data_6Z3G # _entry.id 6Z3G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Z3G pdb_00006z3g 10.2210/pdb6z3g/pdb WWPDB D_1292108827 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-01 2 'Structure model' 1 1 2020-07-08 3 'Structure model' 1 2 2020-07-15 4 'Structure model' 1 3 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Z3G _pdbx_database_status.recvd_initial_deposition_date 2020-05-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Malinauskas, T.' 1 0000-0002-4847-5529 'Peer, T.V.' 2 ? 'Bishop, B.' 3 ? 'Muller, T.D.' 4 0000-0003-1862-7357 'Siebold, C.' 5 0000-0002-6635-3621 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 15620 _citation.page_last 15631 _citation.title 'Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2000561117 _citation.pdbx_database_id_PubMed 32576689 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Malinauskas, T.' 1 ? primary 'Peer, T.V.' 2 ? primary 'Bishop, B.' 3 ? primary 'Mueller, T.D.' 4 ? primary 'Siebold, C.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth/differentiation factor 5' 13405.481 1 ? ? ? ? 2 polymer man 'Repulsive guidance molecule A' 11628.836 1 ? ? ? ? 3 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;GDF-5,Bone morphogenetic protein 14,BMP-14,Cartilage-derived morphogenetic protein 1,CDMP-1,Lipopolysaccharide-associated protein 4,LPS-associated protein 4,Radotermin ; 2 'RGM domain family member A' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MKRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPT CCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR ; ;MKRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPT CCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR ; A ? 2 'polypeptide(L)' no no ;ETGSPCKILKCNSEFWSATSGSHAPASDDTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTS QPRLRTLPPAGDSQERSGTKHHHHHH ; ;ETGSPCKILKCNSEFWSATSGSHAPASDDTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTS QPRLRTLPPAGDSQERSGTKHHHHHH ; B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'CITRIC ACID' _pdbx_entity_nonpoly.comp_id CIT # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ARG n 1 4 GLN n 1 5 GLY n 1 6 LYS n 1 7 ARG n 1 8 PRO n 1 9 SER n 1 10 LYS n 1 11 ASN n 1 12 LEU n 1 13 LYS n 1 14 ALA n 1 15 ARG n 1 16 CYS n 1 17 SER n 1 18 ARG n 1 19 LYS n 1 20 ALA n 1 21 LEU n 1 22 HIS n 1 23 VAL n 1 24 ASN n 1 25 PHE n 1 26 LYS n 1 27 ASP n 1 28 MET n 1 29 GLY n 1 30 TRP n 1 31 ASP n 1 32 ASP n 1 33 TRP n 1 34 ILE n 1 35 ILE n 1 36 ALA n 1 37 PRO n 1 38 LEU n 1 39 GLU n 1 40 TYR n 1 41 GLU n 1 42 ALA n 1 43 PHE n 1 44 HIS n 1 45 CYS n 1 46 GLU n 1 47 GLY n 1 48 LEU n 1 49 CYS n 1 50 GLU n 1 51 PHE n 1 52 PRO n 1 53 LEU n 1 54 ARG n 1 55 SER n 1 56 HIS n 1 57 LEU n 1 58 GLU n 1 59 PRO n 1 60 THR n 1 61 ASN n 1 62 HIS n 1 63 ALA n 1 64 VAL n 1 65 ILE n 1 66 GLN n 1 67 THR n 1 68 LEU n 1 69 MET n 1 70 ASN n 1 71 SER n 1 72 MET n 1 73 ASP n 1 74 PRO n 1 75 GLU n 1 76 SER n 1 77 THR n 1 78 PRO n 1 79 PRO n 1 80 THR n 1 81 CYS n 1 82 CYS n 1 83 VAL n 1 84 PRO n 1 85 THR n 1 86 ARG n 1 87 LEU n 1 88 SER n 1 89 PRO n 1 90 ILE n 1 91 SER n 1 92 ILE n 1 93 LEU n 1 94 PHE n 1 95 ILE n 1 96 ASP n 1 97 SER n 1 98 ALA n 1 99 ASN n 1 100 ASN n 1 101 VAL n 1 102 VAL n 1 103 TYR n 1 104 LYS n 1 105 GLN n 1 106 TYR n 1 107 GLU n 1 108 ASP n 1 109 MET n 1 110 VAL n 1 111 VAL n 1 112 GLU n 1 113 SER n 1 114 CYS n 1 115 GLY n 1 116 CYS n 1 117 ARG n 2 1 GLU n 2 2 THR n 2 3 GLY n 2 4 SER n 2 5 PRO n 2 6 CYS n 2 7 LYS n 2 8 ILE n 2 9 LEU n 2 10 LYS n 2 11 CYS n 2 12 ASN n 2 13 SER n 2 14 GLU n 2 15 PHE n 2 16 TRP n 2 17 SER n 2 18 ALA n 2 19 THR n 2 20 SER n 2 21 