data_6Z0G # _entry.id 6Z0G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Z0G pdb_00006z0g 10.2210/pdb6z0g/pdb WWPDB D_1292108637 ? ? BMRB 50263 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 50263 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6Z0G _pdbx_database_status.recvd_initial_deposition_date 2020-05-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Steiner, A.' 1 ? 'Schlepkow, K.' 2 ? 'Brunner, B.' 3 ? 'Steiner, H.' 4 ? 'Haass, C.' 5 ? 'Hagn, F.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Embo J.' _citation.journal_id_ASTM EMJODG _citation.journal_id_CSD 0897 _citation.journal_id_ISSN 1460-2075 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 39 _citation.language ? _citation.page_first e104247 _citation.page_last e104247 _citation.title 'gamma-Secretase cleavage of the Alzheimer risk factor TREM2 is determined by its intrinsic structural dynamics.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.15252/embj.2019104247 _citation.pdbx_database_id_PubMed 32830336 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Steiner, A.' 1 ? primary 'Schlepckow, K.' 2 ? primary 'Brunner, B.' 3 ? primary 'Steiner, H.' 4 ? primary 'Haass, C.' 5 0000-0002-4869-1627 primary 'Hagn, F.' 6 0000-0002-1315-459X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Triggering receptor expressed on myeloid cells 2' _entity.formula_weight 5172.119 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TREM-2,Triggering receptor expressed on monocytes 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSGRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTH _entity_poly.pdbx_seq_one_letter_code_can GSGRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 ARG n 1 5 SER n 1 6 LEU n 1 7 LEU n 1 8 GLU n 1 9 GLY n 1 10 GLU n 1 11 ILE n 1 12 PRO n 1 13 PHE n 1 14 PRO n 1 15 PRO n 1 16 THR n 1 17 SER n 1 18 ILE n 1 19 LEU n 1 20 LEU n 1 21 LEU n 1 22 LEU n 1 23 ALA n 1 24 CYS n 1 25 ILE n 1 26 PHE n 1 27 LEU n 1 28 ILE n 1 29 LYS n 1 30 ILE n 1 31 LEU n 1 32 ALA n 1 33 ALA n 1 34 SER n 1 35 ALA n 1 36 LEU n 1 37 TRP n 1 38 ALA n 1 39 ALA n 1 40 ALA n 1 41 TRP n 1 42 HIS n 1 43 GLY n 1 44 GLN n 1 45 LYS n 1 46 PRO n 1 47 GLY n 1 48 THR n 1 49 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 49 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TREM2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TREM2_HUMAN _struct_ref.pdbx_db_accession Q9NZC2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTH _struct_ref.pdbx_align_begin 161 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Z0G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NZC2 _struct_ref_seq.db_align_beg 161 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 206 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Z0G GLY A 1 ? UNP Q9NZC2 ? ? 'expression tag' -2 1 1 6Z0G SER A 2 ? UNP Q9NZC2 ? ? 'expression tag' -1 2 1 6Z0G GLY A 3 ? UNP Q9NZC2 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 2D-HSQC 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D HN(CO)CA' 1 isotropic 6 1 1 3D-15N-NOESY 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '500 uM U-2H, U-15N, U-13C TREM2-TMH, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label TREM2-TMHwt _pdbx_nmr_sample_details.type micelle _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 950 ? # _pdbx_nmr_refine.entry_id 6Z0G _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # _pdbx_nmr_ensemble.entry_id 6Z0G _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6Z0G _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 'chemical shift assignment' Sparky ? Goddard 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'peak picking' Sparky ? Goddard 5 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 6 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 7 'data analysis' TALOS ? 'Cornilescu, Delaglio and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Z0G _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6Z0G _struct.title 'Structure of TREM2 transmembrane helix in DPC micelles' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Z0G _struct_keywords.text 'neurodegeneration, proteolysis, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? GLY A 9 ? SER A 2 GLY A 6 5 ? 5 HELX_P HELX_P2 AA2 PRO A 14 ? ALA A 33 ? PRO A 11 ALA A 30 1 ? 20 HELX_P HELX_P3 AA3 ALA A 33 ? HIS A 42 ? ALA A 30 HIS A 39 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6Z0G _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 GLY 3 0 ? ? ? A . n A 1 4 ARG 4 1 1 ARG ARG A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 LEU 6 3 3 LEU LEU A . n A 1 7 LEU 7 4 4 LEU LEU A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 GLY 9 6 6 GLY GLY A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 ILE 11 8 8 ILE ILE A . n A 1 12 PRO 12 9 9 PRO PRO A . n A 1 13 PHE 13 10 10 PHE PHE A . n A 1 14 PRO 14 11 11 PRO PRO A . n A 1 15 PRO 15 12 12 PRO PRO A . n A 1 16 THR 16 13 13 THR THR A . n A 1 17 SER 17 14 14 SER SER A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 CYS 24 21 21 CYS CYS A . n A 1 25 ILE 25 22 22 ILE ILE A . n A 1 26 PHE 26 23 23 PHE PHE A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 ILE 28 25 25 ILE ILE A . n A 1 29 LYS 29 26 26 LYS LYS A . n A 1 30 ILE 30 27 27 ILE ILE A . n A 1 31 LEU 31 28 28 LEU LEU A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 ALA 33 30 30 ALA ALA A . n A 1 34 SER 34 31 31 SER SER A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 LEU 36 33 33 LEU LEU A . n A 1 37 TRP 37 34 34 TRP TRP A . n A 1 38 ALA 38 35 35 ALA ALA A . n A 1 39 ALA 39 36 36 ALA ALA A . n A 1 40 ALA 40 37 37 ALA ALA A . n A 1 41 TRP 41 38 38 TRP TRP A . n A 1 42 HIS 42 39 39 HIS HIS A . n A 1 43 GLY 43 40 40 GLY GLY A . n A 1 44 GLN 44 41 41 GLN GLN A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 PRO 46 43 43 PRO PRO A . n A 1 47 GLY 47 44 44 GLY GLY A . n A 1 48 THR 48 45 45 THR THR A . n A 1 49 HIS 49 46 46 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4960 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-16 2 'Structure model' 1 1 2020-10-28 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component TREM2-TMH _pdbx_nmr_exptl_sample.concentration 500 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling 'U-2H, U-15N, U-13C' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 9 ? ? -58.16 96.89 2 1 PHE A 10 ? ? 56.38 82.58 3 2 PRO A 9 ? ? -48.90 99.86 4 2 PHE A 10 ? ? 56.86 84.98 5 2 ALA A 30 ? ? -169.60 -39.36 6 3 PRO A 9 ? ? -56.76 92.38 7 3 ALA A 30 ? ? 57.94 11.47 8 4 PRO A 11 ? ? -41.46 95.86 9 5 SER A 2 ? ? 58.93 111.35 10 6 PRO A 9 ? ? -58.13 91.39 11 6 PRO A 11 ? ? -43.26 99.08 12 6 ALA A 30 ? ? -146.96 39.79 13 7 PRO A 43 ? ? -79.38 -167.96 14 8 PRO A 9 ? ? -69.26 89.56 15 10 PHE A 10 ? ? 57.62 89.63 16 11 PRO A 9 ? ? -59.77 89.85 17 11 ALA A 30 ? ? 173.62 -24.30 18 11 GLN A 41 ? ? 62.00 103.77 19 11 LYS A 42 ? ? 62.02 72.22 20 12 PRO A 9 ? ? -54.11 96.98 21 12 LYS A 42 ? ? 52.22 74.81 22 12 PRO A 43 ? ? -46.93 97.93 23 13 ALA A 30 ? ? -108.74 40.29 24 14 PHE A 10 ? ? 58.09 95.32 25 15 PHE A 10 ? ? 58.49 166.01 26 15 ALA A 30 ? ? 172.79 86.75 27 16 PRO A 9 ? ? -47.26 97.43 28 16 GLN A 41 ? ? 54.73 95.27 29 17 ALA A 30 ? ? 50.15 19.44 30 17 PRO A 43 ? ? -91.36 35.53 31 18 SER A 2 ? ? 60.99 -84.12 32 18 PRO A 9 ? ? -55.39 97.21 33 18 PHE A 10 ? ? 56.04 85.17 34 18 ALA A 30 ? ? -173.40 -36.16 35 19 ALA A 30 ? ? 78.74 -22.43 36 20 ALA A 30 ? ? -89.42 34.73 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A GLY 0 ? A GLY 3 4 2 Y 1 A GLY -2 ? A GLY 1 5 2 Y 1 A SER -1 ? A SER 2 6 2 Y 1 A GLY 0 ? A GLY 3 7 3 Y 1 A GLY -2 ? A GLY 1 8 3 Y 1 A SER -1 ? A SER 2 9 3 Y 1 A GLY 0 ? A GLY 3 10 4 Y 1 A GLY -2 ? A GLY 1 11 4 Y 1 A SER -1 ? A SER 2 12 4 Y 1 A GLY 0 ? A GLY 3 13 5 Y 1 A GLY -2 ? A GLY 1 14 5 Y 1 A SER -1 ? A SER 2 15 5 Y 1 A GLY 0 ? A GLY 3 16 6 Y 1 A GLY -2 ? A GLY 1 17 6 Y 1 A SER -1 ? A SER 2 18 6 Y 1 A GLY 0 ? A GLY 3 19 7 Y 1 A GLY -2 ? A GLY 1 20 7 Y 1 A SER -1 ? A SER 2 21 7 Y 1 A GLY 0 ? A GLY 3 22 8 Y 1 A GLY -2 ? A GLY 1 23 8 Y 1 A SER -1 ? A SER 2 24 8 Y 1 A GLY 0 ? A GLY 3 25 9 Y 1 A GLY -2 ? A GLY 1 26 9 Y 1 A SER -1 ? A SER 2 27 9 Y 1 A GLY 0 ? A GLY 3 28 10 Y 1 A GLY -2 ? A GLY 1 29 10 Y 1 A SER -1 ? A SER 2 30 10 Y 1 A GLY 0 ? A GLY 3 31 11 Y 1 A GLY -2 ? A GLY 1 32 11 Y 1 A SER -1 ? A SER 2 33 11 Y 1 A GLY 0 ? A GLY 3 34 12 Y 1 A GLY -2 ? A GLY 1 35 12 Y 1 A SER -1 ? A SER 2 36 12 Y 1 A GLY 0 ? A GLY 3 37 13 Y 1 A GLY -2 ? A GLY 1 38 13 Y 1 A SER -1 ? A SER 2 39 13 Y 1 A GLY 0 ? A GLY 3 40 14 Y 1 A GLY -2 ? A GLY 1 41 14 Y 1 A SER -1 ? A SER 2 42 14 Y 1 A GLY 0 ? A GLY 3 43 15 Y 1 A GLY -2 ? A GLY 1 44 15 Y 1 A SER -1 ? A SER 2 45 15 Y 1 A GLY 0 ? A GLY 3 46 16 Y 1 A GLY -2 ? A GLY 1 47 16 Y 1 A SER -1 ? A SER 2 48 16 Y 1 A GLY 0 ? A GLY 3 49 17 Y 1 A GLY -2 ? A GLY 1 50 17 Y 1 A SER -1 ? A SER 2 51 17 Y 1 A GLY 0 ? A GLY 3 52 18 Y 1 A GLY -2 ? A GLY 1 53 18 Y 1 A SER -1 ? A SER 2 54 18 Y 1 A GLY 0 ? A GLY 3 55 19 Y 1 A GLY -2 ? A GLY 1 56 19 Y 1 A SER -1 ? A SER 2 57 19 Y 1 A GLY 0 ? A GLY 3 58 20 Y 1 A GLY -2 ? A GLY 1 59 20 Y 1 A SER -1 ? A SER 2 60 20 Y 1 A GLY 0 ? A GLY 3 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Helmholtz Association' Germany VG-NG-1039 1 'European Communitys Seventh Framework Programme' 'European Union' 291763 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #