 55.80 143 12 PRO A 47 ? ? -58.24 -7.19 144 12 ASN A 55 ? ? -94.14 59.54 145 12 ASN A 58 ? ? -172.23 11.31 146 12 MET A 71 ? ? -100.10 -134.38 147 12 PHE A 87 ? ? -119.63 -75.23 148 12 MET A 100 ? ? -50.74 32.93 149 12 LEU A 131 ? ? -91.40 -60.15 150 12 ASN A 135 ? ? -62.42 -73.32 151 13 LYS A 14 ? ? -64.78 -90.41 152 13 ASN A 15 ? ? -118.75 73.29 153 13 ILE A 19 ? ? -109.39 54.04 154 13 GLU A 23 ? ? 48.14 115.70 155 13 ASP A 28 ? ? -74.12 44.60 156 13 ASP A 29 ? ? -110.34 -70.92 157 13 TYR A 38 ? ? 74.11 54.47 158 13 PRO A 47 ? ? -56.36 -3.05 159 13 TRP A 53 ? ? -172.81 144.52 160 13 ASN A 56 ? ? -166.79 -15.46 161 13 ASN A 58 ? ? -133.42 -63.32 162 13 MET A 71 ? ? -99.32 36.97 163 13 SER A 94 ? ? 175.16 111.00 164 13 MET A 100 ? ? -45.32 -18.04 165 13 PHE A 125 ? ? -89.47 38.36 166 13 LEU A 131 ? ? -92.39 -63.97 167 13 PRO A 133 ? ? -44.01 106.33 168 14 ILE A 19 ? ? -63.41 92.94 169 14 ASN A 21 ? ? 57.00 19.19 170 14 ASP A 29 ? ? -48.27 -75.18 171 14 GLN A 37 ? ? 77.83 57.05 172 14 PRO A 47 ? ? -58.85 0.01 173 14 ASN A 56 ? ? -156.15 -17.29 174 14 ASN A 58 ? ? -135.87 -52.98 175 14 GLN A 60 ? ? -140.43 33.65 176 14 ASN A 62 ? ? -104.74 45.93 177 14 TRP A 70 ? ? -81.54 41.48 178 14 SER A 73 ? ? 76.90 31.14 179 14 VAL A 93 ? ? -130.41 -78.70 180 14 MET A 100 ? ? -64.20 8.62 181 14 ALA A 101 ? ? -140.31 31.92 182 15 LYS A 8 ? ? -64.68 90.70 183 15 LYS A 22 ? ? -95.94 -68.97 184 15 TYR A 38 ? ? 72.57 55.08 185 15 PRO A 47 ? ? -65.19 4.30 186 15 TRP A 53 ? ? -172.71 142.86 187 15 ASN A 55 ? ? -115.38 58.53 188 15 GLU A 57 ? ? 52.38 18.34 189 15 ASN A 58 ? ? -149.87 -22.77 190 15 GLN A 60 ? ? -98.47 40.37 191 15 MET A 71 ? ? -88.78 37.23 192 15 VAL A 93 ? ? -125.63 -62.41 193 15 LEU A 134 ? ? -120.35 -55.05 194 15 ASN A 135 ? ? 61.02 -79.72 195 16 SER A 25 ? ? -117.74 51.84 196 16 TYR A 38 ? ? 81.29 57.09 197 16 PRO A 47 ? ? -57.80 1.53 198 16 TRP A 53 ? ? -170.13 149.32 199 16 ASN A 56 ? ? -147.41 -42.48 200 16 ASN A 58 ? ? -141.07 -2.74 201 16 MET A 71 ? ? -89.23 37.04 202 16 PHE A 87 ? ? -109.14 -71.13 203 16 MET A 100 ? ? 54.35 -55.10 204 16 ALA A 101 ? ? -98.16 -65.73 205 16 PRO A 112 ? ? -62.12 3.55 206 16 TYR A 115 ? ? -56.70 95.83 207 16 LEU A 134 ? ? 58.16 92.40 208 16 ASN A 135 ? ? -129.76 -68.68 209 17 LYS A 10 ? ? -57.34 109.90 210 17 SER A 25 ? ? -55.29 108.73 211 17 SER A 27 ? ? 172.95 -38.50 212 17 PRO A 47 ? ? -24.62 -0.38 213 17 TYR A 52 ? ? -102.13 -72.28 214 17 ASN A 56 ? ? -156.85 -23.66 215 17 ASN A 58 ? ? -142.59 -31.85 216 17 ASN A 62 ? ? -79.56 49.20 217 17 MET A 71 ? ? -83.70 37.27 218 17 PRO A 75 ? ? -76.93 38.99 219 18 LYS A 11 ? ? -76.22 44.64 220 18 SER A 25 ? ? -115.58 51.14 221 18 SER A 27 ? ? -166.58 -45.79 222 18 PRO A 47 ? ? -54.08 4.53 223 18 GLU A 57 ? ? 47.19 16.36 224 18 ASN A 58 ? ? -155.76 3.60 225 18 GLN A 60 ? ? -150.56 81.27 226 18 MET A 71 ? ? -88.82 37.67 227 18 VAL A 93 ? ? -81.69 -73.05 228 18 SER A 94 ? ? -165.36 110.78 229 18 MET A 100 ? ? -65.32 93.22 230 18 ALA A 101 ? ? 179.99 -64.11 231 18 TYR A 115 ? ? -61.03 89.30 232 18 PRO A 133 ? ? -22.46 -61.03 233 18 LEU A 134 ? ? -140.60 28.60 234 19 LYS A 10 ? ? -57.11 109.39 235 19 LYS A 22 ? ? -128.91 -77.31 236 19 SER A 27 ? ? -166.58 -26.17 237 19 ASP A 29 ? ? -132.12 -78.29 238 19 PRO A 47 ? ? -27.45 4.43 239 19 ASN A 56 ? ? -160.40 -12.41 240 19 ASN A 62 ? ? -90.12 45.28 241 19 MET A 71 ? ? -93.91 36.62 242 19 PHE A 87 ? ? -109.01 -76.31 243 19 SER A 94 ? ? 80.77 137.02 244 19 ALA A 101 ? ? -92.21 -71.73 245 19 LEU A 134 ? ? -161.90 83.99 246 20 LYS A 10 ? ? -45.81 100.41 247 20 LYS A 14 ? ? -76.83 -79.61 248 20 ASN A 15 ? ? -115.01 73.40 249 20 TYR A 38 ? ? 72.40 54.70 250 20 PRO A 47 ? ? -56.63 0.10 251 20 ASN A 56 ? ? -160.94 -36.27 252 20 ASN A 58 ? ? -134.34 -42.72 253 20 GLN A 60 ? ? -114.90 62.01 254 20 ASN A 62 ? ? -87.39 47.29 255 20 MET A 71 ? ? -92.72 38.95 256 20 VAL A 93 ? ? -76.43 -75.90 257 20 SER A 94 ? ? -166.19 111.27 258 20 ASN A 99 ? ? -69.48 94.52 259 20 PHE A 125 ? ? -86.38 30.21 260 20 PRO A 133 ? ? -37.97 94.64 # _pdbx_nmr_ensemble.entry_id 6YRR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6YRR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM [U-99% 13C; U-99% 15N] profilin, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '15N/13C sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component profilin _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 TROSY 1 isotropic 2 1 1 HNCACB 2 isotropic 3 1 1 HNCOCACB 2 isotropic 4 1 1 HNCA 2 isotropic 5 1 1 '3D NOESY-HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 6YRR _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.ordinal 1 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.authors 'Brunger A. T. et.al.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 700 ? # _atom_sites.entry_id 6YRR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_