data_6ZHJ # _entry.id 6ZHJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ZHJ pdb_00006zhj 10.2210/pdb6zhj/pdb WWPDB D_1292109539 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-27 2 'Structure model' 1 1 2023-09-13 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ZHJ _pdbx_database_status.recvd_initial_deposition_date 2020-06-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Blum, T.' 1 ? 'Housset, D.' 2 ? 'Clabbers, M.T.B.' 3 ? 'van Genderen, E.' 4 ? 'Schoehn, G.' 5 ? 'Ling, W.L.' 6 ? 'Abrahams, J.P.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 77 _citation.language ? _citation.page_first 75 _citation.page_last 85 _citation.title ;Statistically correcting dynamical electron scattering improves the refinement of protein nanocrystals, including charge refinement of coordinated metals. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798320014540 _citation.pdbx_database_id_PubMed 33404527 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blum, T.B.' 1 ? primary 'Housset, D.' 2 0000-0003-1732-0193 primary 'Clabbers, M.T.B.' 3 ? primary 'van Genderen, E.' 4 0000-0001-5043-6126 primary 'Bacia-Verloop, M.' 5 ? primary 'Zander, U.' 6 ? primary 'McCarthy, A.A.' 7 0000-0003-4478-0136 primary 'Schoehn, G.' 8 0000-0002-1459-3201 primary 'Ling, W.L.' 9 0000-0002-4264-5750 primary 'Abrahams, J.P.' 10 0000-0001-8216-1868 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn Thermolysin 34360.336 1 3.4.24.27 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Thermostable neutral proteinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ITGTSTVGVGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDAPAVDAHYYAGVT YDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNE SGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKA AYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK ; _entity_poly.pdbx_seq_one_letter_code_can ;ITGTSTVGVGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDAPAVDAHYYAGVT YDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNE SGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKA AYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CALCIUM ION' CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 THR n 1 3 GLY n 1 4 THR n 1 5 SER n 1 6 THR n 1 7 VAL n 1 8 GLY n 1 9 VAL n 1 10 GLY n 1 11 ARG n 1 12 GLY n 1 13 VAL n 1 14 LEU n 1 15 GLY n 1 16 ASP n 1 17 GLN n 1 18 LYS n 1 19 ASN n 1 20 ILE n 1 21 ASN n 1 22 THR n 1 23 THR n 1 24 TYR n 1 25 SER n 1 26 THR n 1 27 TYR n 1 28 TYR n 1 29 TYR n 1 30 LEU n 1 31 GLN n 1 32 ASP n 1 33 ASN n 1 34 THR n 1 35 ARG n 1 36 GLY n 1 37 ASN n 1 38 GLY n 1 39 ILE n 1 40 PHE n 1 41 THR n 1 42 TYR n 1 43 ASP n 1 44 ALA n 1 45 LYS n 1 46 TYR n 1 47 ARG n 1 48 THR n 1 49 THR n 1 50 LEU n 1 51 PRO n 1 52 GLY n 1 53 SER n 1 54 LEU n 1 55 TRP n 1 56 ALA n 1 57 ASP n 1 58 ALA n 1 59 ASP n 1 60 ASN n 1 61 GLN n 1 62 PHE n 1 63 PHE n 1 64 ALA n 1 65 SER n 1 66 TYR n 1 67 ASP n 1 68 ALA n 1 69 PRO n 1 70 ALA n 1 71 VAL n 1 72 ASP n 1 73 ALA n 1 74 HIS n 1 75 TYR n 1 76 TYR n 1 77 ALA n 1 78 GLY n 1 79 VAL n 1 80 THR n 1 81 TYR n 1 82 ASP n 1 83 TYR n 1 84 TYR n 1 85 LYS n 1 86 ASN n 1 87 VAL n 1 88 HIS n 1 89 ASN n 1 90 ARG n 1 91 LEU n 1 92 SER n 1 93 TYR n 1 94 ASP n 1 95 GLY n 1 96 ASN n 1 97 ASN n 1 98 ALA n 1 99 ALA n 1 100 ILE n 1 101 ARG n 1 102 SER n 1 103 SER n 1 104 VAL n 1 105 HIS n 1 106 TYR n 1 107 SER n 1 108 GLN n 1 109 GLY n 1 110 TYR n 1 111 ASN n 1 112 ASN n 1 113 ALA n 1 114 PHE n 1 115 TRP n 1 116 ASN n 1 117 GLY n 1 118 SER n 1 119 GLN n 1 120 MET n 1 121 VAL n 1 122 TYR n 1 123 GLY n 1 124 ASP n 1 125 GLY n 1 126 ASP n 1 127 GLY n 1 128 GLN n 1 129 THR n 1 130 PHE n 1 131 ILE n 1 132 PRO n 1 133 LEU n 1 134 SER n 1 135 GLY n 1 136 GLY n 1 137 ILE n 1 138 ASP n 1 139 VAL n 1 140 VAL n 1 141 ALA n 1 142 HIS n 1 143 GLU n 1 144 LEU n 1 145 THR n 1 146 HIS n 1 147 ALA n 1 148 VAL n 1 149 THR n 1 150 ASP n 1 151 TYR n 1 152 THR n 1 153 ALA n 1 154 GLY n 1 155 LEU n 1 156 ILE n 1 157 TYR n 1 158 GLN n 1 159 ASN n 1 160 GLU n 1 161 SER n 1 162 GLY n 1 163 ALA n 1 164 ILE n 1 165 ASN n 1 166 GLU n 1 167 ALA n 1 168 ILE n 1 169 SER n 1 170 ASP n 1 171 ILE n 1 172 PHE n 1 173 GLY n 1 174 THR n 1 175 LEU n 1 176 VAL n 1 177 GLU n 1 178 PHE n 1 179 TYR n 1 180 ALA n 1 181 ASN n 1 182 LYS n 1 183 ASN n 1 184 PRO n 1 185 ASP n 1 186 TRP n 1 187 GLU n 1 188 ILE n 1 189 GLY n 1 190 GLU n 1 191 ASP n 1 192 VAL n 1 193 TYR n 1 194 THR n 1 195 PRO n 1 196 GLY n 1 197 ILE n 1 198 SER n 1 199 GLY n 1 200 ASP n 1 201 SER n 1 202 LEU n 1 203 ARG n 1 204 SER n 1 205 MET n 1 206 SER n 1 207 ASP n 1 208 PRO n 1 209 ALA n 1 210 LYS n 1 211 TYR n 1 212 GLY n 1 213 ASP n 1 214 PRO n 1 215 ASP n 1 216 HIS n 1 217 TYR n 1 218 SER n 1 219 LYS n 1 220 ARG n 1 221 TYR n 1 222 THR n 1 223 GLY n 1 224 THR n 1 225 GLN n 1 226 ASP n 1 227 ASN n 1 228 GLY n 1 229 GLY n 1 230 VAL n 1 231 HIS n 1 232 ILE n 1 233 ASN n 1 234 SER n 1 235 GLY n 1 236 ILE n 1 237 ILE n 1 238 ASN n 1 239 LYS n 1 240 ALA n 1 241 ALA n 1 242 TYR n 1 243 LEU n 1 244 ILE n 1 245 SER n 1 246 GLN n 1 247 GLY n 1 248 GLY n 1 249 THR n 1 250 HIS n 1 251 TYR n 1 252 GLY n 1 253 VAL n 1 254 SER n 1 255 VAL n 1 256 VAL n 1 257 GLY n 1 258 ILE n 1 259 GLY n 1 260 ARG n 1 261 ASP n 1 262 LYS n 1 263 LEU n 1 264 GLY n 1 265 LYS n 1 266 ILE n 1 267 PHE n 1 268 TYR n 1 269 ARG n 1 270 ALA n 1 271 LEU n 1 272 THR n 1 273 GLN n 1 274 TYR n 1 275 LEU n 1 276 THR n 1 277 PRO n 1 278 THR n 1 279 SER n 1 280 ASN n 1 281 PHE n 1 282 SER n 1 283 GLN n 1 284 LEU n 1 285 ARG n 1 286 ALA n 1 287 ALA n 1 288 ALA n 1 289 VAL n 1 290 GLN n 1 291 SER n 1 292 ALA n 1 293 THR n 1 294 ASP n 1 295 LEU n 1 296 TYR n 1 297 GLY n 1 298 SER n 1 299 THR n 1 300 SER n 1 301 GLN n 1 302 GLU n 1 303 VAL n 1 304 ALA n 1 305 SER n 1 306 VAL n 1 307 LYS n 1 308 GLN n 1 309 ALA n 1 310 PHE n 1 311 ASP n 1 312 ALA n 1 313 VAL n 1 314 GLY n 1 315 VAL n 1 316 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 316 _pdbx_entity_src_syn.organism_scientific 'Bacillus thermoproteolyticus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1427 _pdbx_entity_src_syn.details 'purchased from Hampton Research' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 TRP 186 186 186 TRP TRP A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 MET 205 205 205 MET MET A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 TYR 221 221 221 TYR TYR A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 GLN 225 225 225 GLN GLN A . n A 1 226 ASP 226 226 226 ASP ASP A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 HIS 231 231 231 HIS HIS A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 ASN 233 233 233 ASN ASN A . n A 1 234 SER 234 234 234 SER SER A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 ASN 238 238 238 ASN ASN A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 SER 245 245 245 SER SER A . n A 1 246 GLN 246 246 246 GLN GLN A . n A 1 247 GLY 247 247 247 GLY GLY A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 VAL 255 255 255 VAL VAL A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 ARG 260 260 260 ARG ARG A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 LYS 262 262 262 LYS LYS A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 TYR 268 268 268 TYR TYR A . n A 1 269 ARG 269 269 269 ARG ARG A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 THR 272 272 272 THR THR A . n A 1 273 GLN 273 273 273 GLN GLN A . n A 1 274 TYR 274 274 274 TYR TYR A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 THR 276 276 276 THR THR A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 ASN 280 280 280 ASN ASN A . n A 1 281 PHE 281 281 281 PHE PHE A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 GLN 283 283 283 GLN GLN A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 ARG 285 285 285 ARG ARG A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 ALA 288 288 288 ALA ALA A . n A 1 289 VAL 289 289 289 VAL VAL A . n A 1 290 GLN 290 290 290 GLN GLN A . n A 1 291 SER 291 291 291 SER SER A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 THR 293 293 293 THR THR A . n A 1 294 ASP 294 294 294 ASP ASP A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 TYR 296 296 296 TYR TYR A . n A 1 297 GLY 297 297 297 GLY GLY A . n A 1 298 SER 298 298 298 SER SER A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 GLN 301 301 301 GLN GLN A . n A 1 302 GLU 302 302 302 GLU GLU A . n A 1 303 VAL 303 303 303 VAL VAL A . n A 1 304 ALA 304 304 304 ALA ALA A . n A 1 305 SER 305 305 305 SER SER A . n A 1 306 VAL 306 306 306 VAL VAL A . n A 1 307 LYS 307 307 307 LYS LYS A . n A 1 308 GLN 308 308 308 GLN GLN A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 PHE 310 310 310 PHE PHE A . n A 1 311 ASP 311 311 311 ASP ASP A . n A 1 312 ALA 312 312 312 ALA ALA A . n A 1 313 VAL 313 313 313 VAL VAL A . n A 1 314 GLY 314 314 314 GLY GLY A . n A 1 315 VAL 315 315 315 VAL VAL A . n A 1 316 LYS 316 316 316 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 500 500 ZN ZN A . C 3 CA 1 501 501 CA CA A . D 3 CA 1 502 502 CA CA A . E 3 CA 1 503 503 CA CA A . F 3 CA 1 504 504 CA CA A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0230 1 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Apr. 1, 2019' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.25 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6ZHJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.000 _cell.length_a_esd ? _cell.length_b 92.000 _cell.length_b_esd ? _cell.length_c 127.480 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ZHJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ZHJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON CRYSTALLOGRAPHY' _exptl.method_details ? # _refine.aniso_B[1][1] 0.0400 _refine.aniso_B[1][2] 0.0200 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 0.0400 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.1300 _refine.B_iso_max 69.970 _refine.B_iso_mean 29.4000 _refine.B_iso_min 9.500 _refine.correlation_coeff_Fo_to_Fc 0.8410 _refine.correlation_coeff_Fo_to_Fc_free 0.7730 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ZHJ _refine.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.2600 _refine.ls_d_res_low 37.5200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4293 _refine.ls_number_reflns_R_free 237 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 84.1700 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2142 _refine.ls_R_factor_R_free 0.2923 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2101 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1FJ3 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.7740 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 52.0260 _refine.overall_SU_ML 0.8250 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.26 _refine_hist.d_res_low 37.52 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2438 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 316 _refine_hist.pdbx_B_iso_mean_ligand 23.61 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein ? _refine_hist.pdbx_number_atoms_nucleic_acid ? _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON CRYSTALLOGRAPHY' ? 0.007 0.014 2492 ? r_bond_refined_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.002 0.017 2077 ? r_bond_other_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 1.154 1.652 3393 ? r_angle_refined_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.834 1.648 4850 ? r_angle_other_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 8.426 5.000 315 ? r_dihedral_angle_1_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 32.957 23.358 134 ? r_dihedral_angle_2_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 18.072 15.000 357 ? r_dihedral_angle_3_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 15.968 15.000 10 ? r_dihedral_angle_4_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.055 0.200 323 ? r_chiral_restr ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.005 0.020 2915 ? r_gen_planes_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.002 0.020 513 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_ls_shell.d_res_high 3.2600 _refine_ls_shell.d_res_low 3.3440 _refine_ls_shell.number_reflns_all 274 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 12 _refine_ls_shell.number_reflns_R_work 262 _refine_ls_shell.percent_reflns_obs 70.0800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.5410 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3470 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6ZHJ _struct.title '3D electron diffraction structure of thermolysin from Bacillus thermoproteolyticus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ZHJ _struct_keywords.text 'hydrolase, metalloproteinase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THER_BACTH _struct_ref.pdbx_db_accession P00800 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ITGTSTVGVGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDAPAVDAHYYAGVT YDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNE SGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKA AYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK ; _struct_ref.pdbx_align_begin 233 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ZHJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00800 _struct_ref_seq.db_align_beg 233 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 548 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 316 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 390 ? 1 MORE -74 ? 1 'SSA (A^2)' 12580 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'scanning transmission electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 67 ? VAL A 87 ? ASP A 67 VAL A 87 1 ? 21 HELX_P HELX_P2 AA2 GLY A 136 ? TYR A 151 ? GLY A 136 TYR A 151 1 ? 16 HELX_P HELX_P3 AA3 GLN A 158 ? ALA A 180 ? GLN A 158 ALA A 180 1 ? 23 HELX_P HELX_P4 AA4 GLY A 189 ? TYR A 193 ? GLY A 189 TYR A 193 5 ? 5 HELX_P HELX_P5 AA5 ASP A 207 ? GLY A 212 ? ASP A 207 GLY A 212 5 ? 6 HELX_P HELX_P6 AA6 THR A 224 ? GLY A 228 ? THR A 224 GLY A 228 5 ? 5 HELX_P HELX_P7 AA7 GLY A 229 ? GLY A 247 ? GLY A 229 GLY A 247 1 ? 19 HELX_P HELX_P8 AA8 LEU A 263 ? TYR A 274 ? LEU A 263 TYR A 274 1 ? 12 HELX_P HELX_P9 AA9 ASN A 280 ? GLY A 297 ? ASN A 280 GLY A 297 1 ? 18 HELX_P HELX_P10 AB1 SER A 300 ? VAL A 313 ? SER A 300 VAL A 313 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 57 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 57 A CA 503 1_555 ? ? ? ? ? ? ? 2.468 ? ? metalc2 metalc ? ? A ASP 57 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 57 A CA 503 1_555 ? ? ? ? ? ? ? 2.917 ? ? metalc3 metalc ? ? A ASP 59 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 59 A CA 503 1_555 ? ? ? ? ? ? ? 2.634 ? ? metalc4 metalc ? ? A GLN 61 O ? ? ? 1_555 E CA . CA ? ? A GLN 61 A CA 503 1_555 ? ? ? ? ? ? ? 2.525 ? ? metalc5 metalc ? ? A ASP 138 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 138 A CA 501 1_555 ? ? ? ? ? ? ? 2.593 ? ? metalc6 metalc ? ? A HIS 142 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 142 A ZN 500 1_555 ? ? ? ? ? ? ? 2.510 ? ? metalc7 metalc ? ? A HIS 146 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 146 A ZN 500 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc8 metalc ? ? A GLU 166 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 166 A ZN 500 1_555 ? ? ? ? ? ? ? 2.127 ? ? metalc9 metalc ? ? A GLU 177 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 177 A CA 501 1_555 ? ? ? ? ? ? ? 2.416 ? ? metalc10 metalc ? ? A GLU 177 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 177 A CA 502 1_555 ? ? ? ? ? ? ? 2.611 ? ? metalc11 metalc ? ? A ASN 183 O ? ? ? 1_555 D CA . CA ? ? A ASN 183 A CA 502 1_555 ? ? ? ? ? ? ? 2.546 ? ? metalc12 metalc ? ? A ASP 185 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 185 A CA 501 1_555 ? ? ? ? ? ? ? 3.132 ? ? metalc13 metalc ? ? A GLU 187 O ? ? ? 1_555 C CA . CA ? ? A GLU 187 A CA 501 1_555 ? ? ? ? ? ? ? 2.648 ? ? metalc14 metalc ? ? A GLU 190 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 190 A CA 501 1_555 ? ? ? ? ? ? ? 2.977 ? ? metalc15 metalc ? ? A GLU 190 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 190 A CA 501 1_555 ? ? ? ? ? ? ? 2.600 ? ? metalc16 metalc ? ? A GLU 190 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 190 A CA 502 1_555 ? ? ? ? ? ? ? 3.110 ? ? metalc17 metalc ? ? A TYR 193 O ? ? ? 1_555 F CA . CA ? ? A TYR 193 A CA 504 1_555 ? ? ? ? ? ? ? 2.484 ? ? metalc18 metalc ? ? A THR 194 O ? ? ? 1_555 F CA . CA ? ? A THR 194 A CA 504 1_555 ? ? ? ? ? ? ? 2.523 ? ? metalc19 metalc ? ? A THR 194 OG1 ? ? ? 1_555 F CA . CA ? ? A THR 194 A CA 504 1_555 ? ? ? ? ? ? ? 2.887 ? ? metalc20 metalc ? ? A ILE 197 O ? ? ? 1_555 F CA . CA ? ? A ILE 197 A CA 504 1_555 ? ? ? ? ? ? ? 2.738 ? ? metalc21 metalc ? ? A ASP 200 OD1 ? ? ? 1_555 F CA . CA ? ? A ASP 200 A CA 504 1_555 ? ? ? ? ? ? ? 2.821 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 47.5 ? 2 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 104.5 ? 3 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 68.5 ? 4 OD1 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 71.1 ? 5 OD2 ? A ASP 57 ? A ASP 57 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 94.7 ? 6 OD1 ? A ASP 59 ? A ASP 59 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O ? A GLN 61 ? A GLN 61 ? 1_555 80.3 ? 7 OD2 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 113.3 ? 8 OD2 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 139.8 ? 9 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 64.4 ? 10 OD2 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A GLU 187 ? A GLU 187 ? 1_555 116.3 ? 11 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A GLU 187 ? A GLU 187 ? 1_555 103.5 ? 12 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A GLU 187 ? A GLU 187 ? 1_555 102.4 ? 13 OD2 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 91.2 ? 14 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 149.8 ? 15 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 85.5 ? 16 O ? A GLU 187 ? A GLU 187 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 79.1 ? 17 OD2 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 70.4 ? 18 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 124.8 ? 19 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 79.2 ? 20 O ? A GLU 187 ? A GLU 187 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 124.7 ? 21 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 45.7 ? 22 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 53.7 ? 23 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 OE2 ? A GLU 166 ? A GLU 166 ? 1_555 94.9 ? 24 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 OE2 ? A GLU 166 ? A GLU 166 ? 1_555 79.7 ? 25 OE2 ? A GLU 177 ? A GLU 177 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? A ASN 183 ? A ASN 183 ? 1_555 71.9 ? 26 OE2 ? A GLU 177 ? A GLU 177 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 84.0 ? 27 O ? A ASN 183 ? A ASN 183 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 132.0 ? 28 O ? A TYR 193 ? A TYR 193 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 O ? A THR 194 ? A THR 194 ? 1_555 69.3 ? 29 O ? A TYR 193 ? A TYR 193 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 OG1 ? A THR 194 ? A THR 194 ? 1_555 55.4 ? 30 O ? A THR 194 ? A THR 194 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 OG1 ? A THR 194 ? A THR 194 ? 1_555 49.6 ? 31 O ? A TYR 193 ? A TYR 193 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 O ? A ILE 197 ? A ILE 197 ? 1_555 126.4 ? 32 O ? A THR 194 ? A THR 194 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 O ? A ILE 197 ? A ILE 197 ? 1_555 85.2 ? 33 OG1 ? A THR 194 ? A THR 194 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 O ? A ILE 197 ? A ILE 197 ? 1_555 72.0 ? 34 O ? A TYR 193 ? A TYR 193 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 73.3 ? 35 O ? A THR 194 ? A THR 194 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 101.6 ? 36 OG1 ? A THR 194 ? A THR 194 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 52.2 ? 37 O ? A ILE 197 ? A ILE 197 ? 1_555 CA ? F CA . ? A CA 504 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 66.6 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 50 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 50 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 51 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 51 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.33 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 2 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 4 ? SER A 5 ? THR A 4 SER A 5 AA1 2 THR A 23 ? TYR A 24 ? THR A 23 TYR A 24 AA1 3 TYR A 28 ? TYR A 29 ? TYR A 28 TYR A 29 AA1 4 ALA A 56 ? ASP A 57 ? ALA A 56 ASP A 57 AA2 1 GLN A 17 ? ILE A 20 ? GLN A 17 ILE A 20 AA2 2 GLY A 8 ? ARG A 11 ? GLY A 8 ARG A 11 AA2 3 GLN A 61 ? PHE A 62 ? GLN A 61 PHE A 62 AA3 1 SER A 53 ? LEU A 54 ? SER A 53 LEU A 54 AA3 2 TYR A 42 ? ASP A 43 ? TYR A 42 ASP A 43 AA3 3 SER A 102 ? VAL A 104 ? SER A 102 VAL A 104 AA3 4 MET A 120 ? TYR A 122 ? MET A 120 TYR A 122 AA4 1 GLU A 187 ? ILE A 188 ? GLU A 187 ILE A 188 AA4 2 ARG A 203 ? SER A 204 ? ARG A 203 SER A 204 AA5 1 THR A 249 ? HIS A 250 ? THR A 249 HIS A 250 AA5 2 VAL A 253 ? SER A 254 ? VAL A 253 SER A 254 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 4 ? N THR A 4 O TYR A 24 ? O TYR A 24 AA1 2 3 N THR A 23 ? N THR A 23 O TYR A 29 ? O TYR A 29 AA1 3 4 N TYR A 28 ? N TYR A 28 O ASP A 57 ? O ASP A 57 AA2 1 2 O LYS A 18 ? O LYS A 18 N GLY A 10 ? N GLY A 10 AA2 2 3 N VAL A 9 ? N VAL A 9 O PHE A 62 ? O PHE A 62 AA3 1 2 O SER A 53 ? O SER A 53 N ASP A 43 ? N ASP A 43 AA3 2 3 N TYR A 42 ? N TYR A 42 O SER A 102 ? O SER A 102 AA3 3 4 N SER A 103 ? N SER A 103 O MET A 120 ? O MET A 120 AA4 1 2 N ILE A 188 ? N ILE A 188 O ARG A 203 ? O ARG A 203 AA5 1 2 N HIS A 250 ? N HIS A 250 O VAL A 253 ? O VAL A 253 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 500 ? 6 'binding site for residue ZN A 500' AC2 Software A CA 501 ? 5 'binding site for residue CA A 501' AC3 Software A CA 502 ? 4 'binding site for residue CA A 502' AC4 Software A CA 503 ? 3 'binding site for residue CA A 503' AC5 Software A CA 504 ? 5 'binding site for residue CA A 504' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 142 ? HIS A 142 . ? 1_555 ? 2 AC1 6 GLU A 143 ? GLU A 143 . ? 1_555 ? 3 AC1 6 HIS A 146 ? HIS A 146 . ? 1_555 ? 4 AC1 6 TYR A 157 ? TYR A 157 . ? 1_555 ? 5 AC1 6 GLU A 166 ? GLU A 166 . ? 1_555 ? 6 AC1 6 HIS A 231 ? HIS A 231 . ? 1_555 ? 7 AC2 5 ASP A 138 ? ASP A 138 . ? 1_555 ? 8 AC2 5 GLU A 177 ? GLU A 177 . ? 1_555 ? 9 AC2 5 ASP A 185 ? ASP A 185 . ? 1_555 ? 10 AC2 5 GLU A 187 ? GLU A 187 . ? 1_555 ? 11 AC2 5 GLU A 190 ? GLU A 190 . ? 1_555 ? 12 AC3 4 GLU A 177 ? GLU A 177 . ? 1_555 ? 13 AC3 4 ASN A 183 ? ASN A 183 . ? 1_555 ? 14 AC3 4 ASP A 185 ? ASP A 185 . ? 1_555 ? 15 AC3 4 GLU A 190 ? GLU A 190 . ? 1_555 ? 16 AC4 3 ASP A 57 ? ASP A 57 . ? 1_555 ? 17 AC4 3 ASP A 59 ? ASP A 59 . ? 1_555 ? 18 AC4 3 GLN A 61 ? GLN A 61 . ? 1_555 ? 19 AC5 5 GLU A 190 ? GLU A 190 . ? 1_555 ? 20 AC5 5 TYR A 193 ? TYR A 193 . ? 1_555 ? 21 AC5 5 THR A 194 ? THR A 194 . ? 1_555 ? 22 AC5 5 ILE A 197 ? ILE A 197 . ? 1_555 ? 23 AC5 5 ASP A 200 ? ASP A 200 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH A TYR 274 ? ? OD2 A ASP 294 ? ? 1.93 2 1 O A SER 254 ? ? NE2 A GLN 308 ? ? 2.03 3 1 OE2 A GLU 160 ? ? OH A TYR 217 ? ? 2.10 4 1 OH A TYR 157 ? ? OE2 A GLU 166 ? ? 2.18 5 1 NH1 A ARG 285 ? ? O A VAL 315 ? ? 2.18 6 1 NE2 A HIS 142 ? ? NE2 A HIS 146 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 6 ? ? -138.49 -158.40 2 1 LEU A 14 ? ? -91.41 31.55 3 1 SER A 25 ? ? -178.92 103.66 4 1 THR A 26 ? ? 73.82 -80.13 5 1 ASP A 32 ? ? -69.52 97.94 6 1 ASN A 37 ? ? -90.16 31.43 7 1 LYS A 45 ? ? 88.35 33.22 8 1 TYR A 46 ? ? 57.22 19.73 9 1 PHE A 62 ? ? -110.64 73.24 10 1 HIS A 74 ? ? -135.59 -61.66 11 1 VAL A 87 ? ? -129.15 -71.58 12 1 ASN A 89 ? ? 73.86 30.47 13 1 SER A 92 ? ? 63.39 179.93 14 1 ASN A 97 ? ? 32.14 63.84 15 1 SER A 107 ? ? 80.29 159.11 16 1 ASN A 112 ? ? -174.59 -179.89 17 1 ALA A 113 ? ? -179.65 139.23 18 1 PRO A 132 ? ? -32.85 125.74 19 1 THR A 152 ? ? -136.45 -68.70 20 1 ASN A 159 ? ? 49.61 -171.70 21 1 ASN A 183 ? ? 30.01 70.78 22 1 TRP A 186 ? ? -84.11 38.28 23 1 VAL A 192 ? ? -141.21 37.48 24 1 THR A 194 ? ? 64.53 97.31 25 1 ILE A 197 ? ? -151.20 77.80 26 1 ILE A 232 ? ? -124.25 -76.35 27 1 TYR A 251 ? ? 25.47 51.52 28 1 SER A 254 ? ? -69.34 93.68 29 1 TYR A 274 ? ? -148.39 -28.49 30 1 TYR A 296 ? ? -153.76 28.80 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 35 ? ? 0.107 'SIDE CHAIN' 2 1 ARG A 47 ? ? 0.078 'SIDE CHAIN' 3 1 ARG A 101 ? ? 0.079 'SIDE CHAIN' # _pdbx_entry_details.entry_id 6ZHJ _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _em_3d_fitting.entry_id 6ZHJ _em_3d_fitting.id 1 _em_3d_fitting.details 'Refinement performed with Refmac' _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 6ZHJ _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details 'No reconstruction: diffraction data' _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles ? _em_3d_reconstruction.resolution ? _em_3d_reconstruction.resolution_method 'DIFFRACTION PATTERN/LAYERLINES' _em_3d_reconstruction.symmetry_type '3D CRYSTAL' _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details 'MES 100 mM ph 6.5' _em_buffer.pH 6.5 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name Thermolysin _em_entity_assembly.source 'MULTIPLE SOURCES' _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # loop_ _em_imaging.id _em_imaging.entry_id _em_imaging.accelerating_voltage _em_imaging.alignment_procedure _em_imaging.c2_aperture_diameter _em_imaging.calibrated_defocus_max _em_imaging.calibrated_defocus_min _em_imaging.calibrated_magnification _em_imaging.cryogen _em_imaging.details _em_imaging.electron_source _em_imaging.illumination_mode _em_imaging.microscope_model _em_imaging.mode _em_imaging.nominal_cs _em_imaging.nominal_defocus_max _em_imaging.nominal_defocus_min _em_imaging.nominal_magnification _em_imaging.recording_temperature_maximum _em_imaging.recording_temperature_minimum _em_imaging.residual_tilt _em_imaging.specimen_holder_model _em_imaging.specimen_id _em_imaging.citation_id _em_imaging.date _em_imaging.temperature _em_imaging.tilt_angle_min _em_imaging.tilt_angle_max _em_imaging.astigmatism _em_imaging.detector_distance _em_imaging.electron_beam_tilt_params _em_imaging.specimen_holder_type 1 6ZHJ 200 ? ? ? ? ? ? ? 'FIELD EMISSION GUN' 'FLOOD BEAM' 'FEI POLARA 300' DIFFRACTION ? ? ? ? ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 6ZHJ 200 ? ? ? ? ? ? ? 'FIELD EMISSION GUN' 'FLOOD BEAM' 'FEI TALOS ARCTICA' DIFFRACTION ? ? ? ? ? ? ? ? 1 ? ? ? ? ? ? ? ? ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.method ? _em_sample_support.film_material ? _em_sample_support.grid_material ? _em_sample_support.grid_mesh_size ? _em_sample_support.grid_type ? _em_sample_support.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 295 _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity 50 _em_vitrification.instrument 'HOMEMADE PLUNGER' _em_vitrification.entry_id 6ZHJ _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 6ZHJ _em_experiment.id 1 _em_experiment.aggregation_state '3D ARRAY' _em_experiment.reconstruction_method CRYSTALLOGRAPHY _em_experiment.entity_assembly_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TRP N N N N 305 TRP CA C N S 306 TRP C C N N 307 TRP O O N N 308 TRP CB C N N 309 TRP CG C Y N 310 TRP CD1 C Y N 311 TRP CD2 C Y N 312 TRP NE1 N Y N 313 TRP CE2 C Y N 314 TRP CE3 C Y N 315 TRP CZ2 C Y N 316 TRP CZ3 C Y N 317 TRP CH2 C Y N 318 TRP OXT O N N 319 TRP H H N N 320 TRP H2 H N N 321 TRP HA H N N 322 TRP HB2 H N N 323 TRP HB3 H N N 324 TRP HD1 H N N 325 TRP HE1 H N N 326 TRP HE3 H N N 327 TRP HZ2 H N N 328 TRP HZ3 H N N 329 TRP HH2 H N N 330 TRP HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 ZN ZN ZN N N 375 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _em_3d_crystal_entity.id 1 _em_3d_crystal_entity.image_processing_id 1 _em_3d_crystal_entity.angle_alpha 90 _em_3d_crystal_entity.angle_beta 90 _em_3d_crystal_entity.angle_gamma 120 _em_3d_crystal_entity.length_a 92.0 _em_3d_crystal_entity.length_b 92.0 _em_3d_crystal_entity.length_c 127.48 _em_3d_crystal_entity.space_group_name 'P 61 2 2' _em_3d_crystal_entity.space_group_num 178 # loop_ _em_buffer_component.buffer_id _em_buffer_component.id _em_buffer_component.concentration _em_buffer_component.concentration_units _em_buffer_component.formula _em_buffer_component.name 1 1 40 % PEG 'PEG 2000' 1 2 5 mM CaCl2 'Calcium chloride' # _em_crystal_formation.id 1 _em_crystal_formation.specimen_id 1 _em_crystal_formation.atmosphere ? _em_crystal_formation.details ? _em_crystal_formation.instrument ? _em_crystal_formation.lipid_mixture ? _em_crystal_formation.lipid_protein_ratio ? _em_crystal_formation.temperature ? _em_crystal_formation.time ? _em_crystal_formation.time_unit ? # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type NONE _em_ctf_correction.details ? # _em_diffraction.id 1 _em_diffraction.camera_length 1300 _em_diffraction.imaging_id 1 _em_diffraction.tilt_angle_list ? # _em_diffraction_shell.id 1 _em_diffraction_shell.em_diffraction_stats_id 1 _em_diffraction_shell.fourier_space_coverage 84.17 _em_diffraction_shell.high_resolution 3.26 _em_diffraction_shell.low_resolution 37.52 _em_diffraction_shell.multiplicity 4.2 _em_diffraction_shell.num_structure_factors 4530 _em_diffraction_shell.phase_residual 0.001 # _em_diffraction_stats.id 1 _em_diffraction_stats.details 'Diffraction data' _em_diffraction_stats.image_processing_id 1 _em_diffraction_stats.fourier_space_coverage 84.17 _em_diffraction_stats.high_resolution 3.26 _em_diffraction_stats.num_intensities_measured 4536 _em_diffraction_stats.num_structure_factors 4530 _em_diffraction_stats.overall_phase_error 0.001 _em_diffraction_stats.overall_phase_residual 0.001 _em_diffraction_stats.phase_error_rejection_criteria 0.001 _em_diffraction_stats.r_merge 0.548 _em_diffraction_stats.r_sym 0.548 # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 0.0346 # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 1 _em_entity_assembly_naturalsource.ncbi_tax_id 1427 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Bacillus thermoproteolyticus' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 1 _em_entity_assembly_recombinant.ncbi_tax_id 32630 _em_entity_assembly_recombinant.organism 'synthetic construct' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 5 _em_image_recording.average_exposure_time ? _em_image_recording.details 'Timepix detector used' _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model OTHER _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector ? _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name ? _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.energyfilter_slit_width ? _em_imaging_optics.phase_plate ? _em_imaging_optics.sph_aberration_corrector ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'IMAGE ACQUISITION' ? ? ? ? ? 1 2 MASKING ? ? ? ? ? ? 3 'CTF CORRECTION' ? ? ? 1 ? ? 4 'LAYERLINE INDEXING' ? ? ? ? ? ? 5 'DIFFRACTION INDEXING' ? ? ? ? ? ? 6 'MODEL FITTING' ? ? ? ? 1 ? 7 OTHER ? ? ? ? ? ? 8 'MOLECULAR REPLACEMENT' ? 'CCP4 package' ? 1 ? ? 9 'LATTICE DISTORTION CORRECTION' ? ? ? 1 ? ? 10 'SYMMETRY DETERMINATION' ? ? ? 1 ? ? 11 'CRYSTALLOGRAPHY MERGING' ? ? ? 1 ? ? 12 RECONSTRUCTION ? ? ? 1 ? ? 13 'MODEL REFINEMENT' ? ? ? ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration 20 _em_specimen.details '3D nano-sized crystals' _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'French National Research Agency' France ANR-10-INSB-05-02 1 'French National Research Agency' France ANR-10-LABX-49-01 2 'Swiss National Science Foundation' Switzerland 31003A_17002 3 'Swiss National Science Foundation' Switzerland 200021_165669 4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1FJ3 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6ZHJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010870 _atom_sites.fract_transf_matrix[1][2] 0.006276 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012551 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007844 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S ZN # loop_