data_6Z3E
# 
_entry.id   6Z3E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6Z3E         pdb_00006z3e 10.2210/pdb6z3e/pdb 
WWPDB D_1292108811 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-12-01 
2 'Structure model' 1 1 2024-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' pdbx_initial_refinement_model 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6Z3E 
_pdbx_database_status.recvd_initial_deposition_date   2020-05-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Schwefel, D.' 1 0000-0002-2945-0908 
'Daumke, O.'   2 0000-0002-6190-1414 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Crystal structure of GDP-bound human GIMAP5' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schwefel, D.' 1 ? 
primary 'Daumke, O.'   2 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GTPase IMAP family member 5' 31139.219 1  ? ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'               24.305    1  ? ? ? ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"    443.201   1  ? ? ? ? 
4 water       nat water                         18.015    14 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Immune-associated nucleotide-binding protein 5,Immunity-associated nucleotide 4-like 1 protein,Immunity-associated nucleotide 5 protein,hIAN5,Immunity-associated protein 3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPMGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKTGTWNGRKV
LVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGG
QALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGAC
QEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPMGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKTGTWNGRKV
LVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGG
QALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGAC
QEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "GUANOSINE-5'-DIPHOSPHATE" GDP 
4 water                      HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   MET n 
1 4   GLY n 
1 5   GLY n 
1 6   PHE n 
1 7   GLN n 
1 8   ARG n 
1 9   GLY n 
1 10  LYS n 
1 11  TYR n 
1 12  GLY n 
1 13  THR n 
1 14  MET n 
1 15  ALA n 
1 16  GLU n 
1 17  GLY n 
1 18  ARG n 
1 19  SER n 
1 20  GLU n 
1 21  ASP n 
1 22  ASN n 
1 23  LEU n 
1 24  SER n 
1 25  ALA n 
1 26  THR n 
1 27  PRO n 
1 28  PRO n 
1 29  ALA n 
1 30  LEU n 
1 31  ARG n 
1 32  ILE n 
1 33  ILE n 
1 34  LEU n 
1 35  VAL n 
1 36  GLY n 
1 37  LYS n 
1 38  THR n 
1 39  GLY n 
1 40  CYS n 
1 41  GLY n 
1 42  LYS n 
1 43  SER n 
1 44  ALA n 
1 45  THR n 
1 46  GLY n 
1 47  ASN n 
1 48  SER n 
1 49  ILE n 
1 50  LEU n 
1 51  GLY n 
1 52  GLN n 
1 53  PRO n 
1 54  VAL n 
1 55  PHE n 
1 56  GLU n 
1 57  SER n 
1 58  LYS n 
1 59  LEU n 
1 60  ARG n 
1 61  ALA n 
1 62  GLN n 
1 63  SER n 
1 64  VAL n 
1 65  THR n 
1 66  ARG n 
1 67  THR n 
1 68  CYS n 
1 69  GLN n 
1 70  VAL n 
1 71  LYS n 
1 72  THR n 
1 73  GLY n 
1 74  THR n 
1 75  TRP n 
1 76  ASN n 
1 77  GLY n 
1 78  ARG n 
1 79  LYS n 
1 80  VAL n 
1 81  LEU n 
1 82  VAL n 
1 83  VAL n 
1 84  ASP n 
1 85  THR n 
1 86  PRO n 
1 87  SER n 
1 88  ILE n 
1 89  PHE n 
1 90  GLU n 
1 91  SER n 
1 92  GLN n 
1 93  ALA n 
1 94  ASP n 
1 95  THR n 
1 96  GLN n 
1 97  GLU n 
1 98  LEU n 
1 99  TYR n 
1 100 LYS n 
1 101 ASN n 
1 102 ILE n 
1 103 GLY n 
1 104 ASP n 
1 105 CYS n 
1 106 TYR n 
1 107 LEU n 
1 108 LEU n 
1 109 SER n 
1 110 ALA n 
1 111 PRO n 
1 112 GLY n 
1 113 PRO n 
1 114 HIS n 
1 115 VAL n 
1 116 LEU n 
1 117 LEU n 
1 118 LEU n 
1 119 VAL n 
1 120 ILE n 
1 121 GLN n 
1 122 LEU n 
1 123 GLY n 
1 124 ARG n 
1 125 PHE n 
1 126 THR n 
1 127 ALA n 
1 128 GLN n 
1 129 ASP n 
1 130 THR n 
1 131 VAL n 
1 132 ALA n 
1 133 ILE n 
1 134 ARG n 
1 135 LYS n 
1 136 VAL n 
1 137 LYS n 
1 138 GLU n 
1 139 VAL n 
1 140 PHE n 
1 141 GLY n 
1 142 THR n 
1 143 GLY n 
1 144 ALA n 
1 145 MET n 
1 146 ARG n 
1 147 HIS n 
1 148 VAL n 
1 149 VAL n 
1 150 ILE n 
1 151 LEU n 
1 152 PHE n 
1 153 THR n 
1 154 HIS n 
1 155 LYS n 
1 156 GLU n 
1 157 ASP n 
1 158 LEU n 
1 159 GLY n 
1 160 GLY n 
1 161 GLN n 
1 162 ALA n 
1 163 LEU n 
1 164 ASP n 
1 165 ASP n 
1 166 TYR n 
1 167 VAL n 
1 168 ALA n 
1 169 ASN n 
1 170 THR n 
1 171 ASP n 
1 172 ASN n 
1 173 CYS n 
1 174 SER n 
1 175 LEU n 
1 176 LYS n 
1 177 ASP n 
1 178 LEU n 
1 179 VAL n 
1 180 ARG n 
1 181 GLU n 
1 182 CYS n 
1 183 GLU n 
1 184 ARG n 
1 185 ARG n 
1 186 TYR n 
1 187 CYS n 
1 188 ALA n 
1 189 PHE n 
1 190 ASN n 
1 191 ASN n 
1 192 TRP n 
1 193 GLY n 
1 194 SER n 
1 195 VAL n 
1 196 GLU n 
1 197 GLU n 
1 198 GLN n 
1 199 ARG n 
1 200 GLN n 
1 201 GLN n 
1 202 GLN n 
1 203 ALA n 
1 204 GLU n 
1 205 LEU n 
1 206 LEU n 
1 207 ALA n 
1 208 VAL n 
1 209 ILE n 
1 210 GLU n 
1 211 ARG n 
1 212 LEU n 
1 213 GLY n 
1 214 ARG n 
1 215 GLU n 
1 216 ARG n 
1 217 GLU n 
1 218 GLY n 
1 219 SER n 
1 220 PHE n 
1 221 HIS n 
1 222 SER n 
1 223 ASN n 
1 224 ASP n 
1 225 LEU n 
1 226 PHE n 
1 227 LEU n 
1 228 ASP n 
1 229 ALA n 
1 230 GLN n 
1 231 LEU n 
1 232 LEU n 
1 233 GLN n 
1 234 ARG n 
1 235 THR n 
1 236 GLY n 
1 237 ALA n 
1 238 GLY n 
1 239 ALA n 
1 240 CYS n 
1 241 GLN n 
1 242 GLU n 
1 243 ASP n 
1 244 TYR n 
1 245 ARG n 
1 246 GLN n 
1 247 TYR n 
1 248 GLN n 
1 249 ALA n 
1 250 LYS n 
1 251 VAL n 
1 252 GLU n 
1 253 TRP n 
1 254 GLN n 
1 255 VAL n 
1 256 GLU n 
1 257 LYS n 
1 258 HIS n 
1 259 LYS n 
1 260 GLN n 
1 261 GLU n 
1 262 LEU n 
1 263 ARG n 
1 264 GLU n 
1 265 ASN n 
1 266 GLU n 
1 267 SER n 
1 268 ASN n 
1 269 TRP n 
1 270 ALA n 
1 271 TYR n 
1 272 LYS n 
1 273 ALA n 
1 274 LEU n 
1 275 LEU n 
1 276 ARG n 
1 277 VAL n 
1 278 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   278 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GIMAP5, IAN4L1, IAN5, IMAP3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   PRO 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   GLY 4   2   ?   ?   ?   A . n 
A 1 5   GLY 5   3   ?   ?   ?   A . n 
A 1 6   PHE 6   4   ?   ?   ?   A . n 
A 1 7   GLN 7   5   ?   ?   ?   A . n 
A 1 8   ARG 8   6   ?   ?   ?   A . n 
A 1 9   GLY 9   7   ?   ?   ?   A . n 
A 1 10  LYS 10  8   ?   ?   ?   A . n 
A 1 11  TYR 11  9   ?   ?   ?   A . n 
A 1 12  GLY 12  10  ?   ?   ?   A . n 
A 1 13  THR 13  11  ?   ?   ?   A . n 
A 1 14  MET 14  12  ?   ?   ?   A . n 
A 1 15  ALA 15  13  ?   ?   ?   A . n 
A 1 16  GLU 16  14  ?   ?   ?   A . n 
A 1 17  GLY 17  15  ?   ?   ?   A . n 
A 1 18  ARG 18  16  ?   ?   ?   A . n 
A 1 19  SER 19  17  ?   ?   ?   A . n 
A 1 20  GLU 20  18  ?   ?   ?   A . n 
A 1 21  ASP 21  19  ?   ?   ?   A . n 
A 1 22  ASN 22  20  ?   ?   ?   A . n 
A 1 23  LEU 23  21  ?   ?   ?   A . n 
A 1 24  SER 24  22  ?   ?   ?   A . n 
A 1 25  ALA 25  23  ?   ?   ?   A . n 
A 1 26  THR 26  24  ?   ?   ?   A . n 
A 1 27  PRO 27  25  ?   ?   ?   A . n 
A 1 28  PRO 28  26  ?   ?   ?   A . n 
A 1 29  ALA 29  27  27  ALA ALA A . n 
A 1 30  LEU 30  28  28  LEU LEU A . n 
A 1 31  ARG 31  29  29  ARG ARG A . n 
A 1 32  ILE 32  30  30  ILE ILE A . n 
A 1 33  ILE 33  31  31  ILE ILE A . n 
A 1 34  LEU 34  32  32  LEU LEU A . n 
A 1 35  VAL 35  33  33  VAL VAL A . n 
A 1 36  GLY 36  34  34  GLY GLY A . n 
A 1 37  LYS 37  35  35  LYS LYS A . n 
A 1 38  THR 38  36  36  THR THR A . n 
A 1 39  GLY 39  37  37  GLY GLY A . n 
A 1 40  CYS 40  38  38  CYS CYS A . n 
A 1 41  GLY 41  39  39  GLY GLY A . n 
A 1 42  LYS 42  40  40  LYS LYS A . n 
A 1 43  SER 43  41  41  SER SER A . n 
A 1 44  ALA 44  42  42  ALA ALA A . n 
A 1 45  THR 45  43  43  THR THR A . n 
A 1 46  GLY 46  44  44  GLY GLY A . n 
A 1 47  ASN 47  45  45  ASN ASN A . n 
A 1 48  SER 48  46  46  SER SER A . n 
A 1 49  ILE 49  47  47  ILE ILE A . n 
A 1 50  LEU 50  48  48  LEU LEU A . n 
A 1 51  GLY 51  49  49  GLY GLY A . n 
A 1 52  GLN 52  50  50  GLN GLN A . n 
A 1 53  PRO 53  51  51  PRO PRO A . n 
A 1 54  VAL 54  52  52  VAL VAL A . n 
A 1 55  PHE 55  53  53  PHE PHE A . n 
A 1 56  GLU 56  54  54  GLU GLU A . n 
A 1 57  SER 57  55  55  SER SER A . n 
A 1 58  LYS 58  56  56  LYS LYS A . n 
A 1 59  LEU 59  57  57  LEU LEU A . n 
A 1 60  ARG 60  58  58  ARG ARG A . n 
A 1 61  ALA 61  59  59  ALA ALA A . n 
A 1 62  GLN 62  60  60  GLN GLN A . n 
A 1 63  SER 63  61  61  SER SER A . n 
A 1 64  VAL 64  62  62  VAL VAL A . n 
A 1 65  THR 65  63  63  THR THR A . n 
A 1 66  ARG 66  64  64  ARG ARG A . n 
A 1 67  THR 67  65  65  THR THR A . n 
A 1 68  CYS 68  66  66  CYS CYS A . n 
A 1 69  GLN 69  67  67  GLN GLN A . n 
A 1 70  VAL 70  68  68  VAL VAL A . n 
A 1 71  LYS 71  69  69  LYS LYS A . n 
A 1 72  THR 72  70  70  THR THR A . n 
A 1 73  GLY 73  71  71  GLY GLY A . n 
A 1 74  THR 74  72  72  THR THR A . n 
A 1 75  TRP 75  73  73  TRP TRP A . n 
A 1 76  ASN 76  74  74  ASN ASN A . n 
A 1 77  GLY 77  75  75  GLY GLY A . n 
A 1 78  ARG 78  76  76  ARG ARG A . n 
A 1 79  LYS 79  77  77  LYS LYS A . n 
A 1 80  VAL 80  78  78  VAL VAL A . n 
A 1 81  LEU 81  79  79  LEU LEU A . n 
A 1 82  VAL 82  80  80  VAL VAL A . n 
A 1 83  VAL 83  81  81  VAL VAL A . n 
A 1 84  ASP 84  82  82  ASP ASP A . n 
A 1 85  THR 85  83  83  THR THR A . n 
A 1 86  PRO 86  84  84  PRO PRO A . n 
A 1 87  SER 87  85  85  SER SER A . n 
A 1 88  ILE 88  86  86  ILE ILE A . n 
A 1 89  PHE 89  87  87  PHE PHE A . n 
A 1 90  GLU 90  88  88  GLU GLU A . n 
A 1 91  SER 91  89  89  SER SER A . n 
A 1 92  GLN 92  90  90  GLN GLN A . n 
A 1 93  ALA 93  91  91  ALA ALA A . n 
A 1 94  ASP 94  92  92  ASP ASP A . n 
A 1 95  THR 95  93  93  THR THR A . n 
A 1 96  GLN 96  94  94  GLN GLN A . n 
A 1 97  GLU 97  95  95  GLU GLU A . n 
A 1 98  LEU 98  96  96  LEU LEU A . n 
A 1 99  TYR 99  97  97  TYR TYR A . n 
A 1 100 LYS 100 98  98  LYS LYS A . n 
A 1 101 ASN 101 99  99  ASN ASN A . n 
A 1 102 ILE 102 100 100 ILE ILE A . n 
A 1 103 GLY 103 101 101 GLY GLY A . n 
A 1 104 ASP 104 102 102 ASP ASP A . n 
A 1 105 CYS 105 103 103 CYS CYS A . n 
A 1 106 TYR 106 104 104 TYR TYR A . n 
A 1 107 LEU 107 105 105 LEU LEU A . n 
A 1 108 LEU 108 106 106 LEU LEU A . n 
A 1 109 SER 109 107 107 SER SER A . n 
A 1 110 ALA 110 108 108 ALA ALA A . n 
A 1 111 PRO 111 109 109 PRO PRO A . n 
A 1 112 GLY 112 110 110 GLY GLY A . n 
A 1 113 PRO 113 111 111 PRO PRO A . n 
A 1 114 HIS 114 112 112 HIS HIS A . n 
A 1 115 VAL 115 113 113 VAL VAL A . n 
A 1 116 LEU 116 114 114 LEU LEU A . n 
A 1 117 LEU 117 115 115 LEU LEU A . n 
A 1 118 LEU 118 116 116 LEU LEU A . n 
A 1 119 VAL 119 117 117 VAL VAL A . n 
A 1 120 ILE 120 118 118 ILE ILE A . n 
A 1 121 GLN 121 119 119 GLN GLN A . n 
A 1 122 LEU 122 120 120 LEU LEU A . n 
A 1 123 GLY 123 121 121 GLY GLY A . n 
A 1 124 ARG 124 122 122 ARG ARG A . n 
A 1 125 PHE 125 123 123 PHE PHE A . n 
A 1 126 THR 126 124 124 THR THR A . n 
A 1 127 ALA 127 125 125 ALA ALA A . n 
A 1 128 GLN 128 126 126 GLN GLN A . n 
A 1 129 ASP 129 127 127 ASP ASP A . n 
A 1 130 THR 130 128 128 THR THR A . n 
A 1 131 VAL 131 129 129 VAL VAL A . n 
A 1 132 ALA 132 130 130 ALA ALA A . n 
A 1 133 ILE 133 131 131 ILE ILE A . n 
A 1 134 ARG 134 132 132 ARG ARG A . n 
A 1 135 LYS 135 133 133 LYS LYS A . n 
A 1 136 VAL 136 134 134 VAL VAL A . n 
A 1 137 LYS 137 135 135 LYS LYS A . n 
A 1 138 GLU 138 136 136 GLU GLU A . n 
A 1 139 VAL 139 137 137 VAL VAL A . n 
A 1 140 PHE 140 138 138 PHE PHE A . n 
A 1 141 GLY 141 139 139 GLY GLY A . n 
A 1 142 THR 142 140 140 THR THR A . n 
A 1 143 GLY 143 141 141 GLY GLY A . n 
A 1 144 ALA 144 142 142 ALA ALA A . n 
A 1 145 MET 145 143 143 MET MET A . n 
A 1 146 ARG 146 144 144 ARG ARG A . n 
A 1 147 HIS 147 145 145 HIS HIS A . n 
A 1 148 VAL 148 146 146 VAL VAL A . n 
A 1 149 VAL 149 147 147 VAL VAL A . n 
A 1 150 ILE 150 148 148 ILE ILE A . n 
A 1 151 LEU 151 149 149 LEU LEU A . n 
A 1 152 PHE 152 150 150 PHE PHE A . n 
A 1 153 THR 153 151 151 THR THR A . n 
A 1 154 HIS 154 152 152 HIS HIS A . n 
A 1 155 LYS 155 153 153 LYS LYS A . n 
A 1 156 GLU 156 154 154 GLU GLU A . n 
A 1 157 ASP 157 155 155 ASP ASP A . n 
A 1 158 LEU 158 156 156 LEU LEU A . n 
A 1 159 GLY 159 157 157 GLY GLY A . n 
A 1 160 GLY 160 158 158 GLY GLY A . n 
A 1 161 GLN 161 159 159 GLN GLN A . n 
A 1 162 ALA 162 160 160 ALA ALA A . n 
A 1 163 LEU 163 161 161 LEU LEU A . n 
A 1 164 ASP 164 162 162 ASP ASP A . n 
A 1 165 ASP 165 163 163 ASP ASP A . n 
A 1 166 TYR 166 164 164 TYR TYR A . n 
A 1 167 VAL 167 165 165 VAL VAL A . n 
A 1 168 ALA 168 166 166 ALA ALA A . n 
A 1 169 ASN 169 167 167 ASN ASN A . n 
A 1 170 THR 170 168 168 THR THR A . n 
A 1 171 ASP 171 169 169 ASP ASP A . n 
A 1 172 ASN 172 170 170 ASN ASN A . n 
A 1 173 CYS 173 171 171 CYS CYS A . n 
A 1 174 SER 174 172 172 SER SER A . n 
A 1 175 LEU 175 173 173 LEU LEU A . n 
A 1 176 LYS 176 174 174 LYS LYS A . n 
A 1 177 ASP 177 175 175 ASP ASP A . n 
A 1 178 LEU 178 176 176 LEU LEU A . n 
A 1 179 VAL 179 177 177 VAL VAL A . n 
A 1 180 ARG 180 178 178 ARG ARG A . n 
A 1 181 GLU 181 179 179 GLU GLU A . n 
A 1 182 CYS 182 180 180 CYS CYS A . n 
A 1 183 GLU 183 181 181 GLU GLU A . n 
A 1 184 ARG 184 182 182 ARG ARG A . n 
A 1 185 ARG 185 183 183 ARG ARG A . n 
A 1 186 TYR 186 184 184 TYR TYR A . n 
A 1 187 CYS 187 185 185 CYS CYS A . n 
A 1 188 ALA 188 186 186 ALA ALA A . n 
A 1 189 PHE 189 187 187 PHE PHE A . n 
A 1 190 ASN 190 188 188 ASN ASN A . n 
A 1 191 ASN 191 189 189 ASN ASN A . n 
A 1 192 TRP 192 190 190 TRP TRP A . n 
A 1 193 GLY 193 191 191 GLY GLY A . n 
A 1 194 SER 194 192 192 SER SER A . n 
A 1 195 VAL 195 193 193 VAL VAL A . n 
A 1 196 GLU 196 194 194 GLU GLU A . n 
A 1 197 GLU 197 195 195 GLU GLU A . n 
A 1 198 GLN 198 196 196 GLN GLN A . n 
A 1 199 ARG 199 197 197 ARG ARG A . n 
A 1 200 GLN 200 198 198 GLN GLN A . n 
A 1 201 GLN 201 199 199 GLN GLN A . n 
A 1 202 GLN 202 200 200 GLN GLN A . n 
A 1 203 ALA 203 201 201 ALA ALA A . n 
A 1 204 GLU 204 202 202 GLU GLU A . n 
A 1 205 LEU 205 203 203 LEU LEU A . n 
A 1 206 LEU 206 204 204 LEU LEU A . n 
A 1 207 ALA 207 205 205 ALA ALA A . n 
A 1 208 VAL 208 206 206 VAL VAL A . n 
A 1 209 ILE 209 207 207 ILE ILE A . n 
A 1 210 GLU 210 208 208 GLU GLU A . n 
A 1 211 ARG 211 209 209 ARG ARG A . n 
A 1 212 LEU 212 210 210 LEU LEU A . n 
A 1 213 GLY 213 211 211 GLY GLY A . n 
A 1 214 ARG 214 212 212 ARG ARG A . n 
A 1 215 GLU 215 213 213 GLU GLU A . n 
A 1 216 ARG 216 214 214 ARG ARG A . n 
A 1 217 GLU 217 215 215 GLU GLU A . n 
A 1 218 GLY 218 216 216 GLY GLY A . n 
A 1 219 SER 219 217 217 SER SER A . n 
A 1 220 PHE 220 218 218 PHE PHE A . n 
A 1 221 HIS 221 219 219 HIS HIS A . n 
A 1 222 SER 222 220 220 SER SER A . n 
A 1 223 ASN 223 221 221 ASN ASN A . n 
A 1 224 ASP 224 222 222 ASP ASP A . n 
A 1 225 LEU 225 223 223 LEU LEU A . n 
A 1 226 PHE 226 224 224 PHE PHE A . n 
A 1 227 LEU 227 225 225 LEU LEU A . n 
A 1 228 ASP 228 226 226 ASP ASP A . n 
A 1 229 ALA 229 227 227 ALA ALA A . n 
A 1 230 GLN 230 228 228 GLN GLN A . n 
A 1 231 LEU 231 229 229 LEU LEU A . n 
A 1 232 LEU 232 230 230 LEU LEU A . n 
A 1 233 GLN 233 231 231 GLN GLN A . n 
A 1 234 ARG 234 232 232 ARG ARG A . n 
A 1 235 THR 235 233 233 THR THR A . n 
A 1 236 GLY 236 234 234 GLY GLY A . n 
A 1 237 ALA 237 235 235 ALA ALA A . n 
A 1 238 GLY 238 236 236 GLY GLY A . n 
A 1 239 ALA 239 237 237 ALA ALA A . n 
A 1 240 CYS 240 238 238 CYS CYS A . n 
A 1 241 GLN 241 239 239 GLN GLN A . n 
A 1 242 GLU 242 240 240 GLU GLU A . n 
A 1 243 ASP 243 241 241 ASP ASP A . n 
A 1 244 TYR 244 242 242 TYR TYR A . n 
A 1 245 ARG 245 243 243 ARG ARG A . n 
A 1 246 GLN 246 244 244 GLN GLN A . n 
A 1 247 TYR 247 245 245 TYR TYR A . n 
A 1 248 GLN 248 246 246 GLN GLN A . n 
A 1 249 ALA 249 247 247 ALA ALA A . n 
A 1 250 LYS 250 248 248 LYS LYS A . n 
A 1 251 VAL 251 249 249 VAL VAL A . n 
A 1 252 GLU 252 250 250 GLU GLU A . n 
A 1 253 TRP 253 251 251 TRP TRP A . n 
A 1 254 GLN 254 252 252 GLN GLN A . n 
A 1 255 VAL 255 253 253 VAL VAL A . n 
A 1 256 GLU 256 254 254 GLU GLU A . n 
A 1 257 LYS 257 255 255 LYS LYS A . n 
A 1 258 HIS 258 256 256 HIS HIS A . n 
A 1 259 LYS 259 257 257 LYS LYS A . n 
A 1 260 GLN 260 258 258 GLN GLN A . n 
A 1 261 GLU 261 259 259 GLU GLU A . n 
A 1 262 LEU 262 260 260 LEU LEU A . n 
A 1 263 ARG 263 261 261 ARG ARG A . n 
A 1 264 GLU 264 262 262 GLU GLU A . n 
A 1 265 ASN 265 263 263 ASN ASN A . n 
A 1 266 GLU 266 264 ?   ?   ?   A . n 
A 1 267 SER 267 265 ?   ?   ?   A . n 
A 1 268 ASN 268 266 ?   ?   ?   A . n 
A 1 269 TRP 269 267 ?   ?   ?   A . n 
A 1 270 ALA 270 268 ?   ?   ?   A . n 
A 1 271 TYR 271 269 ?   ?   ?   A . n 
A 1 272 LYS 272 270 ?   ?   ?   A . n 
A 1 273 ALA 273 271 ?   ?   ?   A . n 
A 1 274 LEU 274 272 ?   ?   ?   A . n 
A 1 275 LEU 275 273 ?   ?   ?   A . n 
A 1 276 ARG 276 274 ?   ?   ?   A . n 
A 1 277 VAL 277 275 ?   ?   ?   A . n 
A 1 278 LYS 278 276 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  301 1  MG  MG  A . 
C 3 GDP 1  302 1  GDP GDP A . 
D 4 HOH 1  401 1  HOH HOH A . 
D 4 HOH 2  402 19 HOH HOH A . 
D 4 HOH 3  403 4  HOH HOH A . 
D 4 HOH 4  404 13 HOH HOH A . 
D 4 HOH 5  405 6  HOH HOH A . 
D 4 HOH 6  406 16 HOH HOH A . 
D 4 HOH 7  407 3  HOH HOH A . 
D 4 HOH 8  408 2  HOH HOH A . 
D 4 HOH 9  409 21 HOH HOH A . 
D 4 HOH 10 410 12 HOH HOH A . 
D 4 HOH 11 411 7  HOH HOH A . 
D 4 HOH 12 412 20 HOH HOH A . 
D 4 HOH 13 413 10 HOH HOH A . 
D 4 HOH 14 414 18 HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .         3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? .         4 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6Z3E 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     41.280 
_cell.length_a_esd                 ? 
_cell.length_b                     57.230 
_cell.length_b_esd                 ? 
_cell.length_c                     106.760 
_cell.length_c_esd                 ? 
_cell.volume                       252215.627 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6Z3E 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6Z3E 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.02 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         39.26 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;16% 2-propanol
50 mM ammonium acetate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-225' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2008-07-26 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_synchrotron_site       BESSY 
# 
_reflns.B_iso_Wilson_estimate            25.6825591945 
_reflns.entry_id                         6Z3E 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       6579 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.7 
_reflns.pdbx_Rmerge_I_obs                0.0166 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.37 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.9 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           595 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.475 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               27.7779106911 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6Z3E 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.80038678769 
_refine.ls_d_res_low                             39.0355231003 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     6579 
_refine.ls_number_reflns_R_free                  309 
_refine.ls_number_reflns_R_work                  6270 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.0514905149 
_refine.ls_percent_reflns_R_free                 4.6967624259 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.217666000947 
_refine.ls_R_factor_R_free                       0.268149989389 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.215153938036 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99501071312 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2xtp 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.3287354556 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.367330651165 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.80038678769 
_refine_hist.d_res_low                        39.0355231003 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               1915 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1872 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.00391852906709 ? 1966 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.819341518661   ? 2662 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0452000291228  ? 294  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0052578644946  ? 346  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.2906145126    ? 1630 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8004 2.9004 . . 31 595 95.865237366  . . . 0.389409300673 . 0.281011119735 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9004 3.0165 . . 32 603 98.9096573209 . . . 0.414787683567 . 0.259735350036 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0165 3.1538 . . 23 623 99.0797546012 . . . 0.261874424713 . 0.226378875194 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1538 3.32   . . 29 605 99.3730407524 . . . 0.309648180709 . 0.224105775997 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.32   3.5278 . . 27 623 99.0853658537 . . . 0.249402451446 . 0.230129136357 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5278 3.8    . . 29 633 99.5488721805 . . . 0.262066270501 . 0.202460228285 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8    4.182  . . 31 631 99.6987951807 . . . 0.283699716613 . 0.192669429453 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.182  4.7862 . . 25 635 100.0         . . . 0.219549530579 . 0.178472180032 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7862 6.0266 . . 37 641 99.5594713656 . . . 0.27517024657  . 0.2055956971   . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.0266 39     . . 45 681 99.316005472  . . . 0.204964808956 . 0.218593340949 . . . . . . . . . . . 
# 
_struct.entry_id                     6Z3E 
_struct.title                        'Crystal structure of GDP-bound human GIMAP5, amino acid residues 1-276' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6Z3E 
_struct_keywords.text            'GTPase, immunity, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GIMA5_HUMAN 
_struct_ref.pdbx_db_accession          Q96F15 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKTGTWNGRKVLV
VDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGGQA
LDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQE
DYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVK
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6Z3E 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 278 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96F15 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  276 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       276 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6Z3E GLY A 1 ? UNP Q96F15 ? ? 'expression tag' -1 1 
1 6Z3E PRO A 2 ? UNP Q96F15 ? ? 'expression tag' 0  2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 900   ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  12380 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 41  ? GLY A 51  ? GLY A 39  GLY A 49  1 ? 11 
HELX_P HELX_P2  AA2 THR A 95  ? ALA A 110 ? THR A 93  ALA A 108 1 ? 16 
HELX_P HELX_P3  AA3 THR A 126 ? GLY A 141 ? THR A 124 GLY A 139 1 ? 16 
HELX_P HELX_P4  AA4 GLY A 143 ? ARG A 146 ? GLY A 141 ARG A 144 5 ? 4  
HELX_P HELX_P5  AA5 HIS A 154 ? GLY A 159 ? HIS A 152 GLY A 157 5 ? 6  
HELX_P HELX_P6  AA6 ALA A 162 ? THR A 170 ? ALA A 160 THR A 168 1 ? 9  
HELX_P HELX_P7  AA7 ASN A 172 ? CYS A 182 ? ASN A 170 CYS A 180 1 ? 11 
HELX_P HELX_P8  AA8 SER A 194 ? ARG A 216 ? SER A 192 ARG A 214 1 ? 23 
HELX_P HELX_P9  AA9 ASN A 223 ? ARG A 234 ? ASN A 221 ARG A 232 1 ? 12 
HELX_P HELX_P10 AB1 ASP A 243 ? GLU A 264 ? ASP A 241 GLU A 262 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A SER 43 OG ? ? ? 1_555 B MG  . MG  ? ? A SER 41  A MG  301 1_555 ? ? ? ? ? ? ? 2.008 ? ? 
metalc2 metalc ? ? B MG  .  MG ? ? ? 1_555 C GDP . O3B ? ? A MG  301 A GDP 302 1_555 ? ? ? ? ? ? ? 1.994 ? ? 
metalc3 metalc ? ? B MG  .  MG ? ? ? 1_555 D HOH . O   ? ? A MG  301 A HOH 414 1_555 ? ? ? ? ? ? ? 2.835 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OG  ? A SER 43 ? A SER 41  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O3B ? C GDP . ? A GDP 302 ? 1_555 90.8  ? 
2 OG  ? A SER 43 ? A SER 41  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH . ? A HOH 414 ? 1_555 102.7 ? 
3 O3B ? C GDP .  ? A GDP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH . ? A HOH 414 ? 1_555 161.8 ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           110 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            108 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    111 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     109 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.85 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 69  ? TRP A 75  ? GLN A 67  TRP A 73  
AA1 2 ARG A 78  ? ASP A 84  ? ARG A 76  ASP A 82  
AA1 3 LEU A 30  ? VAL A 35  ? LEU A 28  VAL A 33  
AA1 4 VAL A 115 ? GLN A 121 ? VAL A 113 GLN A 119 
AA1 5 VAL A 148 ? THR A 153 ? VAL A 146 THR A 151 
AA1 6 TYR A 186 ? ALA A 188 ? TYR A 184 ALA A 186 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 69  ? N GLN A 67  O ASP A 84  ? O ASP A 82  
AA1 2 3 O LEU A 81  ? O LEU A 79  N LEU A 30  ? N LEU A 28  
AA1 3 4 N ILE A 33  ? N ILE A 31  O LEU A 117 ? O LEU A 115 
AA1 4 5 N LEU A 116 ? N LEU A 114 O VAL A 149 ? O VAL A 147 
AA1 5 6 N PHE A 152 ? N PHE A 150 O CYS A 187 ? O CYS A 185 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  301 ? 4  'binding site for residue MG A 301'  
AC2 Software A GDP 302 ? 16 'binding site for residue GDP A 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  SER A 43  ? SER A 41  . ? 1_555 ? 
2  AC1 4  GLU A 56  ? GLU A 54  . ? 1_555 ? 
3  AC1 4  GDP C .   ? GDP A 302 . ? 1_555 ? 
4  AC1 4  HOH D .   ? HOH A 414 . ? 1_555 ? 
5  AC2 16 LYS A 37  ? LYS A 35  . ? 1_555 ? 
6  AC2 16 THR A 38  ? THR A 36  . ? 1_555 ? 
7  AC2 16 GLY A 39  ? GLY A 37  . ? 1_555 ? 
8  AC2 16 GLY A 41  ? GLY A 39  . ? 1_555 ? 
9  AC2 16 LYS A 42  ? LYS A 40  . ? 1_555 ? 
10 AC2 16 SER A 43  ? SER A 41  . ? 1_555 ? 
11 AC2 16 ALA A 44  ? ALA A 42  . ? 1_555 ? 
12 AC2 16 SER A 57  ? SER A 55  . ? 1_555 ? 
13 AC2 16 LYS A 58  ? LYS A 56  . ? 1_555 ? 
14 AC2 16 LEU A 59  ? LEU A 57  . ? 1_555 ? 
15 AC2 16 HIS A 154 ? HIS A 152 . ? 1_555 ? 
16 AC2 16 GLU A 156 ? GLU A 154 . ? 1_555 ? 
17 AC2 16 PHE A 189 ? PHE A 187 . ? 1_555 ? 
18 AC2 16 ASN A 191 ? ASN A 189 . ? 1_555 ? 
19 AC2 16 TRP A 192 ? TRP A 190 . ? 1_555 ? 
20 AC2 16 MG  B .   ? MG  A 301 . ? 1_555 ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    175 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    178 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 58  ? ? -131.02 -30.48  
2 1 PRO A 84  ? ? -77.90  -166.40 
3 1 PHE A 87  ? ? -107.84 42.06   
4 1 ALA A 237 ? ? -130.95 -34.19  
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z           
2 x+1/2,-y+1/2,-z 
3 -x,y+1/2,-z+1/2 
4 -x+1/2,-y,z+1/2 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 16.1379746315 -0.422525822387 20.2385783104 0.0743948746959 ? -0.0442330329362 ? 0.0199916881337  
? 0.111127672982 ? -0.0647035802706  ? 0.137525752058 ? 1.99718763149  ? -0.45955894891 ? -0.326395904436 ? 1.96565076036 ? 
-0.313227252424 ? 3.76993722207  ? 0.0736453931312   ? 0.202625075066  ? -0.545254118038 ? -0.0311967522988 ? -0.111608369656 ? 
0.223239453879  ? 0.101731299695    ? 0.0383393919046  ? 0.0804478295307  ? 
2 'X-RAY DIFFRACTION' ? refined 20.2141514006 6.57250166985   19.5580336896 0.142905455349  ? 0.0114459315262  ? 0.00238510510979 
? 0.165791898676 ? 0.00663014105619  ? 0.173488004479 ? 1.77797892228  ? 0.48951618693  ? -0.124451207338 ? 2.43177184503 ? 
-0.895232626099 ? 0.708798998441 ? 0.209185717421    ? -0.12315650947  ? -0.320216916275 ? 0.106464149115   ? -0.273329732431 ? 
-0.110247976735 ? -0.00955202579548 ? 0.226887607501   ? 0.105721181335   ? 
3 'X-RAY DIFFRACTION' ? refined 2.75454339488 6.902920245     17.1487922524 0.102743157245  ? 0.0345184767709  ? -0.0507967005068 
? 0.147109653483 ? -0.00710745218811 ? 0.207111509148 ? 1.87981207491  ? 0.456778682566 ? 0.157300039555  ? 1.59071453065 ? 
0.446358496694  ? 1.15165963854  ? -0.191180763323   ? -0.187405773178 ? 0.140694671683  ? -0.145319953541  ? 0.167451875697  ? 
0.342506740718  ? 0.0860880259829   ? -0.192664840347  ? 0.00719508967531 ? 
4 'X-RAY DIFFRACTION' ? refined 10.2106392732 -0.308017283908 9.59591765612 0.241201090801  ? -0.0538980489234 ? 0.0402725604645  
? 0.101814035596 ? -0.0394013316317  ? 0.343079842743 ? 0.429886568363 ? -0.13103850074 ? 0.187474916512  ? 1.52965768607 ? 
-0.61401234901  ? 0.746964462801 ? -0.00102696141278 ? 0.151502192848  ? -0.150366847425 ? -0.425615732191  ? 0.0208177569036 ? 
0.14130366849   ? 0.27795879194     ? -0.0558660952753 ? 0.0672162640118  ? 
5 'X-RAY DIFFRACTION' ? refined 24.1173541673 21.2541009413   9.56682699361 0.467292343688  ? -0.109496579689  ? 0.0948274029776  
? 0.261693019367 ? 0.00551782412043  ? 0.212091688371 ? 5.4611201806   ? 0.302142797792 ? -1.7335529534   ? 1.52349104547 ? 
-0.195217836213 ? 2.22024649237  ? 0.621171096732    ? 0.635224470785  ? 0.797434031958  ? -0.44995096772   ? -0.427201969212 ? 
0.0189177323387 ? -0.39677550111    ? 0.274951436058   ? -0.14162616604   ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_PDB_ins_code 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_PDB_ins_code 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 27:56)'   
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 57:108)'  
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 109:180)' 
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 181:231)' 
5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 232:263)' 
# 
_pdbx_entry_details.entry_id                 6Z3E 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A PRO 0   ? A PRO 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A GLY 2   ? A GLY 4   
5  1 Y 1 A GLY 3   ? A GLY 5   
6  1 Y 1 A PHE 4   ? A PHE 6   
7  1 Y 1 A GLN 5   ? A GLN 7   
8  1 Y 1 A ARG 6   ? A ARG 8   
9  1 Y 1 A GLY 7   ? A GLY 9   
10 1 Y 1 A LYS 8   ? A LYS 10  
11 1 Y 1 A TYR 9   ? A TYR 11  
12 1 Y 1 A GLY 10  ? A GLY 12  
13 1 Y 1 A THR 11  ? A THR 13  
14 1 Y 1 A MET 12  ? A MET 14  
15 1 Y 1 A ALA 13  ? A ALA 15  
16 1 Y 1 A GLU 14  ? A GLU 16  
17 1 Y 1 A GLY 15  ? A GLY 17  
18 1 Y 1 A ARG 16  ? A ARG 18  
19 1 Y 1 A SER 17  ? A SER 19  
20 1 Y 1 A GLU 18  ? A GLU 20  
21 1 Y 1 A ASP 19  ? A ASP 21  
22 1 Y 1 A ASN 20  ? A ASN 22  
23 1 Y 1 A LEU 21  ? A LEU 23  
24 1 Y 1 A SER 22  ? A SER 24  
25 1 Y 1 A ALA 23  ? A ALA 25  
26 1 Y 1 A THR 24  ? A THR 26  
27 1 Y 1 A PRO 25  ? A PRO 27  
28 1 Y 1 A PRO 26  ? A PRO 28  
29 1 Y 1 A GLU 264 ? A GLU 266 
30 1 Y 1 A SER 265 ? A SER 267 
31 1 Y 1 A ASN 266 ? A ASN 268 
32 1 Y 1 A TRP 267 ? A TRP 269 
33 1 Y 1 A ALA 268 ? A ALA 270 
34 1 Y 1 A TYR 269 ? A TYR 271 
35 1 Y 1 A LYS 270 ? A LYS 272 
36 1 Y 1 A ALA 271 ? A ALA 273 
37 1 Y 1 A LEU 272 ? A LEU 274 
38 1 Y 1 A LEU 273 ? A LEU 275 
39 1 Y 1 A ARG 274 ? A ARG 276 
40 1 Y 1 A VAL 275 ? A VAL 277 
41 1 Y 1 A LYS 276 ? A LYS 278 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CYS N      N  N N 74  
CYS CA     C  N R 75  
CYS C      C  N N 76  
CYS O      O  N N 77  
CYS CB     C  N N 78  
CYS SG     S  N N 79  
CYS OXT    O  N N 80  
CYS H      H  N N 81  
CYS H2     H  N N 82  
CYS HA     H  N N 83  
CYS HB2    H  N N 84  
CYS HB3    H  N N 85  
CYS HG     H  N N 86  
CYS HXT    H  N N 87  
GDP PB     P  N N 88  
GDP O1B    O  N N 89  
GDP O2B    O  N N 90  
GDP O3B    O  N N 91  
GDP O3A    O  N N 92  
GDP PA     P  N N 93  
GDP O1A    O  N N 94  
GDP O2A    O  N N 95  
GDP "O5'"  O  N N 96  
GDP "C5'"  C  N N 97  
GDP "C4'"  C  N R 98  
GDP "O4'"  O  N N 99  
GDP "C3'"  C  N S 100 
GDP "O3'"  O  N N 101 
GDP "C2'"  C  N R 102 
GDP "O2'"  O  N N 103 
GDP "C1'"  C  N R 104 
GDP N9     N  Y N 105 
GDP C8     C  Y N 106 
GDP N7     N  Y N 107 
GDP C5     C  Y N 108 
GDP C6     C  N N 109 
GDP O6     O  N N 110 
GDP N1     N  N N 111 
GDP C2     C  N N 112 
GDP N2     N  N N 113 
GDP N3     N  N N 114 
GDP C4     C  Y N 115 
GDP HOB2   H  N N 116 
GDP HOB3   H  N N 117 
GDP HOA2   H  N N 118 
GDP "H5'"  H  N N 119 
GDP "H5''" H  N N 120 
GDP "H4'"  H  N N 121 
GDP "H3'"  H  N N 122 
GDP "HO3'" H  N N 123 
GDP "H2'"  H  N N 124 
GDP "HO2'" H  N N 125 
GDP "H1'"  H  N N 126 
GDP H8     H  N N 127 
GDP HN1    H  N N 128 
GDP HN21   H  N N 129 
GDP HN22   H  N N 130 
GLN N      N  N N 131 
GLN CA     C  N S 132 
GLN C      C  N N 133 
GLN O      O  N N 134 
GLN CB     C  N N 135 
GLN CG     C  N N 136 
GLN CD     C  N N 137 
GLN OE1    O  N N 138 
GLN NE2    N  N N 139 
GLN OXT    O  N N 140 
GLN H      H  N N 141 
GLN H2     H  N N 142 
GLN HA     H  N N 143 
GLN HB2    H  N N 144 
GLN HB3    H  N N 145 
GLN HG2    H  N N 146 
GLN HG3    H  N N 147 
GLN HE21   H  N N 148 
GLN HE22   H  N N 149 
GLN HXT    H  N N 150 
GLU N      N  N N 151 
GLU CA     C  N S 152 
GLU C      C  N N 153 
GLU O      O  N N 154 
GLU CB     C  N N 155 
GLU CG     C  N N 156 
GLU CD     C  N N 157 
GLU OE1    O  N N 158 
GLU OE2    O  N N 159 
GLU OXT    O  N N 160 
GLU H      H  N N 161 
GLU H2     H  N N 162 
GLU HA     H  N N 163 
GLU HB2    H  N N 164 
GLU HB3    H  N N 165 
GLU HG2    H  N N 166 
GLU HG3    H  N N 167 
GLU HE2    H  N N 168 
GLU HXT    H  N N 169 
GLY N      N  N N 170 
GLY CA     C  N N 171 
GLY C      C  N N 172 
GLY O      O  N N 173 
GLY OXT    O  N N 174 
GLY H      H  N N 175 
GLY H2     H  N N 176 
GLY HA2    H  N N 177 
GLY HA3    H  N N 178 
GLY HXT    H  N N 179 
HIS N      N  N N 180 
HIS CA     C  N S 181 
HIS C      C  N N 182 
HIS O      O  N N 183 
HIS CB     C  N N 184 
HIS CG     C  Y N 185 
HIS ND1    N  Y N 186 
HIS CD2    C  Y N 187 
HIS CE1    C  Y N 188 
HIS NE2    N  Y N 189 
HIS OXT    O  N N 190 
HIS H      H  N N 191 
HIS H2     H  N N 192 
HIS HA     H  N N 193 
HIS HB2    H  N N 194 
HIS HB3    H  N N 195 
HIS HD1    H  N N 196 
HIS HD2    H  N N 197 
HIS HE1    H  N N 198 
HIS HE2    H  N N 199 
HIS HXT    H  N N 200 
HOH O      O  N N 201 
HOH H1     H  N N 202 
HOH H2     H  N N 203 
ILE N      N  N N 204 
ILE CA     C  N S 205 
ILE C      C  N N 206 
ILE O      O  N N 207 
ILE CB     C  N S 208 
ILE CG1    C  N N 209 
ILE CG2    C  N N 210 
ILE CD1    C  N N 211 
ILE OXT    O  N N 212 
ILE H      H  N N 213 
ILE H2     H  N N 214 
ILE HA     H  N N 215 
ILE HB     H  N N 216 
ILE HG12   H  N N 217 
ILE HG13   H  N N 218 
ILE HG21   H  N N 219 
ILE HG22   H  N N 220 
ILE HG23   H  N N 221 
ILE HD11   H  N N 222 
ILE HD12   H  N N 223 
ILE HD13   H  N N 224 
ILE HXT    H  N N 225 
LEU N      N  N N 226 
LEU CA     C  N S 227 
LEU C      C  N N 228 
LEU O      O  N N 229 
LEU CB     C  N N 230 
LEU CG     C  N N 231 
LEU CD1    C  N N 232 
LEU CD2    C  N N 233 
LEU OXT    O  N N 234 
LEU H      H  N N 235 
LEU H2     H  N N 236 
LEU HA     H  N N 237 
LEU HB2    H  N N 238 
LEU HB3    H  N N 239 
LEU HG     H  N N 240 
LEU HD11   H  N N 241 
LEU HD12   H  N N 242 
LEU HD13   H  N N 243 
LEU HD21   H  N N 244 
LEU HD22   H  N N 245 
LEU HD23   H  N N 246 
LEU HXT    H  N N 247 
LYS N      N  N N 248 
LYS CA     C  N S 249 
LYS C      C  N N 250 
LYS O      O  N N 251 
LYS CB     C  N N 252 
LYS CG     C  N N 253 
LYS CD     C  N N 254 
LYS CE     C  N N 255 
LYS NZ     N  N N 256 
LYS OXT    O  N N 257 
LYS H      H  N N 258 
LYS H2     H  N N 259 
LYS HA     H  N N 260 
LYS HB2    H  N N 261 
LYS HB3    H  N N 262 
LYS HG2    H  N N 263 
LYS HG3    H  N N 264 
LYS HD2    H  N N 265 
LYS HD3    H  N N 266 
LYS HE2    H  N N 267 
LYS HE3    H  N N 268 
LYS HZ1    H  N N 269 
LYS HZ2    H  N N 270 
LYS HZ3    H  N N 271 
LYS HXT    H  N N 272 
MET N      N  N N 273 
MET CA     C  N S 274 
MET C      C  N N 275 
MET O      O  N N 276 
MET CB     C  N N 277 
MET CG     C  N N 278 
MET SD     S  N N 279 
MET CE     C  N N 280 
MET OXT    O  N N 281 
MET H      H  N N 282 
MET H2     H  N N 283 
MET HA     H  N N 284 
MET HB2    H  N N 285 
MET HB3    H  N N 286 
MET HG2    H  N N 287 
MET HG3    H  N N 288 
MET HE1    H  N N 289 
MET HE2    H  N N 290 
MET HE3    H  N N 291 
MET HXT    H  N N 292 
MG  MG     MG N N 293 
PHE N      N  N N 294 
PHE CA     C  N S 295 
PHE C      C  N N 296 
PHE O      O  N N 297 
PHE CB     C  N N 298 
PHE CG     C  Y N 299 
PHE CD1    C  Y N 300 
PHE CD2    C  Y N 301 
PHE CE1    C  Y N 302 
PHE CE2    C  Y N 303 
PHE CZ     C  Y N 304 
PHE OXT    O  N N 305 
PHE H      H  N N 306 
PHE H2     H  N N 307 
PHE HA     H  N N 308 
PHE HB2    H  N N 309 
PHE HB3    H  N N 310 
PHE HD1    H  N N 311 
PHE HD2    H  N N 312 
PHE HE1    H  N N 313 
PHE HE2    H  N N 314 
PHE HZ     H  N N 315 
PHE HXT    H  N N 316 
PRO N      N  N N 317 
PRO CA     C  N S 318 
PRO C      C  N N 319 
PRO O      O  N N 320 
PRO CB     C  N N 321 
PRO CG     C  N N 322 
PRO CD     C  N N 323 
PRO OXT    O  N N 324 
PRO H      H  N N 325 
PRO HA     H  N N 326 
PRO HB2    H  N N 327 
PRO HB3    H  N N 328 
PRO HG2    H  N N 329 
PRO HG3    H  N N 330 
PRO HD2    H  N N 331 
PRO HD3    H  N N 332 
PRO HXT    H  N N 333 
SER N      N  N N 334 
SER CA     C  N S 335 
SER C      C  N N 336 
SER O      O  N N 337 
SER CB     C  N N 338 
SER OG     O  N N 339 
SER OXT    O  N N 340 
SER H      H  N N 341 
SER H2     H  N N 342 
SER HA     H  N N 343 
SER HB2    H  N N 344 
SER HB3    H  N N 345 
SER HG     H  N N 346 
SER HXT    H  N N 347 
THR N      N  N N 348 
THR CA     C  N S 349 
THR C      C  N N 350 
THR O      O  N N 351 
THR CB     C  N R 352 
THR OG1    O  N N 353 
THR CG2    C  N N 354 
THR OXT    O  N N 355 
THR H      H  N N 356 
THR H2     H  N N 357 
THR HA     H  N N 358 
THR HB     H  N N 359 
THR HG1    H  N N 360 
THR HG21   H  N N 361 
THR HG22   H  N N 362 
THR HG23   H  N N 363 
THR HXT    H  N N 364 
TRP N      N  N N 365 
TRP CA     C  N S 366 
TRP C      C  N N 367 
TRP O      O  N N 368 
TRP CB     C  N N 369 
TRP CG     C  Y N 370 
TRP CD1    C  Y N 371 
TRP CD2    C  Y N 372 
TRP NE1    N  Y N 373 
TRP CE2    C  Y N 374 
TRP CE3    C  Y N 375 
TRP CZ2    C  Y N 376 
TRP CZ3    C  Y N 377 
TRP CH2    C  Y N 378 
TRP OXT    O  N N 379 
TRP H      H  N N 380 
TRP H2     H  N N 381 
TRP HA     H  N N 382 
TRP HB2    H  N N 383 
TRP HB3    H  N N 384 
TRP HD1    H  N N 385 
TRP HE1    H  N N 386 
TRP HE3    H  N N 387 
TRP HZ2    H  N N 388 
TRP HZ3    H  N N 389 
TRP HH2    H  N N 390 
TRP HXT    H  N N 391 
TYR N      N  N N 392 
TYR CA     C  N S 393 
TYR C      C  N N 394 
TYR O      O  N N 395 
TYR CB     C  N N 396 
TYR CG     C  Y N 397 
TYR CD1    C  Y N 398 
TYR CD2    C  Y N 399 
TYR CE1    C  Y N 400 
TYR CE2    C  Y N 401 
TYR CZ     C  Y N 402 
TYR OH     O  N N 403 
TYR OXT    O  N N 404 
TYR H      H  N N 405 
TYR H2     H  N N 406 
TYR HA     H  N N 407 
TYR HB2    H  N N 408 
TYR HB3    H  N N 409 
TYR HD1    H  N N 410 
TYR HD2    H  N N 411 
TYR HE1    H  N N 412 
TYR HE2    H  N N 413 
TYR HH     H  N N 414 
TYR HXT    H  N N 415 
VAL N      N  N N 416 
VAL CA     C  N S 417 
VAL C      C  N N 418 
VAL O      O  N N 419 
VAL CB     C  N N 420 
VAL CG1    C  N N 421 
VAL CG2    C  N N 422 
VAL OXT    O  N N 423 
VAL H      H  N N 424 
VAL H2     H  N N 425 
VAL HA     H  N N 426 
VAL HB     H  N N 427 
VAL HG11   H  N N 428 
VAL HG12   H  N N 429 
VAL HG13   H  N N 430 
VAL HG21   H  N N 431 
VAL HG22   H  N N 432 
VAL HG23   H  N N 433 
VAL HXT    H  N N 434 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
GDP PB    O1B    doub N N 83  
GDP PB    O2B    sing N N 84  
GDP PB    O3B    sing N N 85  
GDP PB    O3A    sing N N 86  
GDP O2B   HOB2   sing N N 87  
GDP O3B   HOB3   sing N N 88  
GDP O3A   PA     sing N N 89  
GDP PA    O1A    doub N N 90  
GDP PA    O2A    sing N N 91  
GDP PA    "O5'"  sing N N 92  
GDP O2A   HOA2   sing N N 93  
GDP "O5'" "C5'"  sing N N 94  
GDP "C5'" "C4'"  sing N N 95  
GDP "C5'" "H5'"  sing N N 96  
GDP "C5'" "H5''" sing N N 97  
GDP "C4'" "O4'"  sing N N 98  
GDP "C4'" "C3'"  sing N N 99  
GDP "C4'" "H4'"  sing N N 100 
GDP "O4'" "C1'"  sing N N 101 
GDP "C3'" "O3'"  sing N N 102 
GDP "C3'" "C2'"  sing N N 103 
GDP "C3'" "H3'"  sing N N 104 
GDP "O3'" "HO3'" sing N N 105 
GDP "C2'" "O2'"  sing N N 106 
GDP "C2'" "C1'"  sing N N 107 
GDP "C2'" "H2'"  sing N N 108 
GDP "O2'" "HO2'" sing N N 109 
GDP "C1'" N9     sing N N 110 
GDP "C1'" "H1'"  sing N N 111 
GDP N9    C8     sing Y N 112 
GDP N9    C4     sing Y N 113 
GDP C8    N7     doub Y N 114 
GDP C8    H8     sing N N 115 
GDP N7    C5     sing Y N 116 
GDP C5    C6     sing N N 117 
GDP C5    C4     doub Y N 118 
GDP C6    O6     doub N N 119 
GDP C6    N1     sing N N 120 
GDP N1    C2     sing N N 121 
GDP N1    HN1    sing N N 122 
GDP C2    N2     sing N N 123 
GDP C2    N3     doub N N 124 
GDP N2    HN21   sing N N 125 
GDP N2    HN22   sing N N 126 
GDP N3    C4     sing N N 127 
GLN N     CA     sing N N 128 
GLN N     H      sing N N 129 
GLN N     H2     sing N N 130 
GLN CA    C      sing N N 131 
GLN CA    CB     sing N N 132 
GLN CA    HA     sing N N 133 
GLN C     O      doub N N 134 
GLN C     OXT    sing N N 135 
GLN CB    CG     sing N N 136 
GLN CB    HB2    sing N N 137 
GLN CB    HB3    sing N N 138 
GLN CG    CD     sing N N 139 
GLN CG    HG2    sing N N 140 
GLN CG    HG3    sing N N 141 
GLN CD    OE1    doub N N 142 
GLN CD    NE2    sing N N 143 
GLN NE2   HE21   sing N N 144 
GLN NE2   HE22   sing N N 145 
GLN OXT   HXT    sing N N 146 
GLU N     CA     sing N N 147 
GLU N     H      sing N N 148 
GLU N     H2     sing N N 149 
GLU CA    C      sing N N 150 
GLU CA    CB     sing N N 151 
GLU CA    HA     sing N N 152 
GLU C     O      doub N N 153 
GLU C     OXT    sing N N 154 
GLU CB    CG     sing N N 155 
GLU CB    HB2    sing N N 156 
GLU CB    HB3    sing N N 157 
GLU CG    CD     sing N N 158 
GLU CG    HG2    sing N N 159 
GLU CG    HG3    sing N N 160 
GLU CD    OE1    doub N N 161 
GLU CD    OE2    sing N N 162 
GLU OE2   HE2    sing N N 163 
GLU OXT   HXT    sing N N 164 
GLY N     CA     sing N N 165 
GLY N     H      sing N N 166 
GLY N     H2     sing N N 167 
GLY CA    C      sing N N 168 
GLY CA    HA2    sing N N 169 
GLY CA    HA3    sing N N 170 
GLY C     O      doub N N 171 
GLY C     OXT    sing N N 172 
GLY OXT   HXT    sing N N 173 
HIS N     CA     sing N N 174 
HIS N     H      sing N N 175 
HIS N     H2     sing N N 176 
HIS CA    C      sing N N 177 
HIS CA    CB     sing N N 178 
HIS CA    HA     sing N N 179 
HIS C     O      doub N N 180 
HIS C     OXT    sing N N 181 
HIS CB    CG     sing N N 182 
HIS CB    HB2    sing N N 183 
HIS CB    HB3    sing N N 184 
HIS CG    ND1    sing Y N 185 
HIS CG    CD2    doub Y N 186 
HIS ND1   CE1    doub Y N 187 
HIS ND1   HD1    sing N N 188 
HIS CD2   NE2    sing Y N 189 
HIS CD2   HD2    sing N N 190 
HIS CE1   NE2    sing Y N 191 
HIS CE1   HE1    sing N N 192 
HIS NE2   HE2    sing N N 193 
HIS OXT   HXT    sing N N 194 
HOH O     H1     sing N N 195 
HOH O     H2     sing N N 196 
ILE N     CA     sing N N 197 
ILE N     H      sing N N 198 
ILE N     H2     sing N N 199 
ILE CA    C      sing N N 200 
ILE CA    CB     sing N N 201 
ILE CA    HA     sing N N 202 
ILE C     O      doub N N 203 
ILE C     OXT    sing N N 204 
ILE CB    CG1    sing N N 205 
ILE CB    CG2    sing N N 206 
ILE CB    HB     sing N N 207 
ILE CG1   CD1    sing N N 208 
ILE CG1   HG12   sing N N 209 
ILE CG1   HG13   sing N N 210 
ILE CG2   HG21   sing N N 211 
ILE CG2   HG22   sing N N 212 
ILE CG2   HG23   sing N N 213 
ILE CD1   HD11   sing N N 214 
ILE CD1   HD12   sing N N 215 
ILE CD1   HD13   sing N N 216 
ILE OXT   HXT    sing N N 217 
LEU N     CA     sing N N 218 
LEU N     H      sing N N 219 
LEU N     H2     sing N N 220 
LEU CA    C      sing N N 221 
LEU CA    CB     sing N N 222 
LEU CA    HA     sing N N 223 
LEU C     O      doub N N 224 
LEU C     OXT    sing N N 225 
LEU CB    CG     sing N N 226 
LEU CB    HB2    sing N N 227 
LEU CB    HB3    sing N N 228 
LEU CG    CD1    sing N N 229 
LEU CG    CD2    sing N N 230 
LEU CG    HG     sing N N 231 
LEU CD1   HD11   sing N N 232 
LEU CD1   HD12   sing N N 233 
LEU CD1   HD13   sing N N 234 
LEU CD2   HD21   sing N N 235 
LEU CD2   HD22   sing N N 236 
LEU CD2   HD23   sing N N 237 
LEU OXT   HXT    sing N N 238 
LYS N     CA     sing N N 239 
LYS N     H      sing N N 240 
LYS N     H2     sing N N 241 
LYS CA    C      sing N N 242 
LYS CA    CB     sing N N 243 
LYS CA    HA     sing N N 244 
LYS C     O      doub N N 245 
LYS C     OXT    sing N N 246 
LYS CB    CG     sing N N 247 
LYS CB    HB2    sing N N 248 
LYS CB    HB3    sing N N 249 
LYS CG    CD     sing N N 250 
LYS CG    HG2    sing N N 251 
LYS CG    HG3    sing N N 252 
LYS CD    CE     sing N N 253 
LYS CD    HD2    sing N N 254 
LYS CD    HD3    sing N N 255 
LYS CE    NZ     sing N N 256 
LYS CE    HE2    sing N N 257 
LYS CE    HE3    sing N N 258 
LYS NZ    HZ1    sing N N 259 
LYS NZ    HZ2    sing N N 260 
LYS NZ    HZ3    sing N N 261 
LYS OXT   HXT    sing N N 262 
MET N     CA     sing N N 263 
MET N     H      sing N N 264 
MET N     H2     sing N N 265 
MET CA    C      sing N N 266 
MET CA    CB     sing N N 267 
MET CA    HA     sing N N 268 
MET C     O      doub N N 269 
MET C     OXT    sing N N 270 
MET CB    CG     sing N N 271 
MET CB    HB2    sing N N 272 
MET CB    HB3    sing N N 273 
MET CG    SD     sing N N 274 
MET CG    HG2    sing N N 275 
MET CG    HG3    sing N N 276 
MET SD    CE     sing N N 277 
MET CE    HE1    sing N N 278 
MET CE    HE2    sing N N 279 
MET CE    HE3    sing N N 280 
MET OXT   HXT    sing N N 281 
PHE N     CA     sing N N 282 
PHE N     H      sing N N 283 
PHE N     H2     sing N N 284 
PHE CA    C      sing N N 285 
PHE CA    CB     sing N N 286 
PHE CA    HA     sing N N 287 
PHE C     O      doub N N 288 
PHE C     OXT    sing N N 289 
PHE CB    CG     sing N N 290 
PHE CB    HB2    sing N N 291 
PHE CB    HB3    sing N N 292 
PHE CG    CD1    doub Y N 293 
PHE CG    CD2    sing Y N 294 
PHE CD1   CE1    sing Y N 295 
PHE CD1   HD1    sing N N 296 
PHE CD2   CE2    doub Y N 297 
PHE CD2   HD2    sing N N 298 
PHE CE1   CZ     doub Y N 299 
PHE CE1   HE1    sing N N 300 
PHE CE2   CZ     sing Y N 301 
PHE CE2   HE2    sing N N 302 
PHE CZ    HZ     sing N N 303 
PHE OXT   HXT    sing N N 304 
PRO N     CA     sing N N 305 
PRO N     CD     sing N N 306 
PRO N     H      sing N N 307 
PRO CA    C      sing N N 308 
PRO CA    CB     sing N N 309 
PRO CA    HA     sing N N 310 
PRO C     O      doub N N 311 
PRO C     OXT    sing N N 312 
PRO CB    CG     sing N N 313 
PRO CB    HB2    sing N N 314 
PRO CB    HB3    sing N N 315 
PRO CG    CD     sing N N 316 
PRO CG    HG2    sing N N 317 
PRO CG    HG3    sing N N 318 
PRO CD    HD2    sing N N 319 
PRO CD    HD3    sing N N 320 
PRO OXT   HXT    sing N N 321 
SER N     CA     sing N N 322 
SER N     H      sing N N 323 
SER N     H2     sing N N 324 
SER CA    C      sing N N 325 
SER CA    CB     sing N N 326 
SER CA    HA     sing N N 327 
SER C     O      doub N N 328 
SER C     OXT    sing N N 329 
SER CB    OG     sing N N 330 
SER CB    HB2    sing N N 331 
SER CB    HB3    sing N N 332 
SER OG    HG     sing N N 333 
SER OXT   HXT    sing N N 334 
THR N     CA     sing N N 335 
THR N     H      sing N N 336 
THR N     H2     sing N N 337 
THR CA    C      sing N N 338 
THR CA    CB     sing N N 339 
THR CA    HA     sing N N 340 
THR C     O      doub N N 341 
THR C     OXT    sing N N 342 
THR CB    OG1    sing N N 343 
THR CB    CG2    sing N N 344 
THR CB    HB     sing N N 345 
THR OG1   HG1    sing N N 346 
THR CG2   HG21   sing N N 347 
THR CG2   HG22   sing N N 348 
THR CG2   HG23   sing N N 349 
THR OXT   HXT    sing N N 350 
TRP N     CA     sing N N 351 
TRP N     H      sing N N 352 
TRP N     H2     sing N N 353 
TRP CA    C      sing N N 354 
TRP CA    CB     sing N N 355 
TRP CA    HA     sing N N 356 
TRP C     O      doub N N 357 
TRP C     OXT    sing N N 358 
TRP CB    CG     sing N N 359 
TRP CB    HB2    sing N N 360 
TRP CB    HB3    sing N N 361 
TRP CG    CD1    doub Y N 362 
TRP CG    CD2    sing Y N 363 
TRP CD1   NE1    sing Y N 364 
TRP CD1   HD1    sing N N 365 
TRP CD2   CE2    doub Y N 366 
TRP CD2   CE3    sing Y N 367 
TRP NE1   CE2    sing Y N 368 
TRP NE1   HE1    sing N N 369 
TRP CE2   CZ2    sing Y N 370 
TRP CE3   CZ3    doub Y N 371 
TRP CE3   HE3    sing N N 372 
TRP CZ2   CH2    doub Y N 373 
TRP CZ2   HZ2    sing N N 374 
TRP CZ3   CH2    sing Y N 375 
TRP CZ3   HZ3    sing N N 376 
TRP CH2   HH2    sing N N 377 
TRP OXT   HXT    sing N N 378 
TYR N     CA     sing N N 379 
TYR N     H      sing N N 380 
TYR N     H2     sing N N 381 
TYR CA    C      sing N N 382 
TYR CA    CB     sing N N 383 
TYR CA    HA     sing N N 384 
TYR C     O      doub N N 385 
TYR C     OXT    sing N N 386 
TYR CB    CG     sing N N 387 
TYR CB    HB2    sing N N 388 
TYR CB    HB3    sing N N 389 
TYR CG    CD1    doub Y N 390 
TYR CG    CD2    sing Y N 391 
TYR CD1   CE1    sing Y N 392 
TYR CD1   HD1    sing N N 393 
TYR CD2   CE2    doub Y N 394 
TYR CD2   HD2    sing N N 395 
TYR CE1   CZ     doub Y N 396 
TYR CE1   HE1    sing N N 397 
TYR CE2   CZ     sing Y N 398 
TYR CE2   HE2    sing N N 399 
TYR CZ    OH     sing N N 400 
TYR OH    HH     sing N N 401 
TYR OXT   HXT    sing N N 402 
VAL N     CA     sing N N 403 
VAL N     H      sing N N 404 
VAL N     H2     sing N N 405 
VAL CA    C      sing N N 406 
VAL CA    CB     sing N N 407 
VAL CA    HA     sing N N 408 
VAL C     O      doub N N 409 
VAL C     OXT    sing N N 410 
VAL CB    CG1    sing N N 411 
VAL CB    CG2    sing N N 412 
VAL CB    HB     sing N N 413 
VAL CG1   HG11   sing N N 414 
VAL CG1   HG12   sing N N 415 
VAL CG1   HG13   sing N N 416 
VAL CG2   HG21   sing N N 417 
VAL CG2   HG22   sing N N 418 
VAL CG2   HG23   sing N N 419 
VAL OXT   HXT    sing N N 420 
# 
_pdbx_audit_support.funding_organization   'Helmholtz Association' 
_pdbx_audit_support.country                Germany 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2XTP 
_pdbx_initial_refinement_model.details          ? 
# 
_space_group.name_H-M_alt     'P 21 21 21' 
_space_group.name_Hall        'P 2ac 2ab' 
_space_group.IT_number        19 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
_atom_sites.entry_id                    6Z3E 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.024225 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017473 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009367 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG ? ? 9.41153 2.53737 2.59044  63.03566 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 7.96527 ?       9.05267  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135 5.44231 1.42069  35.72801 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_