GLY n 2 22 SER n 2 23 HIS n 2 24 ALA n 2 25 PRO n 2 26 ALA n 2 27 SER n 2 28 ASP n 2 29 ASP n 2 30 THR n 2 31 PRO n 2 32 GLU n 2 33 PHE n 2 34 CYS n 2 35 ALA n 2 36 ALA n 2 37 LEU n 2 38 ARG n 2 39 SER n 2 40 TYR n 2 41 ALA n 2 42 LEU n 2 43 CYS n 2 44 THR n 2 45 ARG n 2 46 ARG n 2 47 THR n 2 48 ALA n 2 49 ARG n 2 50 THR n 2 51 CYS n 2 52 ARG n 2 53 GLY n 2 54 ASP n 2 55 LEU n 2 56 ALA n 2 57 TYR n 2 58 HIS n 2 59 SER n 2 60 ALA n 2 61 VAL n 2 62 HIS n 2 63 GLY n 2 64 ILE n 2 65 GLU n 2 66 ASP n 2 67 LEU n 2 68 MET n 2 69 SER n 2 70 GLN n 2 71 HIS n 2 72 ASN n 2 73 CYS n 2 74 SER n 2 75 LYS n 2 76 ASP n 2 77 GLY n 2 78 PRO n 2 79 THR n 2 80 SER n 2 81 GLN n 2 82 PRO n 2 83 ARG n 2 84 LEU n 2 85 ARG n 2 86 THR n 2 87 LEU n 2 88 PRO n 2 89 PRO n 2 90 ALA n 2 91 GLY n 2 92 ASP n 2 93 SER n 2 94 GLN n 2 95 GLU n 2 96 ARG n 2 97 SER n 2 98 GLY n 2 99 THR n 2 100 LYS n 2 101 HIS n 2 102 HIS n 2 103 HIS n 2 104 HIS n 2 105 HIS n 2 106 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 117 Human ? 'GDF5, BMP14, CDMP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 106 Human ? 'RGMA, RGM' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HEK293T CRL-11268 ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 385 ? ? ? A . n A 1 2 LYS 2 386 ? ? ? A . n A 1 3 ARG 3 387 ? ? ? A . n A 1 4 GLN 4 388 ? ? ? A . n A 1 5 GLY 5 389 ? ? ? A . n A 1 6 LYS 6 390 ? ? ? A . n A 1 7 ARG 7 391 ? ? ? A . n A 1 8 PRO 8 392 ? ? ? A . n A 1 9 SER 9 393 ? ? ? A . n A 1 10 LYS 10 394 ? ? ? A . n A 1 11 ASN 11 395 ? ? ? A . n A 1 12 LEU 12 396 ? ? ? A . n A 1 13 LYS 13 397 397 LYS LYS A . n A 1 14 ALA 14 398 398 ALA ALA A . n A 1 15 ARG 15 399 399 ARG ARG A . n A 1 16 CYS 16 400 400 CYS CYS A . n A 1 17 SER 17 401 401 SER SER A . n A 1 18 ARG 18 402 402 ARG ARG A . n A 1 19 LYS 19 403 403 LYS LYS A . n A 1 20 ALA 20 404 404 ALA ALA A . n A 1 21 LEU 21 405 405 LEU LEU A . n A 1 22 HIS 22 406 406 HIS HIS A . n A 1 23 VAL 23 407 407 VAL VAL A . n A 1 24 ASN 24 408 408 ASN ASN A . n A 1 25 PHE 25 409 409 PHE PHE A . n A 1 26 LYS 26 410 410 LYS LYS A . n A 1 27 ASP 27 411 411 ASP ASP A . n A 1 28 MET 28 412 412 MET MET A . n A 1 29 GLY 29 413 413 GLY GLY A . n A 1 30 TRP 30 414 414 TRP TRP A . n A 1 31 ASP 31 415 415 ASP ASP A . n A 1 32 ASP 32 416 416 ASP ASP A . n A 1 33 TRP 33 417 417 TRP TRP A . n A 1 34 ILE 34 418 418 ILE ILE A . n A 1 35 ILE 35 419 419 ILE ILE A . n A 1 36 ALA 36 420 420 ALA ALA A . n A 1 37 PRO 37 421 421 PRO PRO A . n A 1 38 LEU 38 422 422 LEU LEU A . n A 1 39 GLU 39 423 423 GLU GLU A . n A 1 40 TYR 40 424 424 TYR TYR A . n A 1 41 GLU 41 425 425 GLU GLU A . n A 1 42 ALA 42 426 426 ALA ALA A . n A 1 43 PHE 43 427 427 PHE PHE A . n A 1 44 HIS 44 428 428 HIS HIS A . n A 1 45 CYS 45 429 429 CYS CYS A . n A 1 46 GLU 46 430 430 GLU GLU A . n A 1 47 GLY 47 431 431 GLY GLY A . n A 1 48 LEU 48 432 432 LEU LEU A . n A 1 49 CYS 49 433 433 CYS CYS A . n A 1 50 GLU 50 434 434 GLU GLU A . n A 1 51 PHE 51 435 435 PHE PHE A . n A 1 52 PRO 52 436 436 PRO PRO A . n A 1 53 LEU 53 437 437 LEU LEU A . n A 1 54 ARG 54 438 438 ARG ARG A . n A 1 55 SER 55 439 439 SER SER A . n A 1 56 HIS 56 440 440 HIS HIS A . n A 1 57 LEU 57 441 441 LEU LEU A . n A 1 58 GLU 58 442 442 GLU GLU A . n A 1 59 PRO 59 443 443 PRO PRO A . n A 1 60 THR 60 444 444 THR THR A . n A 1 61 ASN 61 445 445 ASN ASN A . n A 1 62 HIS 62 446 446 HIS HIS A . n A 1 63 ALA 63 447 447 ALA ALA A . n A 1 64 VAL 64 448 448 VAL VAL A . n A 1 65 ILE 65 449 449 ILE ILE A . n A 1 66 GLN 66 450 450 GLN GLN A . n A 1 67 THR 67 451 451 THR THR A . n A 1 68 LEU 68 452 452 LEU LEU A . n A 1 69 MET 69 453 453 MET MET A . n A 1 70 ASN 70 454 454 ASN ASN A . n A 1 71 SER 71 455 455 SER SER A . n A 1 72 MET 72 456 456 MET MET A . n A 1 73 ASP 73 457 457 ASP ASP A . n A 1 74 PRO 74 458 458 PRO PRO A . n A 1 75 GLU 75 459 459 GLU GLU A . n A 1 76 SER 76 460 460 SER SER A . n A 1 77 THR 77 461 461 THR THR A . n A 1 78 PRO 78 462 462 PRO PRO A . n A 1 79 PRO 79 463 463 PRO PRO A . n A 1 80 THR 80 464 464 THR THR A . n A 1 81 CYS 81 465 465 CYS CYS A . n A 1 82 CYS 82 466 466 CYS CYS A . n A 1 83 VAL 83 467 467 VAL VAL A . n A 1 84 PRO 84 468 468 PRO PRO A . n A 1 85 THR 85 469 469 THR THR A . n A 1 86 ARG 86 470 470 ARG ARG A . n A 1 87 LEU 87 471 471 LEU LEU A . n A 1 88 SER 88 472 472 SER SER A . n A 1 89 PRO 89 473 473 PRO PRO A . n A 1 90 ILE 90 474 474 ILE ILE A . n A 1 91 SER 91 475 475 SER SER A . n A 1 92 ILE 92 476 476 ILE ILE A . n A 1 93 LEU 93 477 477 LEU LEU A . n A 1 94 PHE 94 478 478 PHE PHE A . n A 1 95 ILE 95 479 479 ILE ILE A . n A 1 96 ASP 96 480 480 ASP ASP A . n A 1 97 SER 97 481 481 SER SER A . n A 1 98 ALA 98 482 482 ALA ALA A . n A 1 99 ASN 99 483 483 ASN ASN A . n A 1 100 ASN 100 484 484 ASN ASN A . n A 1 101 VAL 101 485 485 VAL VAL A . n A 1 102 VAL 102 486 486 VAL VAL A . n A 1 103 TYR 103 487 487 TYR TYR A . n A 1 104 LYS 104 488 488 LYS LYS A . n A 1 105 GLN 105 489 489 GLN GLN A . n A 1 106 TYR 106 490 490 TYR TYR A . n A 1 107 GLU 107 491 491 GLU GLU A . n A 1 108 ASP 108 492 492 ASP ASP A . n A 1 109 MET 109 493 493 MET MET A . n A 1 110 VAL 110 494 494 VAL VAL A . n A 1 111 VAL 111 495 495 VAL VAL A . n A 1 112 GLU 112 496 496 GLU GLU A . n A 1 113 SER 113 497 497 SER SER A . n A 1 114 CYS 114 498 498 CYS CYS A . n A 1 115 GLY 115 499 499 GLY GLY A . n A 1 116 CYS 116 500 500 CYS CYS A . n A 1 117 ARG 117 501 501 ARG ARG A . n B 2 1 GLU 1 43 ? ? ? B . n B 2 2 THR 2 44 ? ? ? B . n B 2 3 GLY 3 45 ? ? ? B . n B 2 4 SER 4 46 ? ? ? B . n B 2 5 PRO 5 47 47 PRO PRO B . n B 2 6 CYS 6 48 48 CYS CYS B . n B 2 7 LYS 7 49 49 LYS LYS B . n B 2 8 ILE 8 50 50 ILE ILE B . n B 2 9 LEU 9 51 51 LEU LEU B . n B 2 10 LYS 10 52 52 LYS LYS B . n B 2 11 CYS 11 53 53 CYS CYS B . n B 2 12 ASN 12 54 54 ASN ASN B . n B 2 13 SER 13 55 55 SER SER B . n B 2 14 GLU 14 56 56 GLU GLU B . n B 2 15 PHE 15 57 57 PHE PHE B . n B 2 16 TRP 16 58 58 TRP TRP B . n B 2 17 SER 17 59 59 SER SER B . n B 2 18 ALA 18 60 60 ALA ALA B . n B 2 19 THR 19 61 ? ? ? B . n B 2 20 SER 20 62 ? ? ? B . n B 2 21 GLY 21 63 ? ? ? B . n B 2 22 SER 22 64 ? ? ? B . n B 2 23 HIS 23 65 ? ? ? B . n B 2 24 ALA 24 66 ? ? ? B . n B 2 25 PRO 25 67 ? ? ? B . n B 2 26 ALA 26 68 ? ? ? B . n B 2 27 SER 27 69 ? ? ? B . n B 2 28 ASP 28 70 ? ? ? B . n B 2 29 ASP 29 71 ? ? ? B . n B 2 30 THR 30 72 ? ? ? B . n B 2 31 PRO 31 73 ? ? ? B . n B 2 32 GLU 32 74 74 GLU GLU B . n B 2 33 PHE 33 75 75 PHE PHE B . n B 2 34 CYS 34 76 76 CYS CYS B . n B 2 35 ALA 35 77 77 ALA ALA B . n B 2 36 ALA 36 78 78 ALA ALA B . n B 2 37 LEU 37 79 79 LEU LEU B . n B 2 38 ARG 38 80 80 ARG ARG B . n B 2 39 SER 39 81 81 SER SER B . n B 2 40 TYR 40 82 82 TYR TYR B . n B 2 41 ALA 41 83 83 ALA ALA B . n B 2 42 LEU 42 84 84 LEU LEU B . n B 2 43 CYS 43 85 85 CYS CYS B . n B 2 44 THR 44 86 86 THR THR B . n B 2 45 ARG 45 87 87 ARG ARG B . n B 2 46 ARG 46 88 88 ARG ARG B . n B 2 47 THR 47 89 89 THR THR B . n B 2 48 ALA 48 90 90 ALA ALA B . n B 2 49 ARG 49 91 91 ARG ARG B . n B 2 50 THR 50 92 92 THR THR B . n B 2 51 CYS 51 93 93 CYS CYS B . n B 2 52 ARG 52 94 94 ARG ARG B . n B 2 53 GLY 53 95 95 GLY GLY B . n B 2 54 ASP 54 96 96 ASP ASP B . n B 2 55 LEU 55 97 97 LEU LEU B . n B 2 56 ALA 56 98 98 ALA ALA B . n B 2 57 TYR 57 99 99 TYR TYR B . n B 2 58 HIS 58 100 100 HIS HIS B . n B 2 59 SER 59 101 101 SER SER B . n B 2 60 ALA 60 102 102 ALA ALA B . n B 2 61 VAL 61 103 103 VAL VAL B . n B 2 62 HIS 62 104 104 HIS HIS B . n B 2 63 GLY 63 105 105 GLY GLY B . n B 2 64 ILE 64 106 106 ILE ILE B . n B 2 65 GLU 65 107 107 GLU GLU B . n B 2 66 ASP 66 108 108 ASP ASP B . n B 2 67 LEU 67 109 109 LEU LEU B . n B 2 68 MET 68 110 110 MET MET B . n B 2 69 SER 69 111 111 SER SER B . n B 2 70 GLN 70 112 112 GLN GLN B . n B 2 71 HIS 71 113 113 HIS HIS B . n B 2 72 ASN 72 114 114 ASN ASN B . n B 2 73 CYS 73 115 115 CYS CYS B . n B 2 74 SER 74 116 116 SER SER B . n B 2 75 LYS 75 117 ? ? ? B . n B 2 76 ASP 76 118 ? ? ? B . n B 2 77 GLY 77 119 ? ? ? B . n B 2 78 PRO 78 120 ? ? ? B . n B 2 79 THR 79 121 ? ? ? B . n B 2 80 SER 80 122 ? ? ? B . n B 2 81 GLN 81 123 ? ? ? B . n B 2 82 PRO 82 124 ? ? ? B . n B 2 83 ARG 83 125 ? ? ? B . n B 2 84 LEU 84 126 ? ? ? B . n B 2 85 ARG 85 127 ? ? ? B . n B 2 86 THR 86 128 ? ? ? B . n B 2 87 LEU 87 129 ? ? ? B . n B 2 88 PRO 88 130 ? ? ? B . n B 2 89 PRO 89 131 ? ? ? B . n B 2 90 ALA 90 132 ? ? ? B . n B 2 91 GLY 91 133 ? ? ? B . n B 2 92 ASP 92 134 ? ? ? B . n B 2 93 SER 93 135 ? ? ? B . n B 2 94 GLN 94 136 ? ? ? B . n B 2 95 GLU 95 137 ? ? ? B . n B 2 96 ARG 96 138 ? ? ? B . n B 2 97 SER 97 139 ? ? ? B . n B 2 98 GLY 98 140 ? ? ? B . n B 2 99 THR 99 141 ? ? ? B . n B 2 100 LYS 100 142 ? ? ? B . n B 2 101 HIS 101 143 ? ? ? B . n B 2 102 HIS 102 144 ? ? ? B . n B 2 103 HIS 103 145 ? ? ? B . n B 2 104 HIS 104 146 ? ? ? B . n B 2 105 HIS 105 147 ? ? ? B . n B 2 106 HIS 106 148 ? ? ? B . n # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id CIT _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 601 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id CIT _pdbx_nonpoly_scheme.auth_mon_id CIT _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 410 ? CG ? A LYS 26 CG 2 1 Y 1 A LYS 410 ? CD ? A LYS 26 CD 3 1 Y 1 A LYS 410 ? CE ? A LYS 26 CE 4 1 Y 1 A LYS 410 ? NZ ? A LYS 26 NZ 5 1 Y 1 B LYS 49 ? CG ? B LYS 7 CG 6 1 Y 1 B LYS 49 ? CD ? B LYS 7 CD 7 1 Y 1 B LYS 49 ? CE ? B LYS 7 CE 8 1 Y 1 B LYS 49 ? NZ ? B LYS 7 NZ 9 1 Y 1 B ARG 88 ? CG ? B ARG 46 CG 10 1 Y 1 B ARG 88 ? CD ? B ARG 46 CD 11 1 Y 1 B ARG 88 ? NE ? B ARG 46 NE 12 1 Y 1 B ARG 88 ? CZ ? B ARG 46 CZ 13 1 Y 1 B ARG 88 ? NH1 ? B ARG 46 NH1 14 1 Y 1 B ARG 88 ? NH2 ? B ARG 46 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13rc2_2986: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6Z3G _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.650 _cell.length_a_esd ? _cell.length_b 97.650 _cell.length_b_esd ? _cell.length_c 99.820 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Z3G _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Z3G _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.74 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium acetate, 0.1 M sodium citrate tribasic dihydrate pH 5.5, 24% v/v polyethylene glycol (PEG) 400.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-09-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6Z3G _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.78 _reflns.d_resolution_low 49.91 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7375 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.5 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.78 _reflns_shell.d_res_low 2.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 494 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.129 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.592 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Z3G _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.780 _refine.ls_d_res_low 48.825 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7337 _refine.ls_number_reflns_R_free 379 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.71 _refine.ls_percent_reflns_R_free 5.17 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2365 _refine.ls_R_factor_R_free 0.2878 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2340 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4UHY _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.85 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.46 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1265 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1278 _refine_hist.d_res_high 2.780 _refine_hist.d_res_low 48.825 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 1313 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.624 ? 1786 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 7.531 ? 804 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 194 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 230 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7804 3.1826 . . 126 2173 95.00 . . . 0.3632 . 0.3128 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1826 4.0095 . . 128 2295 99.00 . . . 0.3201 . 0.2672 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0095 48.825 . . 125 2490 100.00 . . . 0.2670 . 0.2133 . . . . . . . . . . . # _struct.entry_id 6Z3G _struct.title 'Repulsive Guidance Molecule A (RGMA) in complex with Growth Differentiation Factor 5 (GDF5)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Z3G _struct_keywords.text ;Repulsive Guidance Molecule, RGM, Bone Morphogenetic Protein, BMP, Growth Differentiation Factor 5, GDF5, Neogenin, axon guidance, TGFbeta signalling, brain development, iron metabolism., SIGNALING PROTEIN ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GDF5_HUMAN P43026 ? 1 ;RQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCC VPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR ; 387 2 UNP RGMA_HUMAN Q96B86 Q96B86-4 2 ;NSEFWSATSGSHAPASDDTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAG DSQERS ; 54 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6Z3G A 3 ? 117 ? P43026 387 ? 501 ? 387 501 2 2 6Z3G B 12 ? 97 ? Q96B86 54 ? 139 ? 54 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Z3G MET A 1 ? UNP P43026 ? ? 'initiating methionine' 385 1 1 6Z3G LYS A 2 ? UNP P43026 ? ? 'expression tag' 386 2 2 6Z3G GLU B 1 ? UNP Q96B86 ? ? 'expression tag' 43 3 2 6Z3G THR B 2 ? UNP Q96B86 ? ? 'expression tag' 44 4 2 6Z3G GLY B 3 ? UNP Q96B86 ? ? 'expression tag' 45 5 2 6Z3G SER B 4 ? UNP Q96B86 ? ? 'expression tag' 46 6 2 6Z3G PRO B 5 ? UNP Q96B86 ? ? 'expression tag' 47 7 2 6Z3G CYS B 6 ? UNP Q96B86 ? ? 'expression tag' 48 8 2 6Z3G LYS B 7 ? UNP Q96B86 ? ? 'expression tag' 49 9 2 6Z3G ILE B 8 ? UNP Q96B86 ? ? 'expression tag' 50 10 2 6Z3G LEU B 9 ? UNP Q96B86 ? ? 'expression tag' 51 11 2 6Z3G LYS B 10 ? UNP Q96B86 ? ? 'expression tag' 52 12 2 6Z3G CYS B 11 ? UNP Q96B86 ? ? 'expression tag' 53 13 2 6Z3G GLY B 98 ? UNP Q96B86 ? ? 'expression tag' 140 14 2 6Z3G THR B 99 ? UNP Q96B86 ? ? 'expression tag' 141 15 2 6Z3G LYS B 100 ? UNP Q96B86 ? ? 'expression tag' 142 16 2 6Z3G HIS B 101 ? UNP Q96B86 ? ? 'expression tag' 143 17 2 6Z3G HIS B 102 ? UNP Q96B86 ? ? 'expression tag' 144 18 2 6Z3G HIS B 103 ? UNP Q96B86 ? ? 'expression tag' 145 19 2 6Z3G HIS B 104 ? UNP Q96B86 ? ? 'expression tag' 146 20 2 6Z3G HIS B 105 ? UNP Q96B86 ? ? 'expression tag' 147 21 2 6Z3G HIS B 106 ? UNP Q96B86 ? ? 'expression tag' 148 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6520 ? 1 MORE -61 ? 1 'SSA (A^2)' 17440 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'surface plasmon resonance' ? 2 1 'light scattering' ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/3 0.5000000000 0.8660254038 0.0000000000 -48.8250000000 0.8660254038 -0.5000000000 0.0000000000 84.5673806796 0.0000000000 0.0000000000 -1.0000000000 33.2733333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 26 ? ASP A 32 ? LYS A 410 ASP A 416 5 ? 7 HELX_P HELX_P2 AA2 ARG A 54 ? GLU A 58 ? ARG A 438 GLU A 442 5 ? 5 HELX_P HELX_P3 AA3 THR A 60 ? ASP A 73 ? THR A 444 ASP A 457 1 ? 14 HELX_P HELX_P4 AA4 LYS B 7 ? PHE B 15 ? LYS B 49 PHE B 57 1 ? 9 HELX_P HELX_P5 AA5 ALA B 36 ? ARG B 46 ? ALA B 78 ARG B 88 1 ? 11 HELX_P HELX_P6 AA6 ASP B 54 ? SER B 69 ? ASP B 96 SER B 111 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 400 A CYS 466 1_555 ? ? ? ? ? ? ? 2.047 ? ? disulf2 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 114 SG ? ? A CYS 429 A CYS 498 1_555 ? ? ? ? ? ? ? 2.044 ? ? disulf3 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 433 A CYS 500 1_555 ? ? ? ? ? ? ? 2.052 ? ? disulf4 disulf ? ? A CYS 81 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 465 A CYS 465 12_565 ? ? ? ? ? ? ? 2.023 ? ? disulf5 disulf ? ? B CYS 6 SG ? ? ? 1_555 B CYS 51 SG ? ? B CYS 48 B CYS 93 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf6 disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 43 SG ? ? B CYS 53 B CYS 85 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf7 disulf ? ? B CYS 34 SG ? ? ? 1_555 B CYS 73 SG ? ? B CYS 76 B CYS 115 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 36 A . ? ALA 420 A PRO 37 A ? PRO 421 A 1 -4.87 2 PHE 51 A . ? PHE 435 A PRO 52 A ? PRO 436 A 1 -1.88 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 17 ? LYS A 19 ? SER A 401 LYS A 403 AA1 2 HIS A 44 ? GLU A 46 ? HIS A 428 GLU A 430 AA2 1 HIS A 22 ? ASN A 24 ? HIS A 406 ASN A 408 AA2 2 GLU A 39 ? GLU A 41 ? GLU A 423 GLU A 425 AA3 1 ILE A 34 ? ALA A 36 ? ILE A 418 ALA A 420 AA3 2 CYS A 82 ? ILE A 95 ? CYS A 466 ILE A 479 AA3 3 VAL A 101 ? CYS A 116 ? VAL A 485 CYS A 500 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 17 ? N SER A 401 O GLU A 46 ? O GLU A 430 AA2 1 2 N VAL A 23 ? N VAL A 407 O TYR A 40 ? O TYR A 424 AA3 1 2 N ILE A 35 ? N ILE A 419 O LEU A 93 ? O LEU A 477 AA3 2 3 N ARG A 86 ? N ARG A 470 O GLU A 112 ? O GLU A 496 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CIT _struct_site.pdbx_auth_seq_id 601 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue CIT A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 19 ? LYS A 403 . ? 1_555 ? 2 AC1 4 ALA A 20 ? ALA A 404 . ? 1_555 ? 3 AC1 4 HIS A 56 ? HIS A 440 . ? 11_455 ? 4 AC1 4 ARG A 86 ? ARG A 470 . ? 11_455 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 417 ? ? -143.53 -24.63 2 1 ILE A 419 ? ? -85.67 -72.40 3 1 PHE A 427 ? ? 68.07 167.55 4 1 CYS A 433 ? ? -118.29 77.00 5 1 GLU A 442 ? ? 31.96 68.60 6 1 ASP A 480 ? ? -84.70 -153.91 7 1 LYS B 49 ? ? -144.79 52.58 8 1 CYS B 93 ? ? -97.83 30.97 9 1 ASN B 114 ? ? 57.54 81.22 10 1 CYS B 115 ? ? -106.16 60.05 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -44.0027 25.8121 9.7377 0.5945 ? -0.1734 ? 0.0872 ? 0.7066 ? -0.0136 ? 0.4720 ? 2.2797 ? -2.5503 ? -0.5221 ? 4.7923 ? 4.2965 ? 6.2090 ? 0.0538 ? 0.1060 ? 0.1085 ? -0.4783 ? 0.1181 ? -0.1329 ? -0.4183 ? 0.4438 ? -0.2042 ? 2 'X-RAY DIFFRACTION' ? refined -29.1674 10.1992 21.0140 2.4832 ? -0.4943 ? -0.5069 ? 2.0977 ? -0.1994 ? 2.2690 ? 1.2774 ? 0.0698 ? 1.8012 ? 0.0000 ? 0.1374 ? 2.7443 ? 0.4827 ? 0.2917 ? 0.2563 ? 1.0831 ? -0.3103 ? -1.8007 ? -0.7593 ? 0.5073 ? -0.0068 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;(chain 'A' and resid 397 through 501) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;(chain 'B' and resid 47 through 116) ; # _pdbx_entry_details.entry_id 6Z3G _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 385 ? A MET 1 2 1 Y 1 A LYS 386 ? A LYS 2 3 1 Y 1 A ARG 387 ? A ARG 3 4 1 Y 1 A GLN 388 ? A GLN 4 5 1 Y 1 A GLY 389 ? A GLY 5 6 1 Y 1 A LYS 390 ? A LYS 6 7 1 Y 1 A ARG 391 ? A ARG 7 8 1 Y 1 A PRO 392 ? A PRO 8 9 1 Y 1 A SER 393 ? A SER 9 10 1 Y 1 A LYS 394 ? A LYS 10 11 1 Y 1 A ASN 395 ? A ASN 11 12 1 Y 1 A LEU 396 ? A LEU 12 13 1 Y 1 B GLU 43 ? B GLU 1 14 1 Y 1 B THR 44 ? B THR 2 15 1 Y 1 B GLY 45 ? B GLY 3 16 1 Y 1 B SER 46 ? B SER 4 17 1 Y 1 B THR 61 ? B THR 19 18 1 Y 1 B SER 62 ? B SER 20 19 1 Y 1 B GLY 63 ? B GLY 21 20 1 Y 1 B SER 64 ? B SER 22 21 1 Y 1 B HIS 65 ? B HIS 23 22 1 Y 1 B ALA 66 ? B ALA 24 23 1 Y 1 B PRO 67 ? B PRO 25 24 1 Y 1 B ALA 68 ? B ALA 26 25 1 Y 1 B SER 69 ? B SER 27 26 1 Y 1 B ASP 70 ? B ASP 28 27 1 Y 1 B ASP 71 ? B ASP 29 28 1 Y 1 B THR 72 ? B THR 30 29 1 Y 1 B PRO 73 ? B PRO 31 30 1 Y 1 B LYS 117 ? B LYS 75 31 1 Y 1 B ASP 118 ? B ASP 76 32 1 Y 1 B GLY 119 ? B GLY 77 33 1 Y 1 B PRO 120 ? B PRO 78 34 1 Y 1 B THR 121 ? B THR 79 35 1 Y 1 B SER 122 ? B SER 80 36 1 Y 1 B GLN 123 ? B GLN 81 37 1 Y 1 B PRO 124 ? B PRO 82 38 1 Y 1 B ARG 125 ? B ARG 83 39 1 Y 1 B LEU 126 ? B LEU 84 40 1 Y 1 B ARG 127 ? B ARG 85 41 1 Y 1 B THR 128 ? B THR 86 42 1 Y 1 B LEU 129 ? B LEU 87 43 1 Y 1 B PRO 130 ? B PRO 88 44 1 Y 1 B PRO 131 ? B PRO 89 45 1 Y 1 B ALA 132 ? B ALA 90 46 1 Y 1 B GLY 133 ? B GLY 91 47 1 Y 1 B ASP 134 ? B ASP 92 48 1 Y 1 B SER 135 ? B SER 93 49 1 Y 1 B GLN 136 ? B GLN 94 50 1 Y 1 B GLU 137 ? B GLU 95 51 1 Y 1 B ARG 138 ? B ARG 96 52 1 Y 1 B SER 139 ? B SER 97 53 1 Y 1 B GLY 140 ? B GLY 98 54 1 Y 1 B THR 141 ? B THR 99 55 1 Y 1 B LYS 142 ? B LYS 100 56 1 Y 1 B HIS 143 ? B HIS 101 57 1 Y 1 B HIS 144 ? B HIS 102 58 1 Y 1 B HIS 145 ? B HIS 103 59 1 Y 1 B HIS 146 ? B HIS 104 60 1 Y 1 B HIS 147 ? B HIS 105 61 1 Y 1 B HIS 148 ? B HIS 106 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CIT C1 C N N 74 CIT O1 O N N 75 CIT O2 O N N 76 CIT C2 C N N 77 CIT C3 C N N 78 CIT O7 O N N 79 CIT C4 C N N 80 CIT C5 C N N 81 CIT O3 O N N 82 CIT O4 O N N 83 CIT C6 C N N 84 CIT O5 O N N 85 CIT O6 O N N 86 CIT HO2 H N N 87 CIT H21 H N N 88 CIT H22 H N N 89 CIT HO7 H N N 90 CIT H41 H N N 91 CIT H42 H N N 92 CIT HO4 H N N 93 CIT HO6 H N N 94 CYS N N N N 95 CYS CA C N R 96 CYS C C N N 97 CYS O O N N 98 CYS CB C N N 99 CYS SG S N N 100 CYS OXT O N N 101 CYS H H N N 102 CYS H2 H N N 103 CYS HA H N N 104 CYS HB2 H N N 105 CYS HB3 H N N 106 CYS HG H N N 107 CYS HXT H N N 108 GLN N N N N 109 GLN CA C N S 110 GLN C C N N 111 GLN O O N N 112 GLN CB C N N 113 GLN CG C N N 114 GLN CD C N N 115 GLN OE1 O N N 116 GLN NE2 N N N 117 GLN OXT O N N 118 GLN H H N N 119 GLN H2 H N N 120 GLN HA H N N 121 GLN HB2 H N N 122 GLN HB3 H N N 123 GLN HG2 H N N 124 GLN HG3 H N N 125 GLN HE21 H N N 126 GLN HE22 H N N 127 GLN HXT H N N 128 GLU N N N N 129 GLU CA C N S 130 GLU C C N N 131 GLU O O N N 132 GLU CB C N N 133 GLU CG C N N 134 GLU CD C N N 135 GLU OE1 O N N 136 GLU OE2 O N N 137 GLU OXT O N N 138 GLU H H N N 139 GLU H2 H N N 140 GLU HA H N N 141 GLU HB2 H N N 142 GLU HB3 H N N 143 GLU HG2 H N N 144 GLU HG3 H N N 145 GLU HE2 H N N 146 GLU HXT H N N 147 GLY N N N N 148 GLY CA C N N 149 GLY C C N N 150 GLY O O N N 151 GLY OXT O N N 152 GLY H H N N 153 GLY H2 H N N 154 GLY HA2 H N N 155 GLY HA3 H N N 156 GLY HXT H N N 157 HIS N N N N 158 HIS CA C N S 159 HIS C C N N 160 HIS O O N N 161 HIS CB C N N 162 HIS CG C Y N 163 HIS ND1 N Y N 164 HIS CD2 C Y N 165 HIS CE1 C Y N 166 HIS NE2 N Y N 167 HIS OXT O N N 168 HIS H H N N 169 HIS H2 H N N 170 HIS HA H N N 171 HIS HB2 H N N 172 HIS HB3 H N N 173 HIS HD1 H N N 174 HIS HD2 H N N 175 HIS HE1 H N N 176 HIS HE2 H N N 177 HIS HXT H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CIT C1 O1 doub N N 70 CIT C1 O2 sing N N 71 CIT C1 C2 sing N N 72 CIT O2 HO2 sing N N 73 CIT C2 C3 sing N N 74 CIT C2 H21 sing N N 75 CIT C2 H22 sing N N 76 CIT C3 O7 sing N N 77 CIT C3 C4 sing N N 78 CIT C3 C6 sing N N 79 CIT O7 HO7 sing N N 80 CIT C4 C5 sing N N 81 CIT C4 H41 sing N N 82 CIT C4 H42 sing N N 83 CIT C5 O3 doub N N 84 CIT C5 O4 sing N N 85 CIT O4 HO4 sing N N 86 CIT C6 O5 doub N N 87 CIT C6 O6 sing N N 88 CIT O6 HO6 sing N N 89 CYS N CA sing N N 90 CYS N H sing N N 91 CYS N H2 sing N N 92 CYS CA C sing N N 93 CYS CA CB sing N N 94 CYS CA HA sing N N 95 CYS C O doub N N 96 CYS C OXT sing N N 97 CYS CB SG sing N N 98 CYS CB HB2 sing N N 99 CYS CB HB3 sing N N 100 CYS SG HG sing N N 101 CYS OXT HXT sing N N 102 GLN N CA sing N N 103 GLN N H sing N N 104 GLN N H2 sing N N 105 GLN CA C sing N N 106 GLN CA CB sing N N 107 GLN CA HA sing N N 108 GLN C O doub N N 109 GLN C OXT sing N N 110 GLN CB CG sing N N 111 GLN CB HB2 sing N N 112 GLN CB HB3 sing N N 113 GLN CG CD sing N N 114 GLN CG HG2 sing N N 115 GLN CG HG3 sing N N 116 GLN CD OE1 doub N N 117 GLN CD NE2 sing N N 118 GLN NE2 HE21 sing N N 119 GLN NE2 HE22 sing N N 120 GLN OXT HXT sing N N 121 GLU N CA sing N N 122 GLU N H sing N N 123 GLU N H2 sing N N 124 GLU CA C sing N N 125 GLU CA CB sing N N 126 GLU CA HA sing N N 127 GLU C O doub N N 128 GLU C OXT sing N N 129 GLU CB CG sing N N 130 GLU CB HB2 sing N N 131 GLU CB HB3 sing N N 132 GLU CG CD sing N N 133 GLU CG HG2 sing N N 134 GLU CG HG3 sing N N 135 GLU CD OE1 doub N N 136 GLU CD OE2 sing N N 137 GLU OE2 HE2 sing N N 138 GLU OXT HXT sing N N 139 GLY N CA sing N N 140 GLY N H sing N N 141 GLY N H2 sing N N 142 GLY CA C sing N N 143 GLY CA HA2 sing N N 144 GLY CA HA3 sing N N 145 GLY C O doub N N 146 GLY C OXT sing N N 147 GLY OXT HXT sing N N 148 HIS N CA sing N N 149 HIS N H sing N N 150 HIS N H2 sing N N 151 HIS CA C sing N N 152 HIS CA CB sing N N 153 HIS CA HA sing N N 154 HIS C O doub N N 155 HIS C OXT sing N N 156 HIS CB CG sing N N 157 HIS CB HB2 sing N N 158 HIS CB HB3 sing N N 159 HIS CG ND1 sing Y N 160 HIS CG CD2 doub Y N 161 HIS ND1 CE1 doub Y N 162 HIS ND1 HD1 sing N N 163 HIS CD2 NE2 sing Y N 164 HIS CD2 HD2 sing N N 165 HIS CE1 NE2 sing Y N 166 HIS CE1 HE1 sing N N 167 HIS NE2 HE2 sing N N 168 HIS OXT HXT sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' C20724/A14414 1 'Cancer Research UK' 'United Kingdom' C20724/A26752 2 'European Research Council (ERC)' 'United Kingdom' 647278 3 'German Research Foundation (DFG)' Germany MU1095/3-2 4 'German Research Foundation (DFG)' Germany MU1095/5-1 5 'Wellcome Trust' 'United Kingdom' 203852/Z/16/2 6 'Human Frontier Science Program (HFSP)' 'United Kingdom' LT000021/2014-L 7 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CIT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CIT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4UHY _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6Z3G _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010241 _atom_sites.fract_transf_matrix[1][2] 0.005912 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011825 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010018 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_