data_6Z3H # _entry.id 6Z3H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Z3H pdb_00006z3h 10.2210/pdb6z3h/pdb WWPDB D_1292108831 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-01 2 'Structure model' 1 1 2020-07-08 3 'Structure model' 1 2 2020-07-15 4 'Structure model' 1 3 2024-01-24 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' struct_conn 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Z3H _pdbx_database_status.recvd_initial_deposition_date 2020-05-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details '6Z3G contains RGMA in complex with GDF5' _pdbx_database_related.db_id 6Z3G _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Malinauskas, T.' 1 0000-0002-4847-5529 'Peer, T.V.' 2 ? 'Bishop, B.' 3 ? 'Muller, T.D.' 4 0000-0003-1862-7357 'Siebold, C.' 5 0000-0002-6635-3621 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 15620 _citation.page_last 15631 _citation.title 'Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2000561117 _citation.pdbx_database_id_PubMed 32576689 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Malinauskas, T.' 1 ? primary 'Peer, T.V.' 2 ? primary 'Bishop, B.' 3 ? primary 'Mueller, T.D.' 4 ? primary 'Siebold, C.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth/differentiation factor 5' 13405.481 1 ? ? ? ? 2 polymer man 'RGM domain family member B' 10532.701 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;GDF-5,Bone morphogenetic protein 14,BMP-14,Cartilage-derived morphogenetic protein 1,CDMP-1,Lipopolysaccharide-associated protein 4,LPS-associated protein 4,Radotermin ; 2 'DRG11-responsive axonal guidance and outgrowth of neurite,DRAGON' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MKRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPT CCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR ; ;MKRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPT CCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR ; A ? 2 'polypeptide(L)' no no ;ETGQCRIQKCTTDFVSLTSHLNSAVDGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSS TNPEVTHGTKHHHHHH ; ;ETGQCRIQKCTTDFVSLTSHLNSAVDGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSS TNPEVTHGTKHHHHHH ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ARG n 1 4 GLN n 1 5 GLY n 1 6 LYS n 1 7 ARG n 1 8 PRO n 1 9 SER n 1 10 LYS n 1 11 ASN n 1 12 LEU n 1 13 LYS n 1 14 ALA n 1 15 ARG n 1 16 CYS n 1 17 SER n 1 18 ARG n 1 19 LYS n 1 20 ALA n 1 21 LEU n 1 22 HIS n 1 23 VAL n 1 24 ASN n 1 25 PHE n 1 26 LYS n 1 27 ASP n 1 28 MET n 1 29 GLY n 1 30 TRP n 1 31 ASP n 1 32 ASP n 1 33 TRP n 1 34 ILE n 1 35 ILE n 1 36 ALA n 1 37 PRO n 1 38 LEU n 1 39 GLU n 1 40 TYR n 1 41 GLU n 1 42 ALA n 1 43 PHE n 1 44 HIS n 1 45 CYS n 1 46 GLU n 1 47 GLY n 1 48 LEU n 1 49 CYS n 1 50 GLU n 1 51 PHE n 1 52 PRO n 1 53 LEU n 1 54 ARG n 1 55 SER n 1 56 HIS n 1 57 LEU n 1 58 GLU n 1 59 PRO n 1 60 THR n 1 61 ASN n 1 62 HIS n 1 63 ALA n 1 64 VAL n 1 65 ILE n 1 66 GLN n 1 67 THR n 1 68 LEU n 1 69 MET n 1 70 ASN n 1 71 SER n 1 72 MET n 1 73 ASP n 1 74 PRO n 1 75 GLU n 1 76 SER n 1 77 THR n 1 78 PRO n 1 79 PRO n 1 80 THR n 1 81 CYS n 1 82 CYS n 1 83 VAL n 1 84 PRO n 1 85 THR n 1 86 ARG n 1 87 LEU n 1 88 SER n 1 89 PRO n 1 90 ILE n 1 91 SER n 1 92 ILE n 1 93 LEU n 1 94 PHE n 1 95 ILE n 1 96 ASP n 1 97 SER n 1 98 ALA n 1 99 ASN n 1 100 ASN n 1 101 VAL n 1 102 VAL n 1 103 TYR n 1 104 LYS n 1 105 GLN n 1 106 TYR n 1 107 GLU n 1 108 ASP n 1 109 MET n 1 110 VAL n 1 111 VAL n 1 112 GLU n 1 113 SER n 1 114 CYS n 1 115 GLY n 1 116 CYS n 1 117 ARG n 2 1 GLU n 2 2 THR n 2 3 GLY n 2 4 GLN n 2 5 CYS n 2 6 ARG n 2 7 ILE n 2 8 GLN n 2 9 LYS n 2 10 CYS n 2 11 THR n 2 12 THR n 2 13 ASP n 2 14 PHE n 2 15 VAL n 2 16 SER n 2 17 LEU n 2 18 THR n 2 19 SER n 2 20 HIS n 2 21 LEU n 2 22 ASN n 2 23 SER n 2 24 ALA n 2 25 VAL n 2 26 ASP n 2 27 GLY n 2 28 PHE n 2 29 ASP n 2 30 SER n 2 31 GLU n 2 32 PHE n 2 33 CYS n 2 34 LYS n 2 35 ALA n 2 36 LEU n 2 37 ARG n 2 38 ALA n 2 39 TYR n 2 40 ALA n 2 41 GLY n 2 42 CYS n 2 43 THR n 2 44 GLN n 2 45 ARG n 2 46 THR n 2 47 SER n 2 48 LYS n 2 49 ALA n 2 50 CYS n 2 51 ARG n 2 52 GLY n 2 53 ASN n 2 54 LEU n 2 55 VAL n 2 56 TYR n 2 57 HIS n 2 58 SER n 2 59 ALA n 2 60 VAL n 2 61 LEU n 2 62 GLY n 2 63 ILE n 2 64 SER n 2 65 ASP n 2 66 LEU n 2 67 MET n 2 68 SER n 2 69 GLN n 2 70 ARG n 2 71 ASN n 2 72 CYS n 2 73 SER n 2 74 LYS n 2 75 ASP n 2 76 GLY n 2 77 PRO n 2 78 THR n 2 79 SER n 2 80 SER n 2 81 THR n 2 82 ASN n 2 83 PRO n 2 84 GLU n 2 85 VAL n 2 86 THR n 2 87 HIS n 2 88 GLY n 2 89 THR n 2 90 LYS n 2 91 HIS n 2 92 HIS n 2 93 HIS n 2 94 HIS n 2 95 HIS n 2 96 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 117 Human ? 'GDF5, BMP14, CDMP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 96 Human ? RGMB ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HEK293T CRL-11268 ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 385 ? ? ? A . n A 1 2 LYS 2 386 ? ? ? A . n A 1 3 ARG 3 387 ? ? ? A . n A 1 4 GLN 4 388 ? ? ? A . n A 1 5 GLY 5 389 ? ? ? A . n A 1 6 LYS 6 390 ? ? ? A . n A 1 7 ARG 7 391 ? ? ? A . n A 1 8 PRO 8 392 ? ? ? A . n A 1 9 SER 9 393 ? ? ? A . n A 1 10 LYS 10 394 ? ? ? A . n A 1 11 ASN 11 395 ? ? ? A . n A 1 12 LEU 12 396 ? ? ? A . n A 1 13 LYS 13 397 397 LYS LYS A . n A 1 14 ALA 14 398 398 ALA ALA A . n A 1 15 ARG 15 399 399 ARG ARG A . n A 1 16 CYS 16 400 400 CYS CYS A . n A 1 17 SER 17 401 401 SER SER A . n A 1 18 ARG 18 402 402 ARG ARG A . n A 1 19 LYS 19 403 403 LYS LYS A . n A 1 20 ALA 20 404 404 ALA ALA A . n A 1 21 LEU 21 405 405 LEU LEU A . n A 1 22 HIS 22 406 406 HIS HIS A . n A 1 23 VAL 23 407 407 VAL VAL A . n A 1 24 ASN 24 408 408 ASN ASN A . n A 1 25 PHE 25 409 409 PHE PHE A . n A 1 26 LYS 26 410 410 LYS LYS A . n A 1 27 ASP 27 411 411 ASP ASP A . n A 1 28 MET 28 412 412 MET MET A . n A 1 29 GLY 29 413 413 GLY GLY A . n A 1 30 TRP 30 414 414 TRP TRP A . n A 1 31 ASP 31 415 415 ASP ASP A . n A 1 32 ASP 32 416 416 ASP ASP A . n A 1 33 TRP 33 417 417 TRP TRP A . n A 1 34 ILE 34 418 418 ILE ILE A . n A 1 35 ILE 35 419 419 ILE ILE A . n A 1 36 ALA 36 420 420 ALA ALA A . n A 1 37 PRO 37 421 421 PRO PRO A . n A 1 38 LEU 38 422 422 LEU LEU A . n A 1 39 GLU 39 423 423 GLU GLU A . n A 1 40 TYR 40 424 424 TYR TYR A . n A 1 41 GLU 41 425 425 GLU GLU A . n A 1 42 ALA 42 426 426 ALA ALA A . n A 1 43 PHE 43 427 427 PHE PHE A . n A 1 44 HIS 44 428 428 HIS HIS A . n A 1 45 CYS 45 429 429 CYS CYS A . n A 1 46 GLU 46 430 430 GLU GLU A . n A 1 47 GLY 47 431 431 GLY GLY A . n A 1 48 LEU 48 432 432 LEU LEU A . n A 1 49 CYS 49 433 433 CYS CYS A . n A 1 50 GLU 50 434 434 GLU GLU A . n A 1 51 PHE 51 435 435 PHE PHE A . n A 1 52 PRO 52 436 436 PRO PRO A . n A 1 53 LEU 53 437 437 LEU LEU A . n A 1 54 ARG 54 438 438 ARG ARG A . n A 1 55 SER 55 439 439 SER SER A . n A 1 56 HIS 56 440 440 HIS HIS A . n A 1 57 LEU 57 441 441 LEU LEU A . n A 1 58 GLU 58 442 442 GLU GLU A . n A 1 59 PRO 59 443 443 PRO PRO A . n A 1 60 THR 60 444 444 THR THR A . n A 1 61 ASN 61 445 445 ASN ASN A . n A 1 62 HIS 62 446 446 HIS HIS A . n A 1 63 ALA 63 447 447 ALA ALA A . n A 1 64 VAL 64 448 448 VAL VAL A . n A 1 65 ILE 65 449 449 ILE ILE A . n A 1 66 GLN 66 450 450 GLN GLN A . n A 1 67 THR 67 451 451 THR THR A . n A 1 68 LEU 68 452 452 LEU LEU A . n A 1 69 MET 69 453 453 MET MET A . n A 1 70 ASN 70 454 454 ASN ASN A . n A 1 71 SER 71 455 455 SER SER A . n A 1 72 MET 72 456 456 MET MET A . n A 1 73 ASP 73 457 457 ASP ASP A . n A 1 74 PRO 74 458 458 PRO PRO A . n A 1 75 GLU 75 459 459 GLU GLU A . n A 1 76 SER 76 460 460 SER SER A . n A 1 77 THR 77 461 461 THR THR A . n A 1 78 PRO 78 462 462 PRO PRO A . n A 1 79 PRO 79 463 463 PRO PRO A . n A 1 80 THR 80 464 464 THR THR A . n A 1 81 CYS 81 465 465 CYS CYS A . n A 1 82 CYS 82 466 466 CYS CYS A . n A 1 83 VAL 83 467 467 VAL VAL A . n A 1 84 PRO 84 468 468 PRO PRO A . n A 1 85 THR 85 469 469 THR THR A . n A 1 86 ARG 86 470 470 ARG ARG A . n A 1 87 LEU 87 471 471 LEU LEU A . n A 1 88 SER 88 472 472 SER SER A . n A 1 89 PRO 89 473 473 PRO PRO A . n A 1 90 ILE 90 474 474 ILE ILE A . n A 1 91 SER 91 475 475 SER SER A . n A 1 92 ILE 92 476 476 ILE ILE A . n A 1 93 LEU 93 477 477 LEU LEU A . n A 1 94 PHE 94 478 478 PHE PHE A . n A 1 95 ILE 95 479 479 ILE ILE A . n A 1 96 ASP 96 480 480 ASP ASP A . n A 1 97 SER 97 481 481 SER SER A . n A 1 98 ALA 98 482 482 ALA ALA A . n A 1 99 ASN 99 483 483 ASN ASN A . n A 1 100 ASN 100 484 484 ASN ASN A . n A 1 101 VAL 101 485 485 VAL VAL A . n A 1 102 VAL 102 486 486 VAL VAL A . n A 1 103 TYR 103 487 487 TYR TYR A . n A 1 104 LYS 104 488 488 LYS LYS A . n A 1 105 GLN 105 489 489 GLN GLN A . n A 1 106 TYR 106 490 490 TYR TYR A . n A 1 107 GLU 107 491 491 GLU GLU A . n A 1 108 ASP 108 492 492 ASP ASP A . n A 1 109 MET 109 493 493 MET MET A . n A 1 110 VAL 110 494 494 VAL VAL A . n A 1 111 VAL 111 495 495 VAL VAL A . n A 1 112 GLU 112 496 496 GLU GLU A . n A 1 113 SER 113 497 497 SER SER A . n A 1 114 CYS 114 498 498 CYS CYS A . n A 1 115 GLY 115 499 499 GLY GLY A . n A 1 116 CYS 116 500 500 CYS CYS A . n A 1 117 ARG 117 501 501 ARG ARG A . n B 2 1 GLU 1 50 ? ? ? B . n B 2 2 THR 2 51 ? ? ? B . n B 2 3 GLY 3 52 ? ? ? B . n B 2 4 GLN 4 53 53 GLN GLN B . n B 2 5 CYS 5 54 54 CYS CYS B . n B 2 6 ARG 6 55 55 ARG ARG B . n B 2 7 ILE 7 56 56 ILE ILE B . n B 2 8 GLN 8 57 57 GLN GLN B . n B 2 9 LYS 9 58 58 LYS LYS B . n B 2 10 CYS 10 59 59 CYS CYS B . n B 2 11 THR 11 60 60 THR THR B . n B 2 12 THR 12 61 61 THR THR B . n B 2 13 ASP 13 62 62 ASP ASP B . n B 2 14 PHE 14 63 63 PHE PHE B . n B 2 15 VAL 15 64 64 VAL VAL B . n B 2 16 SER 16 65 65 SER SER B . n B 2 17 LEU 17 66 66 LEU LEU B . n B 2 18 THR 18 67 67 THR THR B . n B 2 19 SER 19 68 68 SER SER B . n B 2 20 HIS 20 69 ? ? ? B . n B 2 21 LEU 21 70 ? ? ? B . n B 2 22 ASN 22 71 ? ? ? B . n B 2 23 SER 23 72 ? ? ? B . n B 2 24 ALA 24 73 ? ? ? B . n B 2 25 VAL 25 74 ? ? ? B . n B 2 26 ASP 26 75 ? ? ? B . n B 2 27 GLY 27 76 ? ? ? B . n B 2 28 PHE 28 77 ? ? ? B . n B 2 29 ASP 29 78 ? ? ? B . n B 2 30 SER 30 79 ? ? ? B . n B 2 31 GLU 31 80 ? ? ? B . n B 2 32 PHE 32 81 ? ? ? B . n B 2 33 CYS 33 82 82 CYS CYS B . n B 2 34 LYS 34 83 83 LYS LYS B . n B 2 35 ALA 35 84 84 ALA ALA B . n B 2 36 LEU 36 85 85 LEU LEU B . n B 2 37 ARG 37 86 86 ARG ARG B . n B 2 38 ALA 38 87 87 ALA ALA B . n B 2 39 TYR 39 88 88 TYR TYR B . n B 2 40 ALA 40 89 89 ALA ALA B . n B 2 41 GLY 41 90 90 GLY GLY B . n B 2 42 CYS 42 91 91 CYS CYS B . n B 2 43 THR 43 92 92 THR THR B . n B 2 44 GLN 44 93 93 GLN GLN B . n B 2 45 ARG 45 94 94 ARG ARG B . n B 2 46 THR 46 95 95 THR THR B . n B 2 47 SER 47 96 96 SER SER B . n B 2 48 LYS 48 97 97 LYS LYS B . n B 2 49 ALA 49 98 98 ALA ALA B . n B 2 50 CYS 50 99 99 CYS CYS B . n B 2 51 ARG 51 100 100 ARG ARG B . n B 2 52 GLY 52 101 101 GLY GLY B . n B 2 53 ASN 53 102 102 ASN ASN B . n B 2 54 LEU 54 103 103 LEU LEU B . n B 2 55 VAL 55 104 104 VAL VAL B . n B 2 56 TYR 56 105 105 TYR TYR B . n B 2 57 HIS 57 106 106 HIS HIS B . n B 2 58 SER 58 107 107 SER SER B . n B 2 59 ALA 59 108 108 ALA ALA B . n B 2 60 VAL 60 109 109 VAL VAL B . n B 2 61 LEU 61 110 110 LEU LEU B . n B 2 62 GLY 62 111 111 GLY GLY B . n B 2 63 ILE 63 112 112 ILE ILE B . n B 2 64 SER 64 113 113 SER SER B . n B 2 65 ASP 65 114 114 ASP ASP B . n B 2 66 LEU 66 115 115 LEU LEU B . n B 2 67 MET 67 116 116 MET MET B . n B 2 68 SER 68 117 117 SER SER B . n B 2 69 GLN 69 118 118 GLN GLN B . n B 2 70 ARG 70 119 119 ARG ARG B . n B 2 71 ASN 71 120 120 ASN ASN B . n B 2 72 CYS 72 121 121 CYS CYS B . n B 2 73 SER 73 122 ? ? ? B . n B 2 74 LYS 74 123 ? ? ? B . n B 2 75 ASP 75 124 ? ? ? B . n B 2 76 GLY 76 125 ? ? ? B . n B 2 77 PRO 77 126 ? ? ? B . n B 2 78 THR 78 127 ? ? ? B . n B 2 79 SER 79 128 ? ? ? B . n B 2 80 SER 80 129 ? ? ? B . n B 2 81 THR 81 130 ? ? ? B . n B 2 82 ASN 82 131 ? ? ? B . n B 2 83 PRO 83 132 ? ? ? B . n B 2 84 GLU 84 133 ? ? ? B . n B 2 85 VAL 85 134 ? ? ? B . n B 2 86 THR 86 135 ? ? ? B . n B 2 87 HIS 87 136 ? ? ? B . n B 2 88 GLY 88 137 ? ? ? B . n B 2 89 THR 89 138 ? ? ? B . n B 2 90 LYS 90 139 ? ? ? B . n B 2 91 HIS 91 140 ? ? ? B . n B 2 92 HIS 92 141 ? ? ? B . n B 2 93 HIS 93 142 ? ? ? B . n B 2 94 HIS 94 143 ? ? ? B . n B 2 95 HIS 95 144 ? ? ? B . n B 2 96 HIS 96 145 ? ? ? B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 397 ? CG ? A LYS 13 CG 2 1 Y 1 A LYS 397 ? CD ? A LYS 13 CD 3 1 Y 1 A LYS 397 ? CE ? A LYS 13 CE 4 1 Y 1 A LYS 397 ? NZ ? A LYS 13 NZ 5 1 Y 1 B LYS 83 ? CG ? B LYS 34 CG 6 1 Y 1 B LYS 83 ? CD ? B LYS 34 CD 7 1 Y 1 B LYS 83 ? CE ? B LYS 34 CE 8 1 Y 1 B LYS 83 ? NZ ? B LYS 34 NZ 9 1 Y 1 B ARG 86 ? CG ? B ARG 37 CG 10 1 Y 1 B ARG 86 ? CD ? B ARG 37 CD 11 1 Y 1 B ARG 86 ? NE ? B ARG 37 NE 12 1 Y 1 B ARG 86 ? CZ ? B ARG 37 CZ 13 1 Y 1 B ARG 86 ? NH1 ? B ARG 37 NH1 14 1 Y 1 B ARG 86 ? NH2 ? B ARG 37 NH2 15 1 Y 1 B LYS 97 ? CG ? B LYS 48 CG 16 1 Y 1 B LYS 97 ? CD ? B LYS 48 CD 17 1 Y 1 B LYS 97 ? CE ? B LYS 48 CE 18 1 Y 1 B LYS 97 ? NZ ? B LYS 48 NZ 19 1 Y 1 B GLN 118 ? CG ? B GLN 69 CG 20 1 Y 1 B GLN 118 ? CD ? B GLN 69 CD 21 1 Y 1 B GLN 118 ? OE1 ? B GLN 69 OE1 22 1 Y 1 B GLN 118 ? NE2 ? B GLN 69 NE2 23 1 Y 1 B ARG 119 ? CG ? B ARG 70 CG 24 1 Y 1 B ARG 119 ? CD ? B ARG 70 CD 25 1 Y 1 B ARG 119 ? NE ? B ARG 70 NE 26 1 Y 1 B ARG 119 ? CZ ? B ARG 70 CZ 27 1 Y 1 B ARG 119 ? NH1 ? B ARG 70 NH1 28 1 Y 1 B ARG 119 ? NH2 ? B ARG 70 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.15rc3_3435: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6Z3H _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.860 _cell.length_a_esd ? _cell.length_b 98.860 _cell.length_b_esd ? _cell.length_c 99.810 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Z3H _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Z3H _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.94 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M (NH4)2SO4, 0.1 M sodium acetate pH 4.6, 35% w/v pentaerythritol ethoxylate (15/4 EO/OH; average MW 797 Da)' _exptl_crystal_grow.pdbx_pH_range 4.6-8.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-09-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6Z3H _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.13 _reflns.d_resolution_low 64.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5352 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 35.8 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.13 _reflns_shell.d_res_low 3.21 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 380 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.806 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Z3H _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.158 _refine.ls_d_res_low 49.430 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4299 _refine.ls_number_reflns_R_free 191 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 80.69 _refine.ls_percent_reflns_R_free 4.44 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2362 _refine.ls_R_factor_R_free 0.2682 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2345 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4UI0 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.05 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.10 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1230 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1230 _refine_hist.d_res_high 3.158 _refine_hist.d_res_low 49.430 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.001 ? 1254 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.376 ? 1703 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 9.344 ? 761 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.036 ? 196 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 220 ? f_plane_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.158 _refine_ls_shell.d_res_low 49.43 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 191 _refine_ls_shell.number_reflns_R_work 4108 _refine_ls_shell.percent_reflns_obs 81.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2682 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2345 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6Z3H _struct.title 'Repulsive Guidance Molecule B (RGMB) in complex with Growth Differentiation Factor 5 (GDF5) (crystal form 2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Z3H _struct_keywords.text ;Repulsive Guidance Molecule, RGM, Bone Morphogenetic Protein, BMP, Growth Differentiation Factor 5, GDF5, Neogenin, axon guidance, TGFbeta signalling, brain development, iron metabolism., SIGNALING PROTEIN ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GDF5_HUMAN P43026 ? 1 ;RQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCC VPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR ; 387 2 UNP RGMB_HUMAN Q6NW40 ? 2 ;QCRIQKCTTDFVSLTSHLNSAVDGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNP EVTH ; 53 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6Z3H A 3 ? 117 ? P43026 387 ? 501 ? 387 501 2 2 6Z3H B 4 ? 87 ? Q6NW40 53 ? 136 ? 53 136 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Z3H MET A 1 ? UNP P43026 ? ? 'initiating methionine' 385 1 1 6Z3H LYS A 2 ? UNP P43026 ? ? 'expression tag' 386 2 2 6Z3H GLU B 1 ? UNP Q6NW40 ? ? 'expression tag' 50 3 2 6Z3H THR B 2 ? UNP Q6NW40 ? ? 'expression tag' 51 4 2 6Z3H GLY B 3 ? UNP Q6NW40 ? ? 'expression tag' 52 5 2 6Z3H GLY B 88 ? UNP Q6NW40 ? ? 'expression tag' 137 6 2 6Z3H THR B 89 ? UNP Q6NW40 ? ? 'expression tag' 138 7 2 6Z3H LYS B 90 ? UNP Q6NW40 ? ? 'expression tag' 139 8 2 6Z3H HIS B 91 ? UNP Q6NW40 ? ? 'expression tag' 140 9 2 6Z3H HIS B 92 ? UNP Q6NW40 ? ? 'expression tag' 141 10 2 6Z3H HIS B 93 ? UNP Q6NW40 ? ? 'expression tag' 142 11 2 6Z3H HIS B 94 ? UNP Q6NW40 ? ? 'expression tag' 143 12 2 6Z3H HIS B 95 ? UNP Q6NW40 ? ? 'expression tag' 144 13 2 6Z3H HIS B 96 ? UNP Q6NW40 ? ? 'expression tag' 145 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6450 ? 1 MORE -58 ? 1 'SSA (A^2)' 15610 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'surface plasmon resonance' ? 2 1 'light scattering' ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/3 0.5000000000 0.8660254038 0.0000000000 -49.4300000000 0.8660254038 -0.5000000000 0.0000000000 85.6152714181 0.0000000000 0.0000000000 -1.0000000000 33.2700000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 60 ? ASP A 73 ? THR A 444 ASP A 457 1 ? 14 HELX_P HELX_P2 AA2 ARG B 6 ? THR B 18 ? ARG B 55 THR B 67 1 ? 13 HELX_P HELX_P3 AA3 ALA B 35 ? ARG B 45 ? ALA B 84 ARG B 94 1 ? 11 HELX_P HELX_P4 AA4 ASN B 53 ? ARG B 70 ? ASN B 102 ARG B 119 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 400 A CYS 466 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf2 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 114 SG ? ? A CYS 429 A CYS 498 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 433 A CYS 500 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 81 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 465 A CYS 465 12_565 ? ? ? ? ? ? ? 2.032 ? ? disulf5 disulf ? ? B CYS 5 SG ? ? ? 1_555 B CYS 50 SG ? ? B CYS 54 B CYS 99 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf6 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 42 SG ? ? B CYS 59 B CYS 91 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf7 disulf ? ? B CYS 33 SG ? ? ? 1_555 B CYS 72 SG ? ? B CYS 82 B CYS 121 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 16 ? CYS A 82 ? CYS A 400 ? 1_555 CYS A 466 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 45 ? CYS A 114 ? CYS A 429 ? 1_555 CYS A 498 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 49 ? CYS A 116 ? CYS A 433 ? 1_555 CYS A 500 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 81 ? CYS A 81 ? CYS A 465 ? 1_555 CYS A 465 ? 12_565 SG SG . . . None 'Disulfide bridge' 5 CYS B 5 ? CYS B 50 ? CYS B 54 ? 1_555 CYS B 99 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS B 10 ? CYS B 42 ? CYS B 59 ? 1_555 CYS B 91 ? 1_555 SG SG . . . None 'Disulfide bridge' 7 CYS B 33 ? CYS B 72 ? CYS B 82 ? 1_555 CYS B 121 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 36 A . ? ALA 420 A PRO 37 A ? PRO 421 A 1 -2.30 2 PHE 51 A . ? PHE 435 A PRO 52 A ? PRO 436 A 1 -7.04 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 17 ? LYS A 19 ? SER A 401 LYS A 403 AA1 2 HIS A 44 ? GLU A 46 ? HIS A 428 GLU A 430 AA2 1 HIS A 22 ? ASN A 24 ? HIS A 406 ASN A 408 AA2 2 GLU A 39 ? GLU A 41 ? GLU A 423 GLU A 425 AA3 1 ILE A 34 ? ALA A 36 ? ILE A 418 ALA A 420 AA3 2 CYS A 82 ? ILE A 95 ? CYS A 466 ILE A 479 AA3 3 VAL A 101 ? CYS A 116 ? VAL A 485 CYS A 500 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 17 ? N SER A 401 O GLU A 46 ? O GLU A 430 AA2 1 2 N VAL A 23 ? N VAL A 407 O TYR A 40 ? O TYR A 424 AA3 1 2 N ALA A 36 ? N ALA A 420 O LEU A 93 ? O LEU A 477 AA3 2 3 N PHE A 94 ? N PHE A 478 O VAL A 102 ? O VAL A 486 # _pdbx_entry_details.entry_id 6Z3H _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 427 ? ? 61.88 173.33 2 1 CYS A 433 ? ? -109.57 77.97 3 1 GLU A 442 ? ? 31.65 65.31 4 1 LYS B 83 ? ? -67.56 -75.07 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -44.5738 25.7928 9.6914 0.2228 ? -0.4515 ? -0.0176 ? 0.8383 ? 0.1146 ? 0.8005 ? 1.1303 ? 0.1164 ? -0.0422 ? 2.4870 ? 0.1532 ? 1.2231 ? 0.2656 ? 0.3245 ? 0.4050 ? -0.1248 ? -0.1593 ? -1.3713 ? -0.5010 ? 1.1006 ? -1.4102 ? 2 'X-RAY DIFFRACTION' ? refined -31.5560 10.7714 21.4228 1.3846 ? -0.4648 ? -0.4596 ? 1.8267 ? 0.2687 ? 2.7907 ? 9.5317 ? 0.5399 ? 3.2075 ? 0.2137 ? 1.3284 ? 8.1950 ? 1.6430 ? 0.4495 ? -0.2681 ? 1.4479 ? -0.2907 ? -2.6241 ? -0.1269 ? 1.3532 ? -1.3126 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? 'chain A' 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? 'chain B' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 385 ? A MET 1 2 1 Y 1 A LYS 386 ? A LYS 2 3 1 Y 1 A ARG 387 ? A ARG 3 4 1 Y 1 A GLN 388 ? A GLN 4 5 1 Y 1 A GLY 389 ? A GLY 5 6 1 Y 1 A LYS 390 ? A LYS 6 7 1 Y 1 A ARG 391 ? A ARG 7 8 1 Y 1 A PRO 392 ? A PRO 8 9 1 Y 1 A SER 393 ? A SER 9 10 1 Y 1 A LYS 394 ? A LYS 10 11 1 Y 1 A ASN 395 ? A ASN 11 12 1 Y 1 A LEU 396 ? A LEU 12 13 1 Y 1 B GLU 50 ? B GLU 1 14 1 Y 1 B THR 51 ? B THR 2 15 1 Y 1 B GLY 52 ? B GLY 3 16 1 Y 1 B HIS 69 ? B HIS 20 17 1 Y 1 B LEU 70 ? B LEU 21 18 1 Y 1 B ASN 71 ? B ASN 22 19 1 Y 1 B SER 72 ? B SER 23 20 1 Y 1 B ALA 73 ? B ALA 24 21 1 Y 1 B VAL 74 ? B VAL 25 22 1 Y 1 B ASP 75 ? B ASP 26 23 1 Y 1 B GLY 76 ? B GLY 27 24 1 Y 1 B PHE 77 ? B PHE 28 25 1 Y 1 B ASP 78 ? B ASP 29 26 1 Y 1 B SER 79 ? B SER 30 27 1 Y 1 B GLU 80 ? B GLU 31 28 1 Y 1 B PHE 81 ? B PHE 32 29 1 Y 1 B SER 122 ? B SER 73 30 1 Y 1 B LYS 123 ? B LYS 74 31 1 Y 1 B ASP 124 ? B ASP 75 32 1 Y 1 B GLY 125 ? B GLY 76 33 1 Y 1 B PRO 126 ? B PRO 77 34 1 Y 1 B THR 127 ? B THR 78 35 1 Y 1 B SER 128 ? B SER 79 36 1 Y 1 B SER 129 ? B SER 80 37 1 Y 1 B THR 130 ? B THR 81 38 1 Y 1 B ASN 131 ? B ASN 82 39 1 Y 1 B PRO 132 ? B PRO 83 40 1 Y 1 B GLU 133 ? B GLU 84 41 1 Y 1 B VAL 134 ? B VAL 85 42 1 Y 1 B THR 135 ? B THR 86 43 1 Y 1 B HIS 136 ? B HIS 87 44 1 Y 1 B GLY 137 ? B GLY 88 45 1 Y 1 B THR 138 ? B THR 89 46 1 Y 1 B LYS 139 ? B LYS 90 47 1 Y 1 B HIS 140 ? B HIS 91 48 1 Y 1 B HIS 141 ? B HIS 92 49 1 Y 1 B HIS 142 ? B HIS 93 50 1 Y 1 B HIS 143 ? B HIS 94 51 1 Y 1 B HIS 144 ? B HIS 95 52 1 Y 1 B HIS 145 ? B HIS 96 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' C20724/A14414 1 'Cancer Research UK' 'United Kingdom' C20724/A26752 2 'European Research Council (ERC)' 'United Kingdom' 647278 3 'German Research Foundation (DFG)' Germany MU1095/3-2 4 'German Research Foundation (DFG)' Germany MU1095/5-1 5 'Wellcome Trust' 'United Kingdom' 203852/Z/16/2 6 'Human Frontier Science Program (HFSP)' 'United Kingdom' LT000021/2014-L 7 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4UI0 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6Z3H _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010115 _atom_sites.fract_transf_matrix[1][2] 0.005840 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011680 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010019 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #