data_6Z29 # _entry.id 6Z29 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Z29 pdb_00006z29 10.2210/pdb6z29/pdb WWPDB D_1292108487 ? ? BMRB 34517 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Structure of eIF4G1 (37-49) - PUB1 RRM3 chimera in solution' _pdbx_database_related.db_id 34517 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6Z29 _pdbx_database_status.recvd_initial_deposition_date 2020-05-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chaves-Arquero, B.' 1 0000-0002-2761-2336 'Martinez-Lumbreras, S.' 2 0000-0002-8617-0566 'Perez-Canadillas, J.M.' 3 0000-0002-8266-5502 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Mol Biosci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2296-889X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 986121 _citation.page_last 986121 _citation.title 'eIF4G1 N-terminal intrinsically disordered domain is a multi-docking station for RNA, Pab1, Pub1, and self-assembly.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fmolb.2022.986121 _citation.pdbx_database_id_PubMed 36213119 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chaves-Arquero, B.' 1 ? primary 'Martinez-Lumbreras, S.' 2 ? primary 'Sibille, N.' 3 ? primary 'Camero, S.' 4 ? primary 'Bernado, P.' 5 ? primary 'Jimenez, M.A.' 6 ? primary 'Zorrilla, S.' 7 ? primary 'Perez-Canadillas, J.M.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Eukaryotic initiation factor 4F subunit p150,Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1' _entity.formula_weight 13031.693 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;eIF4F p150,eIF4G1,mRNA cap-binding protein complex subunit p150,ARS consensus-binding protein ACBP-60,Poly uridylate-binding protein,Poly(U)-binding protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGYTNYNNGSNYTQKKQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGC CFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGYTNYNNGSNYTQKKQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGC CFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 TYR n 1 5 THR n 1 6 ASN n 1 7 TYR n 1 8 ASN n 1 9 ASN n 1 10 GLY n 1 11 SER n 1 12 ASN n 1 13 TYR n 1 14 THR n 1 15 GLN n 1 16 LYS n 1 17 LYS n 1 18 GLN n 1 19 THR n 1 20 ILE n 1 21 GLY n 1 22 LEU n 1 23 PRO n 1 24 PRO n 1 25 GLN n 1 26 VAL n 1 27 ASN n 1 28 PRO n 1 29 GLN n 1 30 ALA n 1 31 VAL n 1 32 ASP n 1 33 HIS n 1 34 ILE n 1 35 ILE n 1 36 ARG n 1 37 SER n 1 38 ALA n 1 39 PRO n 1 40 PRO n 1 41 ARG n 1 42 VAL n 1 43 THR n 1 44 THR n 1 45 ALA n 1 46 TYR n 1 47 ILE n 1 48 GLY n 1 49 ASN n 1 50 ILE n 1 51 PRO n 1 52 HIS n 1 53 PHE n 1 54 ALA n 1 55 THR n 1 56 GLU n 1 57 ALA n 1 58 ASP n 1 59 LEU n 1 60 ILE n 1 61 PRO n 1 62 LEU n 1 63 PHE n 1 64 GLN n 1 65 ASN n 1 66 PHE n 1 67 GLY n 1 68 PHE n 1 69 ILE n 1 70 LEU n 1 71 ASP n 1 72 PHE n 1 73 LYS n 1 74 HIS n 1 75 TYR n 1 76 PRO n 1 77 GLU n 1 78 LYS n 1 79 GLY n 1 80 CYS n 1 81 CYS n 1 82 PHE n 1 83 ILE n 1 84 LYS n 1 85 TYR n 1 86 ASP n 1 87 THR n 1 88 HIS n 1 89 GLU n 1 90 GLN n 1 91 ALA n 1 92 ALA n 1 93 VAL n 1 94 CYS n 1 95 ILE n 1 96 VAL n 1 97 ALA n 1 98 LEU n 1 99 ALA n 1 100 ASN n 1 101 PHE n 1 102 PRO n 1 103 PHE n 1 104 GLN n 1 105 GLY n 1 106 ARG n 1 107 ASN n 1 108 LEU n 1 109 ARG n 1 110 THR n 1 111 GLY n 1 112 TRP n 1 113 GLY n 1 114 LYS n 1 115 GLU n 1 116 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 17 ? ? 'TIF4631, YGR162W' ? ? ? ? ? ? 'Saccharomyces cerevisiae S288C' 559292 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 18 116 ? ? 'PUB1, RNP1, YNL016W, N2842' ? ? ? ? ? ? 'Saccharomyces cerevisiae S288C' 559292 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP IF4F1_YEAST P39935 ? 1 GYTNYNNGSNYTQKK 35 2 UNP PUB1_YEAST P32588 ? 1 ;QTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVA LANFPFQGRNLRTGWGKER ; 316 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6Z29 A 3 ? 17 ? P39935 35 ? 49 ? 301 315 2 2 6Z29 A 18 ? 116 ? P32588 316 ? 414 ? 316 414 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Z29 GLY A 1 ? UNP P39935 ? ? 'expression tag' 299 1 1 6Z29 SER A 2 ? UNP P39935 ? ? 'expression tag' 300 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 3 3 '2D 1H-15N HSQC' 1 isotropic 2 3 3 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 3 3 '3D HNCO' 1 isotropic 4 3 3 '3D HNCA' 1 isotropic 6 3 3 '3D CBCA(CO)NH' 1 isotropic 9 1 1 '2D 1H-1H NOESY' 1 isotropic 10 2 2 '2D 1H-1H NOESY' 1 isotropic 11 1 1 '2D 1H-1H TOCSY' 1 isotropic 12 2 2 '2D 1H-1H TOCSY' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 301.2 atm 1 5.0 0.050 ? ? M conditions1 ? pH ? ? K 2 301.2 atm 1 5.0 0.050 ? ? M conditions2 ? pH ? ? K 3 301.2 atm 1 5.0 0.050 ? ? M condicions3 ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '250 uM eIF4G1(37-49)/PUB1(RRM3) Chimera, 25 mM potassium phosphate, 25 mM sodium chloride, 0.1 mM DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' H2O solution ? 2 '250 uM eIF4G1(37-49)/PUB1(RRM3) Chimera, 25 mM potassium phosphate, 25 mM sodium chloride, 0.1 mM DTT, 100% D2O' '100% D2O' D2O solution ? 3 ;148 uM [U-13C; U-15N] eIF4G1(37-49)/PUB1(RRM3) Chimera, 25 mM potassium phosphate, 25 mM sodium chloride, 0.1 mM DTT, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N13C solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6Z29 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # _pdbx_nmr_ensemble.entry_id 6Z29 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6Z29 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 5 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Z29 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6Z29 _struct.title 'Structure of eIF4G1 (37-49) - PUB1 RRM3 chimera in solution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Z29 _struct_keywords.text 'Stress Granules, Translation Regulation, TRANSLATION' _struct_keywords.pdbx_keywords TRANSLATION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 28 ? ARG A 36 ? PRO A 326 ARG A 334 1 ? 9 HELX_P HELX_P2 AA2 THR A 55 ? GLY A 67 ? THR A 353 GLY A 365 1 ? 13 HELX_P HELX_P3 AA3 THR A 87 ? LEU A 98 ? THR A 385 LEU A 396 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6Z29 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 299 299 GLY GLY A . n A 1 2 SER 2 300 300 SER SER A . n A 1 3 GLY 3 301 301 GLY GLY A . n A 1 4 TYR 4 302 302 TYR TYR A . n A 1 5 THR 5 303 303 THR THR A . n A 1 6 ASN 6 304 304 ASN ASN A . n A 1 7 TYR 7 305 305 TYR TYR A . n A 1 8 ASN 8 306 306 ASN ASN A . n A 1 9 ASN 9 307 307 ASN ASN A . n A 1 10 GLY 10 308 308 GLY GLY A . n A 1 11 SER 11 309 309 SER SER A . n A 1 12 ASN 12 310 310 ASN ASN A . n A 1 13 TYR 13 311 311 TYR TYR A . n A 1 14 THR 14 312 312 THR THR A . n A 1 15 GLN 15 313 313 GLN GLN A . n A 1 16 LYS 16 314 314 LYS LYS A . n A 1 17 LYS 17 315 315 LYS LYS A . n A 1 18 GLN 18 316 316 GLN GLN A . n A 1 19 THR 19 317 317 THR THR A . n A 1 20 ILE 20 318 318 ILE ILE A . n A 1 21 GLY 21 319 319 GLY GLY A . n A 1 22 LEU 22 320 320 LEU LEU A . n A 1 23 PRO 23 321 321 PRO PRO A . n A 1 24 PRO 24 322 322 PRO PRO A . n A 1 25 GLN 25 323 323 GLN GLN A . n A 1 26 VAL 26 324 324 VAL VAL A . n A 1 27 ASN 27 325 325 ASN ASN A . n A 1 28 PRO 28 326 326 PRO PRO A . n A 1 29 GLN 29 327 327 GLN GLN A . n A 1 30 ALA 30 328 328 ALA ALA A . n A 1 31 VAL 31 329 329 VAL VAL A . n A 1 32 ASP 32 330 330 ASP ASP A . n A 1 33 HIS 33 331 331 HIS HIS A . n A 1 34 ILE 34 332 332 ILE ILE A . n A 1 35 ILE 35 333 333 ILE ILE A . n A 1 36 ARG 36 334 334 ARG ARG A . n A 1 37 SER 37 335 335 SER SER A . n A 1 38 ALA 38 336 336 ALA ALA A . n A 1 39 PRO 39 337 337 PRO PRO A . n A 1 40 PRO 40 338 338 PRO PRO A . n A 1 41 ARG 41 339 339 ARG ARG A . n A 1 42 VAL 42 340 340 VAL VAL A . n A 1 43 THR 43 341 341 THR THR A . n A 1 44 THR 44 342 342 THR THR A . n A 1 45 ALA 45 343 343 ALA ALA A . n A 1 46 TYR 46 344 344 TYR TYR A . n A 1 47 ILE 47 345 345 ILE ILE A . n A 1 48 GLY 48 346 346 GLY GLY A . n A 1 49 ASN 49 347 347 ASN ASN A . n A 1 50 ILE 50 348 348 ILE ILE A . n A 1 51 PRO 51 349 349 PRO PRO A . n A 1 52 HIS 52 350 350 HIS HIS A . n A 1 53 PHE 53 351 351 PHE PHE A . n A 1 54 ALA 54 352 352 ALA ALA A . n A 1 55 THR 55 353 353 THR THR A . n A 1 56 GLU 56 354 354 GLU GLU A . n A 1 57 ALA 57 355 355 ALA ALA A . n A 1 58 ASP 58 356 356 ASP ASP A . n A 1 59 LEU 59 357 357 LEU LEU A . n A 1 60 ILE 60 358 358 ILE ILE A . n A 1 61 PRO 61 359 359 PRO PRO A . n A 1 62 LEU 62 360 360 LEU LEU A . n A 1 63 PHE 63 361 361 PHE PHE A . n A 1 64 GLN 64 362 362 GLN GLN A . n A 1 65 ASN 65 363 363 ASN ASN A . n A 1 66 PHE 66 364 364 PHE PHE A . n A 1 67 GLY 67 365 365 GLY GLY A . n A 1 68 PHE 68 366 366 PHE PHE A . n A 1 69 ILE 69 367 367 ILE ILE A . n A 1 70 LEU 70 368 368 LEU LEU A . n A 1 71 ASP 71 369 369 ASP ASP A . n A 1 72 PHE 72 370 370 PHE PHE A . n A 1 73 LYS 73 371 371 LYS LYS A . n A 1 74 HIS 74 372 372 HIS HIS A . n A 1 75 TYR 75 373 373 TYR TYR A . n A 1 76 PRO 76 374 374 PRO PRO A . n A 1 77 GLU 77 375 375 GLU GLU A . n A 1 78 LYS 78 376 376 LYS LYS A . n A 1 79 GLY 79 377 377 GLY GLY A . n A 1 80 CYS 80 378 378 CYS CYS A . n A 1 81 CYS 81 379 379 CYS CYS A . n A 1 82 PHE 82 380 380 PHE PHE A . n A 1 83 ILE 83 381 381 ILE ILE A . n A 1 84 LYS 84 382 382 LYS LYS A . n A 1 85 TYR 85 383 383 TYR TYR A . n A 1 86 ASP 86 384 384 ASP ASP A . n A 1 87 THR 87 385 385 THR THR A . n A 1 88 HIS 88 386 386 HIS HIS A . n A 1 89 GLU 89 387 387 GLU GLU A . n A 1 90 GLN 90 388 388 GLN GLN A . n A 1 91 ALA 91 389 389 ALA ALA A . n A 1 92 ALA 92 390 390 ALA ALA A . n A 1 93 VAL 93 391 391 VAL VAL A . n A 1 94 CYS 94 392 392 CYS CYS A . n A 1 95 ILE 95 393 393 ILE ILE A . n A 1 96 VAL 96 394 394 VAL VAL A . n A 1 97 ALA 97 395 395 ALA ALA A . n A 1 98 LEU 98 396 396 LEU LEU A . n A 1 99 ALA 99 397 397 ALA ALA A . n A 1 100 ASN 100 398 398 ASN ASN A . n A 1 101 PHE 101 399 399 PHE PHE A . n A 1 102 PRO 102 400 400 PRO PRO A . n A 1 103 PHE 103 401 401 PHE PHE A . n A 1 104 GLN 104 402 402 GLN GLN A . n A 1 105 GLY 105 403 403 GLY GLY A . n A 1 106 ARG 106 404 404 ARG ARG A . n A 1 107 ASN 107 405 405 ASN ASN A . n A 1 108 LEU 108 406 406 LEU LEU A . n A 1 109 ARG 109 407 407 ARG ARG A . n A 1 110 THR 110 408 408 THR THR A . n A 1 111 GLY 111 409 409 GLY GLY A . n A 1 112 TRP 112 410 410 TRP TRP A . n A 1 113 GLY 113 411 411 GLY GLY A . n A 1 114 LYS 114 412 412 LYS LYS A . n A 1 115 GLU 115 413 413 GLU GLU A . n A 1 116 ARG 116 414 414 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8280 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-26 2 'Structure model' 1 1 2022-12-07 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.name' 13 2 'Structure model' '_database_2.pdbx_DOI' 14 2 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'eIF4G1(37-49)/PUB1(RRM3) Chimera' 250 ? uM 'natural abundance' 1 'potassium phosphate' 25 ? mM 'natural abundance' 1 'sodium chloride' 25 ? mM 'natural abundance' 1 DTT 0.1 ? mM 'natural abundance' 2 'eIF4G1(37-49)/PUB1(RRM3) Chimera' 250 ? uM 'natural abundance' 2 'potassium phosphate' 25 ? mM 'natural abundance' 2 'sodium chloride' 25 ? mM 'natural abundance' 2 DTT 0.1 ? mM 'natural abundance' 3 'eIF4G1(37-49)/PUB1(RRM3) Chimera' 148 ? uM '[U-13C; U-15N]' 3 'potassium phosphate' 25 ? mM 'natural abundance' 3 'sodium chloride' 25 ? mM 'natural abundance' 3 DTT 0.1 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 303 ? ? -103.65 -61.59 2 1 ASN A 306 ? ? -122.38 -169.51 3 1 ASN A 310 ? ? -97.98 53.26 4 1 TYR A 311 ? ? -169.99 52.88 5 1 GLN A 313 ? ? 56.67 91.10 6 1 ILE A 318 ? ? 53.44 88.68 7 1 LEU A 320 ? ? -151.70 68.05 8 1 GLN A 323 ? ? -52.57 -73.00 9 1 ALA A 328 ? ? -93.14 31.11 10 1 VAL A 329 ? ? -135.09 -41.26 11 1 SER A 335 ? ? -50.58 -75.53 12 1 PRO A 338 ? ? -69.70 64.98 13 1 ARG A 339 ? ? -157.55 -62.74 14 1 ALA A 343 ? ? -79.00 -168.05 15 1 PHE A 351 ? ? -91.34 40.74 16 1 PRO A 359 ? ? -69.77 37.10 17 1 LEU A 360 ? ? -147.91 -53.84 18 1 ASP A 369 ? ? -152.82 55.46 19 1 GLU A 375 ? ? -94.34 35.19 20 1 LYS A 376 ? ? -156.11 -61.33 21 1 CYS A 378 ? ? -179.74 137.42 22 1 LEU A 396 ? ? -113.13 -75.36 23 1 ALA A 397 ? ? 43.90 85.85 24 1 PRO A 400 ? ? -69.69 97.62 25 1 PHE A 401 ? ? -94.36 -60.61 26 1 GLN A 402 ? ? -157.71 54.82 27 1 LEU A 406 ? ? -57.82 -174.93 28 1 LYS A 412 ? ? 63.33 101.54 29 2 SER A 300 ? ? -171.26 99.18 30 2 THR A 303 ? ? -135.43 -55.09 31 2 ASN A 304 ? ? 63.31 -169.61 32 2 ASN A 306 ? ? -179.46 102.73 33 2 ASN A 310 ? ? 56.61 -170.23 34 2 LYS A 314 ? ? -175.25 55.58 35 2 THR A 317 ? ? -160.25 102.93 36 2 ILE A 318 ? ? 60.55 99.75 37 2 VAL A 324 ? ? 63.81 158.24 38 2 GLN A 327 ? ? -93.84 34.41 39 2 SER A 335 ? ? -51.18 -75.78 40 2 PRO A 338 ? ? -69.76 65.05 41 2 ARG A 339 ? ? -155.62 -61.34 42 2 THR A 341 ? ? -153.51 20.14 43 2 ALA A 343 ? ? -61.16 -167.33 44 2 PHE A 351 ? ? -88.12 46.27 45 2 LYS A 371 ? ? -72.97 -75.08 46 2 HIS A 372 ? ? 58.69 88.30 47 2 LYS A 376 ? ? -121.91 -55.12 48 2 CYS A 378 ? ? -175.63 110.58 49 2 TYR A 383 ? ? -57.56 -176.20 50 2 GLN A 388 ? ? -121.35 -58.41 51 2 ALA A 397 ? ? 41.53 78.57 52 2 ASN A 398 ? ? 65.48 71.95 53 2 PRO A 400 ? ? -69.74 96.57 54 2 ARG A 404 ? ? -178.16 -176.04 55 2 LEU A 406 ? ? -91.75 -156.76 56 2 GLU A 413 ? ? -160.68 76.30 57 3 THR A 303 ? ? -166.58 -55.62 58 3 ASN A 306 ? ? -175.87 98.16 59 3 ASN A 307 ? ? -94.14 54.33 60 3 SER A 309 ? ? -171.08 110.83 61 3 ASN A 310 ? ? -63.17 95.61 62 3 TYR A 311 ? ? -128.43 -71.16 63 3 THR A 312 ? ? 51.34 -170.90 64 3 LYS A 314 ? ? 63.16 -169.85 65 3 LYS A 315 ? ? -58.46 -177.93 66 3 GLN A 316 ? ? 57.63 179.65 67 3 THR A 317 ? ? -59.85 178.84 68 3 LEU A 320 ? ? 49.00 73.55 69 3 PRO A 322 ? ? -69.72 78.57 70 3 GLN A 323 ? ? -51.74 -75.38 71 3 VAL A 324 ? ? -72.79 -76.93 72 3 GLN A 327 ? ? -91.74 41.31 73 3 ALA A 328 ? ? -136.56 -39.83 74 3 SER A 335 ? ? -89.48 45.24 75 3 ALA A 336 ? ? 179.71 150.03 76 3 PRO A 338 ? ? -69.85 67.09 77 3 ARG A 339 ? ? -169.77 -44.38 78 3 ALA A 343 ? ? -60.68 -169.29 79 3 ALA A 352 ? ? -178.45 86.45 80 3 ASP A 369 ? ? -155.75 75.06 81 3 TYR A 373 ? ? -157.49 76.41 82 3 LYS A 376 ? ? -104.32 -75.06 83 3 GLN A 388 ? ? -49.57 -70.85 84 3 LEU A 396 ? ? -114.07 -72.94 85 3 ALA A 397 ? ? 41.52 81.23 86 3 PHE A 401 ? ? -91.04 -68.97 87 3 GLN A 402 ? ? -151.65 57.61 88 3 ARG A 404 ? ? -113.28 -169.53 89 3 LEU A 406 ? ? -102.32 -162.55 90 3 TRP A 410 ? ? 61.57 160.33 91 4 SER A 300 ? ? 57.16 -173.44 92 4 TYR A 302 ? ? -148.77 -55.80 93 4 TYR A 305 ? ? 72.38 -68.99 94 4 ASN A 307 ? ? -51.74 104.34 95 4 TYR A 311 ? ? -155.84 66.12 96 4 THR A 312 ? ? -57.60 178.14 97 4 GLN A 313 ? ? -52.81 -71.01 98 4 LYS A 314 ? ? 58.03 95.50 99 4 GLN A 323 ? ? 179.24 -35.49 100 4 ASN A 325 ? ? -49.70 108.54 101 4 PRO A 338 ? ? -69.76 64.48 102 4 ARG A 339 ? ? -167.19 -39.29 103 4 VAL A 340 ? ? -68.42 86.42 104 4 THR A 342 ? ? -51.38 106.66 105 4 ALA A 343 ? ? -60.98 -168.44 106 4 TYR A 344 ? ? -169.81 113.93 107 4 ALA A 352 ? ? -148.76 -59.82 108 4 THR A 353 ? ? 70.15 155.51 109 4 ASP A 369 ? ? -156.39 65.06 110 4 GLU A 375 ? ? -150.61 45.74 111 4 CYS A 378 ? ? -174.45 112.51 112 4 GLN A 388 ? ? -50.57 -75.34 113 4 LEU A 396 ? ? -109.84 -63.47 114 4 ALA A 397 ? ? 39.63 70.39 115 4 ASN A 398 ? ? 65.17 62.72 116 4 PRO A 400 ? ? -69.75 98.79 117 4 LEU A 406 ? ? -126.64 -163.41 118 4 GLU A 413 ? ? 60.12 92.88 119 5 TYR A 302 ? ? -153.58 53.58 120 5 ASN A 306 ? ? 63.70 157.27 121 5 ASN A 307 ? ? -179.74 116.92 122 5 SER A 309 ? ? -109.06 65.54 123 5 TYR A 311 ? ? 54.49 76.09 124 5 GLN A 313 ? ? -140.51 56.10 125 5 LYS A 314 ? ? -156.43 47.12 126 5 GLN A 316 ? ? -160.68 53.20 127 5 ILE A 318 ? ? -150.50 47.38 128 5 PRO A 322 ? ? -69.79 97.90 129 5 GLN A 323 ? ? -138.27 -66.07 130 5 GLN A 327 ? ? -93.98 33.57 131 5 SER A 335 ? ? -51.60 -75.18 132 5 ALA A 343 ? ? -67.32 -166.11 133 5 LEU A 368 ? ? -98.04 -67.41 134 5 LYS A 371 ? ? -165.03 103.05 135 5 TYR A 373 ? ? 51.23 79.44 136 5 LYS A 376 ? ? -90.04 -68.45 137 5 TYR A 383 ? ? -54.41 177.26 138 5 ALA A 397 ? ? 43.46 82.46 139 5 ASN A 398 ? ? 65.13 64.99 140 5 PRO A 400 ? ? -69.77 96.71 141 5 GLN A 402 ? ? -149.43 34.90 142 5 LEU A 406 ? ? -85.58 -158.66 143 6 THR A 303 ? ? -105.92 -72.93 144 6 TYR A 311 ? ? 56.29 91.70 145 6 LYS A 314 ? ? -172.77 48.21 146 6 ILE A 318 ? ? -160.49 -75.54 147 6 VAL A 324 ? ? 63.68 158.35 148 6 SER A 335 ? ? -52.42 -75.19 149 6 ALA A 343 ? ? -60.55 -169.17 150 6 TYR A 344 ? ? -165.71 114.91 151 6 PHE A 361 ? ? -143.61 -59.74 152 6 PHE A 364 ? ? -59.52 -72.61 153 6 TYR A 373 ? ? -113.78 74.18 154 6 CYS A 378 ? ? 179.88 146.60 155 6 ALA A 397 ? ? 39.42 79.05 156 6 ASN A 398 ? ? 65.17 73.56 157 6 PRO A 400 ? ? -69.84 97.59 158 6 GLN A 402 ? ? -158.01 36.66 159 6 LEU A 406 ? ? -89.69 -157.47 160 6 TRP A 410 ? ? 62.08 156.13 161 6 GLU A 413 ? ? 51.79 85.67 162 7 THR A 303 ? ? -177.91 -35.55 163 7 ASN A 306 ? ? 179.60 144.30 164 7 ASN A 310 ? ? -97.78 -69.97 165 7 GLN A 313 ? ? 61.71 81.52 166 7 LYS A 314 ? ? -139.47 -49.86 167 7 LYS A 315 ? ? 69.00 -75.65 168 7 GLN A 316 ? ? 56.81 78.54 169 7 GLN A 323 ? ? -171.36 -38.68 170 7 VAL A 329 ? ? -130.32 -39.41 171 7 SER A 335 ? ? -52.01 -76.32 172 7 ALA A 343 ? ? -61.37 -166.86 173 7 ASN A 347 ? ? 176.91 34.77 174 7 PHE A 351 ? ? -103.23 68.32 175 7 PHE A 361 ? ? -137.08 -61.29 176 7 HIS A 372 ? ? -178.84 134.46 177 7 TYR A 383 ? ? -48.95 164.05 178 7 LEU A 396 ? ? -111.29 -75.94 179 7 ALA A 397 ? ? 47.55 88.87 180 7 LEU A 406 ? ? -76.71 -169.22 181 7 GLU A 413 ? ? 62.92 81.84 182 8 THR A 303 ? ? 57.36 -174.29 183 8 SER A 309 ? ? -176.95 -36.41 184 8 ASN A 310 ? ? 63.12 82.81 185 8 TYR A 311 ? ? -178.49 -37.29 186 8 THR A 312 ? ? 63.42 74.69 187 8 GLN A 313 ? ? -148.03 41.99 188 8 LYS A 315 ? ? -175.88 107.59 189 8 GLN A 316 ? ? 55.60 90.89 190 8 THR A 317 ? ? -54.59 104.18 191 8 ILE A 318 ? ? 61.93 79.24 192 8 ALA A 328 ? ? -92.72 32.63 193 8 VAL A 329 ? ? -137.55 -42.80 194 8 SER A 335 ? ? -48.90 -71.27 195 8 PRO A 338 ? ? -69.80 63.91 196 8 ARG A 339 ? ? -173.54 36.23 197 8 THR A 342 ? ? -55.98 99.69 198 8 ALA A 343 ? ? -66.84 -169.76 199 8 TYR A 344 ? ? -172.89 120.98 200 8 PHE A 351 ? ? -91.66 40.81 201 8 PHE A 361 ? ? -152.19 -54.58 202 8 PHE A 364 ? ? -57.34 -71.63 203 8 ASP A 369 ? ? -132.65 -44.83 204 8 PHE A 370 ? ? 62.90 94.29 205 8 TYR A 373 ? ? -111.87 79.42 206 8 TYR A 383 ? ? -52.64 172.88 207 8 GLN A 388 ? ? -50.16 -70.31 208 8 ALA A 397 ? ? 57.46 -92.76 209 8 LEU A 406 ? ? -56.90 -176.43 210 9 TYR A 302 ? ? 57.70 94.81 211 9 ASN A 306 ? ? 64.26 156.27 212 9 ASN A 307 ? ? -174.72 105.21 213 9 SER A 309 ? ? -98.78 -66.33 214 9 ASN A 310 ? ? -153.74 -70.38 215 9 PRO A 322 ? ? -69.74 -178.77 216 9 SER A 335 ? ? -94.14 36.92 217 9 ALA A 336 ? ? 179.27 151.26 218 9 ALA A 343 ? ? -68.55 -168.52 219 9 TYR A 344 ? ? -176.55 111.21 220 9 ILE A 345 ? ? -95.71 -79.48 221 9 PRO A 349 ? ? -69.77 -175.95 222 9 ALA A 352 ? ? -138.25 -72.19 223 9 THR A 353 ? ? 71.89 152.28 224 9 PHE A 364 ? ? -60.69 -73.62 225 9 LEU A 368 ? ? -120.04 -60.53 226 9 TYR A 373 ? ? -112.57 77.53 227 9 LYS A 376 ? ? -105.23 -71.76 228 9 CYS A 378 ? ? 179.95 124.35 229 9 TYR A 383 ? ? -46.91 155.33 230 9 GLN A 388 ? ? -50.89 -71.08 231 9 ALA A 397 ? ? 41.61 82.69 232 9 ASN A 398 ? ? 66.48 62.72 233 9 PHE A 401 ? ? -103.57 77.99 234 9 LEU A 406 ? ? -115.06 -165.36 235 9 ARG A 407 ? ? -126.15 -166.92 236 10 ASN A 306 ? ? 65.84 157.67 237 10 ASN A 307 ? ? -176.76 111.38 238 10 SER A 309 ? ? 56.96 -172.69 239 10 TYR A 311 ? ? -175.46 70.45 240 10 THR A 312 ? ? 72.56 -68.68 241 10 GLN A 313 ? ? -170.15 -171.75 242 10 GLN A 316 ? ? -174.06 56.19 243 10 THR A 317 ? ? -161.18 34.93 244 10 ILE A 318 ? ? -178.40 139.78 245 10 LEU A 320 ? ? -118.99 68.92 246 10 PRO A 322 ? ? -69.76 -170.35 247 10 GLN A 323 ? ? 63.36 104.32 248 10 VAL A 324 ? ? 65.09 152.30 249 10 SER A 335 ? ? -52.13 -76.47 250 10 PRO A 338 ? ? -69.76 64.47 251 10 ARG A 339 ? ? -158.44 -52.50 252 10 ALA A 343 ? ? -63.42 -168.34 253 10 TYR A 344 ? ? -171.69 103.86 254 10 PHE A 351 ? ? -88.11 48.49 255 10 PRO A 359 ? ? -69.80 38.58 256 10 LEU A 360 ? ? -151.93 -43.20 257 10 PHE A 366 ? ? -161.87 -38.41 258 10 ILE A 367 ? ? 67.01 143.59 259 10 TYR A 373 ? ? -113.23 75.94 260 10 CYS A 378 ? ? -179.13 139.53 261 10 TYR A 383 ? ? -51.26 170.37 262 10 GLN A 388 ? ? -49.57 -74.44 263 10 LEU A 396 ? ? -109.38 -66.80 264 10 ALA A 397 ? ? 43.17 83.13 265 10 ASN A 398 ? ? 65.44 60.49 266 10 GLN A 402 ? ? -148.35 34.80 267 10 LEU A 406 ? ? -57.45 -174.80 268 10 GLU A 413 ? ? -162.97 -40.25 269 11 TYR A 302 ? ? -141.21 -57.96 270 11 THR A 303 ? ? 61.00 96.58 271 11 TYR A 305 ? ? -51.77 171.32 272 11 ASN A 306 ? ? -152.25 -77.22 273 11 ASN A 307 ? ? 176.09 143.79 274 11 ASN A 310 ? ? -123.10 -60.05 275 11 THR A 312 ? ? -126.30 -57.07 276 11 PRO A 322 ? ? -69.73 -170.19 277 11 GLN A 323 ? ? 69.37 -75.49 278 11 VAL A 329 ? ? -132.55 -41.92 279 11 SER A 335 ? ? -50.32 -75.58 280 11 PRO A 338 ? ? -69.72 65.09 281 11 ARG A 339 ? ? -154.78 -49.63 282 11 PHE A 351 ? ? -92.10 40.67 283 11 PHE A 364 ? ? -61.55 -72.20 284 11 PHE A 366 ? ? -153.85 -58.37 285 11 ILE A 367 ? ? 66.37 156.07 286 11 LEU A 368 ? ? -142.71 -54.56 287 11 ASP A 369 ? ? -88.90 -75.67 288 11 PHE A 370 ? ? 66.54 139.60 289 11 GLU A 375 ? ? -50.18 -74.98 290 11 TYR A 383 ? ? -48.25 163.98 291 11 LEU A 396 ? ? -112.47 -73.15 292 11 ALA A 397 ? ? 47.48 87.44 293 11 PHE A 401 ? ? -110.15 75.59 294 11 LEU A 406 ? ? -57.29 -175.93 295 11 LYS A 412 ? ? -165.64 117.91 296 12 TYR A 302 ? ? 59.79 179.27 297 12 THR A 303 ? ? -140.89 -43.71 298 12 ASN A 304 ? ? -60.55 -168.86 299 12 THR A 312 ? ? 51.41 -170.96 300 12 LYS A 315 ? ? -84.93 -74.84 301 12 PRO A 322 ? ? -69.74 -171.51 302 12 ASN A 325 ? ? -48.66 107.73 303 12 PRO A 338 ? ? -69.76 66.36 304 12 ARG A 339 ? ? -179.72 36.08 305 12 THR A 342 ? ? -56.16 104.27 306 12 ALA A 343 ? ? -60.10 -169.88 307 12 TYR A 344 ? ? -178.58 114.12 308 12 ILE A 345 ? ? -96.03 -78.90 309 12 PHE A 351 ? ? -90.89 41.45 310 12 PHE A 364 ? ? -60.30 -71.61 311 12 LEU A 368 ? ? -96.79 -61.09 312 12 HIS A 372 ? ? -175.93 144.63 313 12 TYR A 383 ? ? -57.49 -176.44 314 12 GLU A 387 ? ? -92.00 33.50 315 12 GLN A 388 ? ? -129.19 -59.44 316 12 LEU A 396 ? ? -108.48 -67.45 317 12 ALA A 397 ? ? 41.70 83.24 318 12 GLN A 402 ? ? -155.12 46.99 319 12 LEU A 406 ? ? -57.31 -175.28 320 12 GLU A 413 ? ? 62.27 174.47 321 13 THR A 303 ? ? 57.64 77.94 322 13 ASN A 307 ? ? 67.20 143.10 323 13 SER A 309 ? ? -174.02 40.44 324 13 ASN A 310 ? ? -138.92 -74.03 325 13 GLN A 313 ? ? 58.35 95.94 326 13 LYS A 315 ? ? -163.18 92.76 327 13 GLN A 323 ? ? -149.35 -74.86 328 13 SER A 335 ? ? -51.61 -75.48 329 13 PRO A 338 ? ? -69.77 64.88 330 13 ARG A 339 ? ? -166.69 -51.71 331 13 THR A 342 ? ? -54.48 101.56 332 13 ALA A 343 ? ? -60.01 -169.78 333 13 TYR A 344 ? ? -176.00 127.79 334 13 PHE A 351 ? ? -91.02 41.15 335 13 LYS A 376 ? ? -179.87 103.15 336 13 TYR A 383 ? ? -51.37 170.14 337 13 GLN A 388 ? ? -49.25 -72.11 338 13 LEU A 396 ? ? -104.89 -64.96 339 13 ALA A 397 ? ? 34.65 85.98 340 13 PHE A 401 ? ? -107.82 60.57 341 13 GLN A 402 ? ? 70.98 35.39 342 13 ARG A 404 ? ? -141.18 -49.28 343 13 ASN A 405 ? ? 62.34 90.71 344 13 LEU A 406 ? ? -56.65 -176.59 345 13 THR A 408 ? ? 49.13 -174.62 346 14 ASN A 304 ? ? 59.81 -170.97 347 14 ASN A 306 ? ? 179.95 130.46 348 14 TYR A 311 ? ? -168.16 89.59 349 14 LYS A 314 ? ? -66.32 99.96 350 14 GLN A 316 ? ? -69.72 95.13 351 14 PRO A 322 ? ? -69.73 -171.81 352 14 VAL A 324 ? ? 64.67 154.12 353 14 ASN A 325 ? ? -50.51 108.69 354 14 PRO A 338 ? ? -69.76 64.72 355 14 ARG A 339 ? ? -164.95 -48.11 356 14 THR A 342 ? ? -58.81 105.90 357 14 ALA A 343 ? ? -60.73 -168.79 358 14 TYR A 344 ? ? -167.34 95.55 359 14 GLU A 354 ? ? 77.00 -50.02 360 14 LEU A 368 ? ? -103.92 -61.36 361 14 GLU A 375 ? ? -108.45 63.98 362 14 LYS A 376 ? ? -179.35 101.25 363 14 TYR A 383 ? ? -49.54 164.36 364 14 ALA A 397 ? ? 42.80 76.09 365 14 ASN A 398 ? ? 66.49 72.46 366 14 GLN A 402 ? ? -161.83 63.44 367 14 LEU A 406 ? ? -114.88 -161.04 368 14 LYS A 412 ? ? 62.27 164.82 369 15 TYR A 302 ? ? 59.80 77.22 370 15 ASN A 304 ? ? 58.51 178.09 371 15 TYR A 305 ? ? -123.33 -69.29 372 15 ASN A 306 ? ? 64.08 156.03 373 15 TYR A 311 ? ? -157.97 39.85 374 15 GLN A 313 ? ? -156.55 35.91 375 15 GLN A 316 ? ? 62.05 94.99 376 15 THR A 317 ? ? 64.54 148.56 377 15 PRO A 322 ? ? -69.78 93.24 378 15 GLN A 323 ? ? -136.89 -68.38 379 15 ASN A 325 ? ? -50.24 108.29 380 15 SER A 335 ? ? -89.86 43.50 381 15 ALA A 336 ? ? 179.35 149.99 382 15 PRO A 338 ? ? -69.75 66.71 383 15 ARG A 339 ? ? -170.36 -44.76 384 15 VAL A 340 ? ? -50.73 105.52 385 15 THR A 342 ? ? -56.33 102.77 386 15 ALA A 343 ? ? -61.18 -166.18 387 15 TYR A 344 ? ? -169.76 114.14 388 15 PHE A 351 ? ? -87.99 49.20 389 15 PHE A 364 ? ? -59.95 -70.95 390 15 TYR A 373 ? ? 63.48 157.08 391 15 LYS A 376 ? ? 58.34 97.13 392 15 TYR A 383 ? ? -49.84 161.34 393 15 ALA A 397 ? ? 41.43 81.35 394 15 PRO A 400 ? ? -69.77 94.92 395 15 LEU A 406 ? ? -120.93 -160.77 396 16 TYR A 302 ? ? 57.04 87.00 397 16 THR A 303 ? ? 65.59 114.29 398 16 ASN A 304 ? ? -150.91 35.89 399 16 ASN A 307 ? ? -163.80 -42.08 400 16 ASN A 310 ? ? -165.22 86.84 401 16 TYR A 311 ? ? 59.50 87.88 402 16 GLN A 313 ? ? -153.22 36.50 403 16 LYS A 314 ? ? -167.05 114.02 404 16 LYS A 315 ? ? -162.42 41.08 405 16 LEU A 320 ? ? 60.08 73.07 406 16 PRO A 322 ? ? -69.69 80.47 407 16 VAL A 324 ? ? 50.32 -169.94 408 16 SER A 335 ? ? -52.05 -75.29 409 16 PRO A 338 ? ? -69.77 64.72 410 16 ARG A 339 ? ? -167.21 -48.79 411 16 ALA A 343 ? ? -72.14 -167.88 412 16 TYR A 344 ? ? -164.15 117.49 413 16 ASN A 347 ? ? 60.13 62.71 414 16 PHE A 351 ? ? -87.48 47.61 415 16 PHE A 366 ? ? -144.40 -43.81 416 16 ILE A 367 ? ? 66.20 139.03 417 16 GLU A 375 ? ? -154.47 73.78 418 16 CYS A 378 ? ? 179.75 142.26 419 16 TYR A 383 ? ? -49.12 161.08 420 16 GLN A 388 ? ? -47.95 -73.36 421 16 LEU A 396 ? ? -115.25 -71.14 422 16 ALA A 397 ? ? 47.48 82.06 423 16 LEU A 406 ? ? -120.28 -163.32 424 17 TYR A 302 ? ? -145.96 -57.04 425 17 TYR A 305 ? ? -110.54 -169.59 426 17 ILE A 318 ? ? 61.24 88.69 427 17 GLN A 323 ? ? -161.26 -55.30 428 17 VAL A 324 ? ? -63.71 -179.93 429 17 GLN A 327 ? ? -93.60 33.43 430 17 SER A 335 ? ? -49.77 -74.07 431 17 PRO A 338 ? ? -69.71 64.10 432 17 ARG A 339 ? ? -151.91 -53.74 433 17 ALA A 352 ? ? -150.32 89.12 434 17 PHE A 364 ? ? -62.83 -71.09 435 17 ILE A 367 ? ? 63.84 117.03 436 17 LYS A 371 ? ? -49.96 -76.99 437 17 HIS A 372 ? ? 59.51 86.43 438 17 GLU A 375 ? ? -147.05 47.60 439 17 GLN A 388 ? ? -49.57 -71.11 440 17 ALA A 397 ? ? 41.45 73.49 441 17 ASN A 398 ? ? 67.63 64.43 442 17 PRO A 400 ? ? -69.73 97.84 443 17 GLN A 402 ? ? -142.76 34.34 444 17 LEU A 406 ? ? -63.06 -160.35 445 17 TRP A 410 ? ? 59.90 165.65 446 17 GLU A 413 ? ? 62.60 165.64 447 18 TYR A 302 ? ? -109.73 51.08 448 18 THR A 303 ? ? -178.72 -36.58 449 18 ASN A 306 ? ? 64.16 158.19 450 18 SER A 309 ? ? 69.52 -75.52 451 18 ASN A 310 ? ? -92.20 44.76 452 18 TYR A 311 ? ? -179.27 95.83 453 18 GLN A 313 ? ? -87.51 -73.83 454 18 PRO A 322 ? ? -69.74 81.18 455 18 GLN A 323 ? ? -138.75 -74.48 456 18 VAL A 329 ? ? -131.69 -39.44 457 18 SER A 335 ? ? -93.08 33.90 458 18 ALA A 336 ? ? 178.17 151.09 459 18 ALA A 343 ? ? -69.00 -167.55 460 18 TYR A 344 ? ? -175.32 116.07 461 18 ILE A 345 ? ? -97.66 -79.72 462 18 PHE A 351 ? ? -89.04 48.68 463 18 PHE A 366 ? ? -129.81 -167.60 464 18 ILE A 367 ? ? -171.18 -34.67 465 18 LEU A 368 ? ? 65.42 -76.08 466 18 GLU A 375 ? ? -95.07 36.55 467 18 LYS A 376 ? ? -151.24 -66.57 468 18 CYS A 378 ? ? -179.96 115.95 469 18 TYR A 383 ? ? -61.45 -175.09 470 18 GLN A 388 ? ? -50.43 -72.78 471 18 LEU A 396 ? ? -111.06 -72.48 472 18 ALA A 397 ? ? 43.46 85.23 473 18 PHE A 401 ? ? -108.74 77.82 474 18 ARG A 407 ? ? -124.77 -167.21 475 18 LYS A 412 ? ? 55.39 91.26 476 19 TYR A 302 ? ? 52.76 84.86 477 19 ASN A 304 ? ? 62.38 103.07 478 19 TYR A 305 ? ? -51.65 171.46 479 19 SER A 309 ? ? -176.81 -42.44 480 19 TYR A 311 ? ? -96.95 50.57 481 19 THR A 312 ? ? 72.53 -68.72 482 19 LYS A 314 ? ? -148.42 48.50 483 19 GLN A 316 ? ? 56.58 87.80 484 19 SER A 335 ? ? -52.10 -75.90 485 19 PRO A 338 ? ? -69.78 64.50 486 19 ARG A 339 ? ? -166.49 -44.71 487 19 ALA A 343 ? ? -60.63 -167.78 488 19 ASN A 347 ? ? 174.51 35.26 489 19 PHE A 351 ? ? -105.14 78.41 490 19 PRO A 359 ? ? -69.73 5.05 491 19 PHE A 364 ? ? -60.26 -76.01 492 19 PHE A 366 ? ? -137.79 -40.87 493 19 ILE A 367 ? ? 64.84 115.15 494 19 ASP A 369 ? ? -174.42 122.35 495 19 PHE A 370 ? ? -61.30 -164.33 496 19 LYS A 371 ? ? -179.67 35.07 497 19 LYS A 376 ? ? -179.72 -36.24 498 19 TYR A 383 ? ? -51.82 171.45 499 19 GLN A 388 ? ? -49.07 -72.45 500 19 ALA A 397 ? ? 46.23 85.49 501 19 LEU A 406 ? ? -61.91 -164.69 502 19 TRP A 410 ? ? 62.05 154.83 503 20 TYR A 305 ? ? -52.12 171.75 504 20 ASN A 307 ? ? -166.12 -66.53 505 20 GLN A 313 ? ? -98.65 -73.62 506 20 LYS A 314 ? ? -153.95 -71.44 507 20 LYS A 315 ? ? -178.63 -35.70 508 20 GLN A 316 ? ? -171.20 -171.22 509 20 ALA A 328 ? ? -93.96 31.04 510 20 VAL A 329 ? ? -136.17 -40.94 511 20 PRO A 338 ? ? -69.75 64.44 512 20 ARG A 339 ? ? -164.29 -57.33 513 20 TYR A 344 ? ? -172.88 128.07 514 20 ASN A 347 ? ? 61.63 -89.87 515 20 ILE A 348 ? ? 60.56 130.95 516 20 PHE A 351 ? ? 178.78 39.08 517 20 PHE A 361 ? ? -134.28 -60.68 518 20 PHE A 364 ? ? -58.30 -71.56 519 20 ASP A 369 ? ? -113.73 -75.73 520 20 PHE A 370 ? ? 66.07 149.86 521 20 LYS A 376 ? ? -143.60 -46.64 522 20 CYS A 378 ? ? 177.52 134.33 523 20 TYR A 383 ? ? -47.37 160.68 524 20 ALA A 397 ? ? 43.50 83.79 525 20 PRO A 400 ? ? -69.76 99.15 526 20 LEU A 406 ? ? -110.95 -165.49 527 20 ARG A 407 ? ? -155.54 81.16 528 20 THR A 408 ? ? -52.42 173.19 # _pdbx_audit_support.funding_organization 'Ministry of Economy and Competitiveness (MINECO)' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number 'CTQ2018 84371' _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #