data_6ZQO # _entry.id 6ZQO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ZQO pdb_00006zqo 10.2210/pdb6zqo/pdb WWPDB D_1292109708 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-16 2 'Structure model' 1 1 2021-06-30 3 'Structure model' 1 2 2024-01-31 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_first' 2 2 'Structure model' '_citation.page_last' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' 8 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ZQO _pdbx_database_status.recvd_initial_deposition_date 2020-07-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pletnev, V.Z.' 1 0000-0003-1453-6597 'Pletnev, S.V.' 2 ? 'Pletneva, N.V.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Comput Struct Biotechnol J' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2001-0370 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first 2950 _citation.page_last 2959 _citation.title 'Amino acid residue at the 165th position tunes EYFP chromophore maturation. A structure-based design.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.csbj.2021.05.017 _citation.pdbx_database_id_PubMed 34136094 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pletneva, N.V.' 1 ? primary 'Maksimov, E.G.' 2 ? primary 'Protasova, E.A.' 3 ? primary 'Mamontova, A.V.' 4 ? primary 'Simonyan, T.R.' 5 ? primary 'Ziganshin, R.H.' 6 ? primary 'Lukyanov, K.A.' 7 ? primary 'Muslinkina, L.' 8 ? primary 'Pletnev, S.' 9 ? primary 'Bogdanov, A.M.' 10 ? primary 'Pletnev, V.Z.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'G protein/GFP fusion protein' 28321.910 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 29 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTF (CR2)LQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLE YNYNSHNVYIMADKQKNGIKVNGKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLE FVTAAGITLGMDELYK ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYG LQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNS HNVYIMADKQKNGIKVNGKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAA GITLGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 MET n 1 14 VAL n 1 15 SER n 1 16 LYS n 1 17 GLY n 1 18 GLU n 1 19 GLU n 1 20 LEU n 1 21 PHE n 1 22 THR n 1 23 GLY n 1 24 VAL n 1 25 VAL n 1 26 PRO n 1 27 ILE n 1 28 LEU n 1 29 VAL n 1 30 GLU n 1 31 LEU n 1 32 ASP n 1 33 GLY n 1 34 ASP n 1 35 VAL n 1 36 ASN n 1 37 GLY n 1 38 HIS n 1 39 LYS n 1 40 PHE n 1 41 SER n 1 42 VAL n 1 43 SER n 1 44 GLY n 1 45 GLU n 1 46 GLY n 1 47 GLU n 1 48 GLY n 1 49 ASP n 1 50 ALA n 1 51 THR n 1 52 TYR n 1 53 GLY n 1 54 LYS n 1 55 LEU n 1 56 THR n 1 57 LEU n 1 58 LYS n 1 59 PHE n 1 60 ILE n 1 61 CYS n 1 62 THR n 1 63 THR n 1 64 GLY n 1 65 LYS n 1 66 LEU n 1 67 PRO n 1 68 VAL n 1 69 PRO n 1 70 TRP n 1 71 PRO n 1 72 THR n 1 73 LEU n 1 74 VAL n 1 75 THR n 1 76 THR n 1 77 PHE n 1 78 CR2 n 1 79 LEU n 1 80 GLN n 1 81 CYS n 1 82 PHE n 1 83 ALA n 1 84 ARG n 1 85 TYR n 1 86 PRO n 1 87 ASP n 1 88 HIS n 1 89 MET n 1 90 LYS n 1 91 GLN n 1 92 HIS n 1 93 ASP n 1 94 PHE n 1 95 PHE n 1 96 LYS n 1 97 SER n 1 98 ALA n 1 99 MET n 1 100 PRO n 1 101 GLU n 1 102 GLY n 1 103 TYR n 1 104 VAL n 1 105 GLN n 1 106 GLU n 1 107 ARG n 1 108 THR n 1 109 ILE n 1 110 PHE n 1 111 PHE n 1 112 LYS n 1 113 ASP n 1 114 ASP n 1 115 GLY n 1 116 ASN n 1 117 TYR n 1 118 LYS n 1 119 THR n 1 120 ARG n 1 121 ALA n 1 122 GLU n 1 123 VAL n 1 124 LYS n 1 125 PHE n 1 126 GLU n 1 127 GLY n 1 128 ASP n 1 129 THR n 1 130 LEU n 1 131 VAL n 1 132 ASN n 1 133 ARG n 1 134 ILE n 1 135 GLU n 1 136 LEU n 1 137 LYS n 1 138 GLY n 1 139 ILE n 1 140 ASP n 1 141 PHE n 1 142 LYS n 1 143 GLU n 1 144 ASP n 1 145 GLY n 1 146 ASN n 1 147 ILE n 1 148 LEU n 1 149 GLY n 1 150 HIS n 1 151 LYS n 1 152 LEU n 1 153 GLU n 1 154 TYR n 1 155 ASN n 1 156 TYR n 1 157 ASN n 1 158 SER n 1 159 HIS n 1 160 ASN n 1 161 VAL n 1 162 TYR n 1 163 ILE n 1 164 MET n 1 165 ALA n 1 166 ASP n 1 167 LYS n 1 168 GLN n 1 169 LYS n 1 170 ASN n 1 171 GLY n 1 172 ILE n 1 173 LYS n 1 174 VAL n 1 175 ASN n 1 176 GLY n 1 177 LYS n 1 178 ILE n 1 179 ARG n 1 180 HIS n 1 181 ASN n 1 182 ILE n 1 183 GLU n 1 184 ASP n 1 185 GLY n 1 186 SER n 1 187 VAL n 1 188 GLN n 1 189 LEU n 1 190 ALA n 1 191 ASP n 1 192 HIS n 1 193 TYR n 1 194 GLN n 1 195 GLN n 1 196 ASN n 1 197 THR n 1 198 PRO n 1 199 ILE n 1 200 GLY n 1 201 ASP n 1 202 GLY n 1 203 PRO n 1 204 VAL n 1 205 LEU n 1 206 LEU n 1 207 PRO n 1 208 ASP n 1 209 ASN n 1 210 HIS n 1 211 TYR n 1 212 LEU n 1 213 SER n 1 214 TYR n 1 215 GLN n 1 216 SER n 1 217 ALA n 1 218 LEU n 1 219 SER n 1 220 LYS n 1 221 ASP n 1 222 PRO n 1 223 ASN n 1 224 GLU n 1 225 LYS n 1 226 ARG n 1 227 ASP n 1 228 HIS n 1 229 MET n 1 230 VAL n 1 231 LEU n 1 232 LEU n 1 233 GLU n 1 234 PHE n 1 235 VAL n 1 236 THR n 1 237 ALA n 1 238 ALA n 1 239 GLY n 1 240 ILE n 1 241 THR n 1 242 LEU n 1 243 GLY n 1 244 MET n 1 245 ASP n 1 246 GLU n 1 247 LEU n 1 248 TYR n 1 249 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 249 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'G, GFP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Recombinant vesicular stomatitis Indiana virus rVSV-G/GFP' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 582817 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CR2 'L-peptide linking' n '{(4Z)-2-(aminomethyl)-4-[(4-hydroxyphenyl)methylidene]-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'CHROMOPHORE (GLY-TYR-GLY)' 'C13 H13 N3 O4' 275.260 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -12 ? ? ? A . n A 1 2 ARG 2 -11 ? ? ? A . n A 1 3 GLY 3 -10 ? ? ? A . n A 1 4 SER 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 HIS 7 -6 ? ? ? A . n A 1 8 HIS 8 -5 ? ? ? A . n A 1 9 HIS 9 -4 ? ? ? A . n A 1 10 HIS 10 -3 ? ? ? A . n A 1 11 GLY 11 -2 ? ? ? A . n A 1 12 SER 12 -1 ? ? ? A . n A 1 13 MET 13 0 ? ? ? A . n A 1 14 VAL 14 1 ? ? ? A . n A 1 15 SER 15 2 2 SER SER A . n A 1 16 LYS 16 3 3 LYS LYS A . n A 1 17 GLY 17 4 4 GLY GLY A . n A 1 18 GLU 18 5 5 GLU GLU A . n A 1 19 GLU 19 6 6 GLU GLU A . n A 1 20 LEU 20 7 7 LEU LEU A . n A 1 21 PHE 21 8 8 PHE PHE A . n A 1 22 THR 22 9 9 THR THR A . n A 1 23 GLY 23 10 10 GLY GLY A . n A 1 24 VAL 24 11 11 VAL VAL A . n A 1 25 VAL 25 12 12 VAL VAL A . n A 1 26 PRO 26 13 13 PRO PRO A . n A 1 27 ILE 27 14 14 ILE ILE A . n A 1 28 LEU 28 15 15 LEU LEU A . n A 1 29 VAL 29 16 16 VAL VAL A . n A 1 30 GLU 30 17 17 GLU GLU A . n A 1 31 LEU 31 18 18 LEU LEU A . n A 1 32 ASP 32 19 19 ASP ASP A . n A 1 33 GLY 33 20 20 GLY GLY A . n A 1 34 ASP 34 21 21 ASP ASP A . n A 1 35 VAL 35 22 22 VAL VAL A . n A 1 36 ASN 36 23 23 ASN ASN A . n A 1 37 GLY 37 24 24 GLY GLY A . n A 1 38 HIS 38 25 25 HIS HIS A . n A 1 39 LYS 39 26 26 LYS LYS A . n A 1 40 PHE 40 27 27 PHE PHE A . n A 1 41 SER 41 28 28 SER SER A . n A 1 42 VAL 42 29 29 VAL VAL A . n A 1 43 SER 43 30 30 SER SER A . n A 1 44 GLY 44 31 31 GLY GLY A . n A 1 45 GLU 45 32 32 GLU GLU A . n A 1 46 GLY 46 33 33 GLY GLY A . n A 1 47 GLU 47 34 34 GLU GLU A . n A 1 48 GLY 48 35 35 GLY GLY A . n A 1 49 ASP 49 36 36 ASP ASP A . n A 1 50 ALA 50 37 37 ALA ALA A . n A 1 51 THR 51 38 38 THR THR A . n A 1 52 TYR 52 39 39 TYR TYR A . n A 1 53 GLY 53 40 40 GLY GLY A . n A 1 54 LYS 54 41 41 LYS LYS A . n A 1 55 LEU 55 42 42 LEU LEU A . n A 1 56 THR 56 43 43 THR THR A . n A 1 57 LEU 57 44 44 LEU LEU A . n A 1 58 LYS 58 45 45 LYS LYS A . n A 1 59 PHE 59 46 46 PHE PHE A . n A 1 60 ILE 60 47 47 ILE ILE A . n A 1 61 CYS 61 48 48 CYS CYS A . n A 1 62 THR 62 49 49 THR THR A . n A 1 63 THR 63 50 50 THR THR A . n A 1 64 GLY 64 51 51 GLY GLY A . n A 1 65 LYS 65 52 52 LYS LYS A . n A 1 66 LEU 66 53 53 LEU LEU A . n A 1 67 PRO 67 54 54 PRO PRO A . n A 1 68 VAL 68 55 55 VAL VAL A . n A 1 69 PRO 69 56 56 PRO PRO A . n A 1 70 TRP 70 57 57 TRP TRP A . n A 1 71 PRO 71 58 58 PRO PRO A . n A 1 72 THR 72 59 59 THR THR A . n A 1 73 LEU 73 60 60 LEU LEU A . n A 1 74 VAL 74 61 61 VAL VAL A . n A 1 75 THR 75 62 62 THR THR A . n A 1 76 THR 76 63 63 THR THR A . n A 1 77 PHE 77 64 64 PHE PHE A . n A 1 78 CR2 78 65 66 CR2 CR2 A . n A 1 79 LEU 79 66 68 LEU LEU A . n A 1 80 GLN 80 67 69 GLN GLN A . n A 1 81 CYS 81 68 70 CYS CYS A . n A 1 82 PHE 82 69 71 PHE PHE A . n A 1 83 ALA 83 70 72 ALA ALA A . n A 1 84 ARG 84 71 73 ARG ARG A . n A 1 85 TYR 85 72 74 TYR TYR A . n A 1 86 PRO 86 73 75 PRO PRO A . n A 1 87 ASP 87 74 76 ASP ASP A . n A 1 88 HIS 88 75 77 HIS HIS A . n A 1 89 MET 89 76 78 MET MET A . n A 1 90 LYS 90 77 79 LYS LYS A . n A 1 91 GLN 91 78 80 GLN GLN A . n A 1 92 HIS 92 79 81 HIS HIS A . n A 1 93 ASP 93 80 82 ASP ASP A . n A 1 94 PHE 94 81 83 PHE PHE A . n A 1 95 PHE 95 82 84 PHE PHE A . n A 1 96 LYS 96 83 85 LYS LYS A . n A 1 97 SER 97 84 86 SER SER A . n A 1 98 ALA 98 85 87 ALA ALA A . n A 1 99 MET 99 86 88 MET MET A . n A 1 100 PRO 100 87 89 PRO PRO A . n A 1 101 GLU 101 88 90 GLU GLU A . n A 1 102 GLY 102 89 91 GLY GLY A . n A 1 103 TYR 103 90 92 TYR TYR A . n A 1 104 VAL 104 91 93 VAL VAL A . n A 1 105 GLN 105 92 94 GLN GLN A . n A 1 106 GLU 106 93 95 GLU GLU A . n A 1 107 ARG 107 94 96 ARG ARG A . n A 1 108 THR 108 95 97 THR THR A . n A 1 109 ILE 109 96 98 ILE ILE A . n A 1 110 PHE 110 97 99 PHE PHE A . n A 1 111 PHE 111 98 100 PHE PHE A . n A 1 112 LYS 112 99 101 LYS LYS A . n A 1 113 ASP 113 100 102 ASP ASP A . n A 1 114 ASP 114 101 103 ASP ASP A . n A 1 115 GLY 115 102 104 GLY GLY A . n A 1 116 ASN 116 103 105 ASN ASN A . n A 1 117 TYR 117 104 106 TYR TYR A . n A 1 118 LYS 118 105 107 LYS LYS A . n A 1 119 THR 119 106 108 THR THR A . n A 1 120 ARG 120 107 109 ARG ARG A . n A 1 121 ALA 121 108 110 ALA ALA A . n A 1 122 GLU 122 109 111 GLU GLU A . n A 1 123 VAL 123 110 112 VAL VAL A . n A 1 124 LYS 124 111 113 LYS LYS A . n A 1 125 PHE 125 112 114 PHE PHE A . n A 1 126 GLU 126 113 115 GLU GLU A . n A 1 127 GLY 127 114 116 GLY GLY A . n A 1 128 ASP 128 115 117 ASP ASP A . n A 1 129 THR 129 116 118 THR THR A . n A 1 130 LEU 130 117 119 LEU LEU A . n A 1 131 VAL 131 118 120 VAL VAL A . n A 1 132 ASN 132 119 121 ASN ASN A . n A 1 133 ARG 133 120 122 ARG ARG A . n A 1 134 ILE 134 121 123 ILE ILE A . n A 1 135 GLU 135 122 124 GLU GLU A . n A 1 136 LEU 136 123 125 LEU LEU A . n A 1 137 LYS 137 124 126 LYS LYS A . n A 1 138 GLY 138 125 127 GLY GLY A . n A 1 139 ILE 139 126 128 ILE ILE A . n A 1 140 ASP 140 127 129 ASP ASP A . n A 1 141 PHE 141 128 130 PHE PHE A . n A 1 142 LYS 142 129 131 LYS LYS A . n A 1 143 GLU 143 130 132 GLU GLU A . n A 1 144 ASP 144 131 133 ASP ASP A . n A 1 145 GLY 145 132 134 GLY GLY A . n A 1 146 ASN 146 133 135 ASN ASN A . n A 1 147 ILE 147 134 136 ILE ILE A . n A 1 148 LEU 148 135 137 LEU LEU A . n A 1 149 GLY 149 136 138 GLY GLY A . n A 1 150 HIS 150 137 139 HIS HIS A . n A 1 151 LYS 151 138 140 LYS LYS A . n A 1 152 LEU 152 139 141 LEU LEU A . n A 1 153 GLU 153 140 142 GLU GLU A . n A 1 154 TYR 154 141 143 TYR TYR A . n A 1 155 ASN 155 142 144 ASN ASN A . n A 1 156 TYR 156 143 145 TYR TYR A . n A 1 157 ASN 157 144 146 ASN ASN A . n A 1 158 SER 158 145 147 SER SER A . n A 1 159 HIS 159 146 148 HIS HIS A . n A 1 160 ASN 160 147 149 ASN ASN A . n A 1 161 VAL 161 148 150 VAL VAL A . n A 1 162 TYR 162 149 151 TYR TYR A . n A 1 163 ILE 163 150 152 ILE ILE A . n A 1 164 MET 164 151 153 MET MET A . n A 1 165 ALA 165 152 154 ALA ALA A . n A 1 166 ASP 166 153 155 ASP ASP A . n A 1 167 LYS 167 154 156 LYS LYS A . n A 1 168 GLN 168 155 157 GLN GLN A . n A 1 169 LYS 169 156 158 LYS LYS A . n A 1 170 ASN 170 157 159 ASN ASN A . n A 1 171 GLY 171 158 160 GLY GLY A . n A 1 172 ILE 172 159 161 ILE ILE A . n A 1 173 LYS 173 160 162 LYS LYS A . n A 1 174 VAL 174 161 163 VAL VAL A . n A 1 175 ASN 175 162 164 ASN ASN A . n A 1 176 GLY 176 163 165 GLY GLY A . n A 1 177 LYS 177 164 166 LYS LYS A . n A 1 178 ILE 178 165 167 ILE ILE A . n A 1 179 ARG 179 166 168 ARG ARG A . n A 1 180 HIS 180 167 169 HIS HIS A . n A 1 181 ASN 181 168 170 ASN ASN A . n A 1 182 ILE 182 169 171 ILE ILE A . n A 1 183 GLU 183 170 172 GLU GLU A . n A 1 184 ASP 184 171 173 ASP ASP A . n A 1 185 GLY 185 172 174 GLY GLY A . n A 1 186 SER 186 173 175 SER SER A . n A 1 187 VAL 187 174 176 VAL VAL A . n A 1 188 GLN 188 175 177 GLN GLN A . n A 1 189 LEU 189 176 178 LEU LEU A . n A 1 190 ALA 190 177 179 ALA ALA A . n A 1 191 ASP 191 178 180 ASP ASP A . n A 1 192 HIS 192 179 181 HIS HIS A . n A 1 193 TYR 193 180 182 TYR TYR A . n A 1 194 GLN 194 181 183 GLN GLN A . n A 1 195 GLN 195 182 184 GLN GLN A . n A 1 196 ASN 196 183 185 ASN ASN A . n A 1 197 THR 197 184 186 THR THR A . n A 1 198 PRO 198 185 187 PRO PRO A . n A 1 199 ILE 199 186 188 ILE ILE A . n A 1 200 GLY 200 187 189 GLY GLY A . n A 1 201 ASP 201 188 190 ASP ASP A . n A 1 202 GLY 202 189 191 GLY GLY A . n A 1 203 PRO 203 190 192 PRO PRO A . n A 1 204 VAL 204 191 193 VAL VAL A . n A 1 205 LEU 205 192 194 LEU LEU A . n A 1 206 LEU 206 193 195 LEU LEU A . n A 1 207 PRO 207 194 196 PRO PRO A . n A 1 208 ASP 208 195 197 ASP ASP A . n A 1 209 ASN 209 196 198 ASN ASN A . n A 1 210 HIS 210 197 199 HIS HIS A . n A 1 211 TYR 211 198 200 TYR TYR A . n A 1 212 LEU 212 199 201 LEU LEU A . n A 1 213 SER 213 200 202 SER SER A . n A 1 214 TYR 214 201 203 TYR TYR A . n A 1 215 GLN 215 202 204 GLN GLN A . n A 1 216 SER 216 203 205 SER SER A . n A 1 217 ALA 217 204 206 ALA ALA A . n A 1 218 LEU 218 205 207 LEU LEU A . n A 1 219 SER 219 206 208 SER SER A . n A 1 220 LYS 220 207 209 LYS LYS A . n A 1 221 ASP 221 208 210 ASP ASP A . n A 1 222 PRO 222 209 211 PRO PRO A . n A 1 223 ASN 223 210 212 ASN ASN A . n A 1 224 GLU 224 211 213 GLU GLU A . n A 1 225 LYS 225 212 214 LYS LYS A . n A 1 226 ARG 226 213 215 ARG ARG A . n A 1 227 ASP 227 214 216 ASP ASP A . n A 1 228 HIS 228 215 217 HIS HIS A . n A 1 229 MET 229 216 218 MET MET A . n A 1 230 VAL 230 217 219 VAL VAL A . n A 1 231 LEU 231 218 220 LEU LEU A . n A 1 232 LEU 232 219 221 LEU LEU A . n A 1 233 GLU 233 220 222 GLU GLU A . n A 1 234 PHE 234 221 223 PHE PHE A . n A 1 235 VAL 235 222 224 VAL VAL A . n A 1 236 THR 236 223 225 THR THR A . n A 1 237 ALA 237 224 226 ALA ALA A . n A 1 238 ALA 238 225 227 ALA ALA A . n A 1 239 GLY 239 226 228 GLY GLY A . n A 1 240 ILE 240 227 229 ILE ILE A . n A 1 241 THR 241 228 230 THR THR A . n A 1 242 LEU 242 229 231 LEU LEU A . n A 1 243 GLY 243 230 232 GLY GLY A . n A 1 244 MET 244 231 233 MET MET A . n A 1 245 ASP 245 232 ? ? ? A . n A 1 246 GLU 246 233 ? ? ? A . n A 1 247 LEU 247 234 ? ? ? A . n A 1 248 TYR 248 235 ? ? ? A . n A 1 249 LYS 249 236 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 239 SO4 SO4 A . C 3 HOH 1 401 7 HOH HOH A . C 3 HOH 2 402 28 HOH HOH A . C 3 HOH 3 403 13 HOH HOH A . C 3 HOH 4 404 6 HOH HOH A . C 3 HOH 5 405 5 HOH HOH A . C 3 HOH 6 406 25 HOH HOH A . C 3 HOH 7 407 14 HOH HOH A . C 3 HOH 8 408 16 HOH HOH A . C 3 HOH 9 409 23 HOH HOH A . C 3 HOH 10 410 21 HOH HOH A . C 3 HOH 11 411 17 HOH HOH A . C 3 HOH 12 412 24 HOH HOH A . C 3 HOH 13 413 22 HOH HOH A . C 3 HOH 14 414 11 HOH HOH A . C 3 HOH 15 415 2 HOH HOH A . C 3 HOH 16 416 18 HOH HOH A . C 3 HOH 17 417 9 HOH HOH A . C 3 HOH 18 418 26 HOH HOH A . C 3 HOH 19 419 3 HOH HOH A . C 3 HOH 20 420 4 HOH HOH A . C 3 HOH 21 421 27 HOH HOH A . C 3 HOH 22 422 1 HOH HOH A . C 3 HOH 23 423 19 HOH HOH A . C 3 HOH 24 424 8 HOH HOH A . C 3 HOH 25 425 10 HOH HOH A . C 3 HOH 26 426 20 HOH HOH A . C 3 HOH 27 427 12 HOH HOH A . C 3 HOH 28 428 29 HOH HOH A . C 3 HOH 29 429 15 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6ZQO _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.888 _cell.length_a_esd ? _cell.length_b 57.888 _cell.length_b_esd ? _cell.length_c 168.838 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ZQO _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ZQO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '5.7 mg/ml in 20mM Tris 8.0 200 mM NaCl mixed with a 1.44M (NH4)2SO4, 60mM Bicine pH 9.0 reservoir solution.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-09-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6ZQO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14573 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.700 _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.816 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.066 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 83201 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.200 2.280 ? ? ? ? ? ? 1457 98.400 ? ? ? ? 0.794 ? ? ? ? ? ? ? ? 5.500 ? 1.028 ? ? 0.876 0.362 ? 1 1 0.881 ? ? 2.280 2.370 ? ? ? ? ? ? 1479 99.100 ? ? ? ? 0.611 ? ? ? ? ? ? ? ? 5.900 ? 0.535 ? ? 0.671 0.272 ? 2 1 0.982 ? ? 2.370 2.480 ? ? ? ? ? ? 1493 99.100 ? ? ? ? 0.352 ? ? ? ? ? ? ? ? 5.700 ? 0.527 ? ? 0.388 0.160 ? 3 1 0.984 ? ? 2.480 2.610 ? ? ? ? ? ? 1389 92.400 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 5.300 ? 0.591 ? ? 0.247 0.103 ? 4 1 0.990 ? ? 2.610 2.770 ? ? ? ? ? ? 1483 98.300 ? ? ? ? 0.169 ? ? ? ? ? ? ? ? 6.600 ? 0.629 ? ? 0.184 0.071 ? 5 1 0.997 ? ? 2.770 2.990 ? ? ? ? ? ? 1504 99.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 6.600 ? 0.743 ? ? 0.127 0.049 ? 6 1 0.997 ? ? 2.990 3.290 ? ? ? ? ? ? 1503 98.400 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 6.300 ? 0.940 ? ? 0.081 0.032 ? 7 1 0.997 ? ? 3.290 3.760 ? ? ? ? ? ? 1475 95.100 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 5.400 ? 1.065 ? ? 0.064 0.027 ? 8 1 0.998 ? ? 3.760 4.730 ? ? ? ? ? ? 1315 83.400 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 4.400 ? 1.039 ? ? 0.048 0.021 ? 9 1 0.998 ? ? 4.730 30.000 ? ? ? ? ? ? 1475 85.600 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 5.100 ? 1.249 ? ? 0.044 0.019 ? 10 1 0.998 ? ? # _refine.aniso_B[1][1] 4.2700 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 4.2700 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -8.5400 _refine.B_iso_max 138.060 _refine.B_iso_mean 64.9240 _refine.B_iso_min 32.570 _refine.correlation_coeff_Fo_to_Fc 0.9480 _refine.correlation_coeff_Fo_to_Fc_free 0.8950 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ZQO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 29.4000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13828 _refine.ls_number_reflns_R_free 710 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.8300 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2585 _refine.ls_R_factor_R_free 0.3396 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2543 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1YFP _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3210 _refine.pdbx_overall_ESU_R_Free 0.2870 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 13.2770 _refine.overall_SU_ML 0.3060 _refine.overall_SU_R_Cruickshank_DPI 0.3214 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 29.4000 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 1888 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 232 _refine_hist.pdbx_B_iso_mean_ligand 88.82 _refine_hist.pdbx_B_iso_mean_solvent 65.78 _refine_hist.pdbx_number_atoms_protein 1854 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.013 1922 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1733 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.542 1.662 2597 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.195 1.593 4040 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.857 5.000 231 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.288 24.141 99 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.180 15.000 326 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.061 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.056 0.200 236 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2147 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 392 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2020 _refine_ls_shell.d_res_low 2.2590 _refine_ls_shell.number_reflns_all 1091 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 50 _refine_ls_shell.number_reflns_R_work 1041 _refine_ls_shell.percent_reflns_obs 98.5500 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3760 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.4470 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6ZQO _struct.title 'EYFP mutant - F165G' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ZQO _struct_keywords.text 'Alternative routes of post-translation chemistry, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B7UCZ6_9RHAB _struct_ref.pdbx_db_accession B7UCZ6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK QHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK ; _struct_ref.pdbx_align_begin 512 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ZQO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 249 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B7UCZ6 _struct_ref_seq.db_align_beg 512 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 750 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 236 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6ZQO MET A 1 ? UNP B7UCZ6 ? ? 'initiating methionine' -12 1 1 6ZQO ARG A 2 ? UNP B7UCZ6 ? ? 'expression tag' -11 2 1 6ZQO GLY A 3 ? UNP B7UCZ6 ? ? 'expression tag' -10 3 1 6ZQO SER A 4 ? UNP B7UCZ6 ? ? 'expression tag' -9 4 1 6ZQO HIS A 5 ? UNP B7UCZ6 ? ? 'expression tag' -8 5 1 6ZQO HIS A 6 ? UNP B7UCZ6 ? ? 'expression tag' -7 6 1 6ZQO HIS A 7 ? UNP B7UCZ6 ? ? 'expression tag' -6 7 1 6ZQO HIS A 8 ? UNP B7UCZ6 ? ? 'expression tag' -5 8 1 6ZQO HIS A 9 ? UNP B7UCZ6 ? ? 'expression tag' -4 9 1 6ZQO HIS A 10 ? UNP B7UCZ6 ? ? 'expression tag' -3 10 1 6ZQO GLY A 11 ? UNP B7UCZ6 ? ? 'expression tag' -2 11 1 6ZQO SER A 12 ? UNP B7UCZ6 ? ? 'expression tag' -1 12 1 6ZQO PHE A 77 ? UNP B7UCZ6 LEU 576 'engineered mutation' 64 13 1 6ZQO CR2 A 78 ? UNP B7UCZ6 THR 577 chromophore 65 14 1 6ZQO CR2 A 78 ? UNP B7UCZ6 TYR 578 chromophore 65 15 1 6ZQO CR2 A 78 ? UNP B7UCZ6 GLY 579 chromophore 65 16 1 6ZQO LEU A 79 ? UNP B7UCZ6 VAL 580 'engineered mutation' 66 17 1 6ZQO ALA A 83 ? UNP B7UCZ6 SER 584 'engineered mutation' 70 18 1 6ZQO GLY A 176 ? UNP B7UCZ6 PHE 677 'engineered mutation' 163 19 1 6ZQO TYR A 214 ? UNP B7UCZ6 THR 715 'engineered mutation' 201 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 160 ? 1 MORE -11 ? 1 'SSA (A^2)' 10930 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 18 ? THR A 22 ? GLU A 5 THR A 9 5 ? 5 HELX_P HELX_P2 AA2 PRO A 69 ? VAL A 74 ? PRO A 56 VAL A 61 5 ? 6 HELX_P HELX_P3 AA3 LEU A 79 ? ALA A 83 ? LEU A 66 ALA A 70 5 ? 5 HELX_P HELX_P4 AA4 PRO A 86 ? HIS A 92 ? PRO A 73 HIS A 79 5 ? 7 HELX_P HELX_P5 AA5 ASP A 93 ? ALA A 98 ? ASP A 80 ALA A 85 1 ? 6 HELX_P HELX_P6 AA6 LYS A 167 ? ASN A 170 ? LYS A 154 ASN A 157 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 77 C B ? ? 1_555 A CR2 78 N1 B ? A PHE 64 A CR2 65 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A CR2 78 C3 B ? ? 1_555 A LEU 79 N B ? A CR2 65 A LEU 66 1_555 ? ? ? ? ? ? ? 1.350 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CR2 _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 78 _pdbx_modification_feature.label_alt_id B _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id CR2 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 65 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id 'GLY, TYR, GLY' _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CR2 _pdbx_modification_feature.type None _pdbx_modification_feature.category Chromophore/chromophore-like # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 99 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 86 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 100 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 87 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.12 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 24 ? VAL A 35 ? VAL A 11 VAL A 22 AA1 2 HIS A 38 ? ASP A 49 ? HIS A 25 ASP A 36 AA1 3 LYS A 54 ? CYS A 61 ? LYS A 41 CYS A 48 AA1 4 HIS A 228 ? ALA A 238 ? HIS A 215 ALA A 225 AA1 5 HIS A 210 ? SER A 219 ? HIS A 197 SER A 206 AA1 6 HIS A 159 ? ASP A 166 ? HIS A 146 ASP A 153 AA1 7 GLY A 171 ? ASN A 181 ? GLY A 158 ASN A 168 AA1 8 VAL A 187 ? PRO A 198 ? VAL A 174 PRO A 185 AA1 9 TYR A 103 ? PHE A 111 ? TYR A 90 PHE A 98 AA1 10 ASN A 116 ? PHE A 125 ? ASN A 103 PHE A 112 AA1 11 LEU A 130 ? ILE A 139 ? LEU A 117 ILE A 126 AA1 12 VAL A 24 ? VAL A 35 ? VAL A 11 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 29 ? N VAL A 16 O GLY A 44 ? O GLY A 31 AA1 2 3 N GLU A 45 ? N GLU A 32 O LYS A 58 ? O LYS A 45 AA1 3 4 N LEU A 57 ? N LEU A 44 O LEU A 231 ? O LEU A 218 AA1 4 5 O THR A 236 ? O THR A 223 N SER A 213 ? N SER A 200 AA1 5 6 O TYR A 214 ? O TYR A 201 N HIS A 159 ? N HIS A 146 AA1 6 7 N ASP A 166 ? N ASP A 153 O GLY A 171 ? O GLY A 158 AA1 7 8 N ILE A 178 ? N ILE A 165 O ALA A 190 ? O ALA A 177 AA1 8 9 O GLN A 195 ? O GLN A 182 N GLU A 106 ? N GLU A 93 AA1 9 10 N ILE A 109 ? N ILE A 96 O TYR A 117 ? O TYR A 104 AA1 10 11 N LYS A 118 ? N LYS A 105 O LYS A 137 ? O LYS A 124 AA1 11 12 O ILE A 134 ? O ILE A 121 N GLU A 30 ? N GLU A 17 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue SO4 A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ARG A 84 ? ARG A 71 . ? 1_555 ? 2 AC1 5 PRO A 86 ? PRO A 73 . ? 1_555 ? 3 AC1 5 ASP A 87 ? ASP A 74 . ? 1_555 ? 4 AC1 5 LYS A 173 ? LYS A 160 . ? 6_544 ? 5 AC1 5 HOH C . ? HOH A 422 . ? 1_555 ? # _pdbx_entry_details.entry_id 6ZQO _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A THR 63 ? ? N A PHE 64 ? B 1.485 1.336 0.149 0.023 Y 2 1 CA A LEU 66 ? B C A LEU 66 ? B 1.270 1.525 -0.255 0.026 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PHE _pdbx_validate_rmsd_angle.auth_seq_id_1 64 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 B _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PHE _pdbx_validate_rmsd_angle.auth_seq_id_2 64 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 B _pdbx_validate_rmsd_angle.auth_atom_id_3 CB _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PHE _pdbx_validate_rmsd_angle.auth_seq_id_3 64 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 B _pdbx_validate_rmsd_angle.angle_value 97.07 _pdbx_validate_rmsd_angle.angle_target_value 110.60 _pdbx_validate_rmsd_angle.angle_deviation -13.53 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.80 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 73 ? ? -57.40 171.60 2 1 ILE A 134 ? ? -97.08 -65.03 3 1 ASN A 142 ? ? -160.16 -165.73 4 1 ASP A 153 ? ? -118.81 71.16 5 1 LYS A 156 ? ? -141.40 20.30 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CR2 78 A CR2 65 ? THR chromophore 2 A CR2 78 A CR2 65 ? TYR chromophore 3 A CR2 78 A CR2 65 ? GLY chromophore # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -12 ? A MET 1 2 1 Y 1 A ARG -11 ? A ARG 2 3 1 Y 1 A GLY -10 ? A GLY 3 4 1 Y 1 A SER -9 ? A SER 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A HIS -6 ? A HIS 7 8 1 Y 1 A HIS -5 ? A HIS 8 9 1 Y 1 A HIS -4 ? A HIS 9 10 1 Y 1 A HIS -3 ? A HIS 10 11 1 Y 1 A GLY -2 ? A GLY 11 12 1 Y 1 A SER -1 ? A SER 12 13 1 Y 1 A MET 0 ? A MET 13 14 1 Y 1 A VAL 1 ? A VAL 14 15 1 Y 1 A ASP 232 ? A ASP 245 16 1 Y 1 A GLU 233 ? A GLU 246 17 1 Y 1 A LEU 234 ? A LEU 247 18 1 Y 1 A TYR 235 ? A TYR 248 19 1 Y 1 A LYS 236 ? A LYS 249 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CR2 N1 N N N 74 CR2 CA1 C N N 75 CR2 C1 C N N 76 CR2 N2 N N N 77 CR2 N3 N N N 78 CR2 C2 C N N 79 CR2 O2 O N N 80 CR2 CA2 C N N 81 CR2 CA3 C N N 82 CR2 C3 C N N 83 CR2 O3 O N N 84 CR2 CB2 C N N 85 CR2 CG2 C Y N 86 CR2 CD1 C Y N 87 CR2 CD2 C Y N 88 CR2 CE1 C Y N 89 CR2 CE2 C Y N 90 CR2 CZ C Y N 91 CR2 OH O N N 92 CR2 OXT O N N 93 CR2 H H N N 94 CR2 H2 H N N 95 CR2 HA1 H N N 96 CR2 HA12 H N N 97 CR2 HA31 H N N 98 CR2 HA32 H N N 99 CR2 HB2 H N N 100 CR2 HD1 H N N 101 CR2 HD2 H N N 102 CR2 HE1 H N N 103 CR2 HE2 H N N 104 CR2 HOH H N N 105 CR2 HXT H N N 106 CYS N N N N 107 CYS CA C N R 108 CYS C C N N 109 CYS O O N N 110 CYS CB C N N 111 CYS SG S N N 112 CYS OXT O N N 113 CYS H H N N 114 CYS H2 H N N 115 CYS HA H N N 116 CYS HB2 H N N 117 CYS HB3 H N N 118 CYS HG H N N 119 CYS HXT H N N 120 GLN N N N N 121 GLN CA C N S 122 GLN C C N N 123 GLN O O N N 124 GLN CB C N N 125 GLN CG C N N 126 GLN CD C N N 127 GLN OE1 O N N 128 GLN NE2 N N N 129 GLN OXT O N N 130 GLN H H N N 131 GLN H2 H N N 132 GLN HA H N N 133 GLN HB2 H N N 134 GLN HB3 H N N 135 GLN HG2 H N N 136 GLN HG3 H N N 137 GLN HE21 H N N 138 GLN HE22 H N N 139 GLN HXT H N N 140 GLU N N N N 141 GLU CA C N S 142 GLU C C N N 143 GLU O O N N 144 GLU CB C N N 145 GLU CG C N N 146 GLU CD C N N 147 GLU OE1 O N N 148 GLU OE2 O N N 149 GLU OXT O N N 150 GLU H H N N 151 GLU H2 H N N 152 GLU HA H N N 153 GLU HB2 H N N 154 GLU HB3 H N N 155 GLU HG2 H N N 156 GLU HG3 H N N 157 GLU HE2 H N N 158 GLU HXT H N N 159 GLY N N N N 160 GLY CA C N N 161 GLY C C N N 162 GLY O O N N 163 GLY OXT O N N 164 GLY H H N N 165 GLY H2 H N N 166 GLY HA2 H N N 167 GLY HA3 H N N 168 GLY HXT H N N 169 HIS N N N N 170 HIS CA C N S 171 HIS C C N N 172 HIS O O N N 173 HIS CB C N N 174 HIS CG C Y N 175 HIS ND1 N Y N 176 HIS CD2 C Y N 177 HIS CE1 C Y N 178 HIS NE2 N Y N 179 HIS OXT O N N 180 HIS H H N N 181 HIS H2 H N N 182 HIS HA H N N 183 HIS HB2 H N N 184 HIS HB3 H N N 185 HIS HD1 H N N 186 HIS HD2 H N N 187 HIS HE1 H N N 188 HIS HE2 H N N 189 HIS HXT H N N 190 HOH O O N N 191 HOH H1 H N N 192 HOH H2 H N N 193 ILE N N N N 194 ILE CA C N S 195 ILE C C N N 196 ILE O O N N 197 ILE CB C N S 198 ILE CG1 C N N 199 ILE CG2 C N N 200 ILE CD1 C N N 201 ILE OXT O N N 202 ILE H H N N 203 ILE H2 H N N 204 ILE HA H N N 205 ILE HB H N N 206 ILE HG12 H N N 207 ILE HG13 H N N 208 ILE HG21 H N N 209 ILE HG22 H N N 210 ILE HG23 H N N 211 ILE HD11 H N N 212 ILE HD12 H N N 213 ILE HD13 H N N 214 ILE HXT H N N 215 LEU N N N N 216 LEU CA C N S 217 LEU C C N N 218 LEU O O N N 219 LEU CB C N N 220 LEU CG C N N 221 LEU CD1 C N N 222 LEU CD2 C N N 223 LEU OXT O N N 224 LEU H H N N 225 LEU H2 H N N 226 LEU HA H N N 227 LEU HB2 H N N 228 LEU HB3 H N N 229 LEU HG H N N 230 LEU HD11 H N N 231 LEU HD12 H N N 232 LEU HD13 H N N 233 LEU HD21 H N N 234 LEU HD22 H N N 235 LEU HD23 H N N 236 LEU HXT H N N 237 LYS N N N N 238 LYS CA C N S 239 LYS C C N N 240 LYS O O N N 241 LYS CB C N N 242 LYS CG C N N 243 LYS CD C N N 244 LYS CE C N N 245 LYS NZ N N N 246 LYS OXT O N N 247 LYS H H N N 248 LYS H2 H N N 249 LYS HA H N N 250 LYS HB2 H N N 251 LYS HB3 H N N 252 LYS HG2 H N N 253 LYS HG3 H N N 254 LYS HD2 H N N 255 LYS HD3 H N N 256 LYS HE2 H N N 257 LYS HE3 H N N 258 LYS HZ1 H N N 259 LYS HZ2 H N N 260 LYS HZ3 H N N 261 LYS HXT H N N 262 MET N N N N 263 MET CA C N S 264 MET C C N N 265 MET O O N N 266 MET CB C N N 267 MET CG C N N 268 MET SD S N N 269 MET CE C N N 270 MET OXT O N N 271 MET H H N N 272 MET H2 H N N 273 MET HA H N N 274 MET HB2 H N N 275 MET HB3 H N N 276 MET HG2 H N N 277 MET HG3 H N N 278 MET HE1 H N N 279 MET HE2 H N N 280 MET HE3 H N N 281 MET HXT H N N 282 PHE N N N N 283 PHE CA C N S 284 PHE C C N N 285 PHE O O N N 286 PHE CB C N N 287 PHE CG C Y N 288 PHE CD1 C Y N 289 PHE CD2 C Y N 290 PHE CE1 C Y N 291 PHE CE2 C Y N 292 PHE CZ C Y N 293 PHE OXT O N N 294 PHE H H N N 295 PHE H2 H N N 296 PHE HA H N N 297 PHE HB2 H N N 298 PHE HB3 H N N 299 PHE HD1 H N N 300 PHE HD2 H N N 301 PHE HE1 H N N 302 PHE HE2 H N N 303 PHE HZ H N N 304 PHE HXT H N N 305 PRO N N N N 306 PRO CA C N S 307 PRO C C N N 308 PRO O O N N 309 PRO CB C N N 310 PRO CG C N N 311 PRO CD C N N 312 PRO OXT O N N 313 PRO H H N N 314 PRO HA H N N 315 PRO HB2 H N N 316 PRO HB3 H N N 317 PRO HG2 H N N 318 PRO HG3 H N N 319 PRO HD2 H N N 320 PRO HD3 H N N 321 PRO HXT H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 SO4 S S N N 337 SO4 O1 O N N 338 SO4 O2 O N N 339 SO4 O3 O N N 340 SO4 O4 O N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CR2 O3 C3 doub N N 70 CR2 CA3 C3 sing N N 71 CR2 CA3 N3 sing N N 72 CR2 C3 OXT sing N N 73 CR2 N1 CA1 sing N N 74 CR2 O2 C2 doub N N 75 CR2 N3 C2 sing N N 76 CR2 N3 C1 sing N N 77 CR2 C2 CA2 sing N N 78 CR2 CA1 C1 sing N N 79 CR2 C1 N2 doub N N 80 CR2 CA2 N2 sing N N 81 CR2 CA2 CB2 doub N Z 82 CR2 CB2 CG2 sing N N 83 CR2 CG2 CD2 doub Y N 84 CR2 CG2 CD1 sing Y N 85 CR2 CD2 CE2 sing Y N 86 CR2 CD1 CE1 doub Y N 87 CR2 CE2 CZ doub Y N 88 CR2 CE1 CZ sing Y N 89 CR2 CZ OH sing N N 90 CR2 N1 H sing N N 91 CR2 N1 H2 sing N N 92 CR2 CA1 HA1 sing N N 93 CR2 CA1 HA12 sing N N 94 CR2 CA3 HA31 sing N N 95 CR2 CA3 HA32 sing N N 96 CR2 CB2 HB2 sing N N 97 CR2 CD1 HD1 sing N N 98 CR2 CD2 HD2 sing N N 99 CR2 CE1 HE1 sing N N 100 CR2 CE2 HE2 sing N N 101 CR2 OH HOH sing N N 102 CR2 OXT HXT sing N N 103 CYS N CA sing N N 104 CYS N H sing N N 105 CYS N H2 sing N N 106 CYS CA C sing N N 107 CYS CA CB sing N N 108 CYS CA HA sing N N 109 CYS C O doub N N 110 CYS C OXT sing N N 111 CYS CB SG sing N N 112 CYS CB HB2 sing N N 113 CYS CB HB3 sing N N 114 CYS SG HG sing N N 115 CYS OXT HXT sing N N 116 GLN N CA sing N N 117 GLN N H sing N N 118 GLN N H2 sing N N 119 GLN CA C sing N N 120 GLN CA CB sing N N 121 GLN CA HA sing N N 122 GLN C O doub N N 123 GLN C OXT sing N N 124 GLN CB CG sing N N 125 GLN CB HB2 sing N N 126 GLN CB HB3 sing N N 127 GLN CG CD sing N N 128 GLN CG HG2 sing N N 129 GLN CG HG3 sing N N 130 GLN CD OE1 doub N N 131 GLN CD NE2 sing N N 132 GLN NE2 HE21 sing N N 133 GLN NE2 HE22 sing N N 134 GLN OXT HXT sing N N 135 GLU N CA sing N N 136 GLU N H sing N N 137 GLU N H2 sing N N 138 GLU CA C sing N N 139 GLU CA CB sing N N 140 GLU CA HA sing N N 141 GLU C O doub N N 142 GLU C OXT sing N N 143 GLU CB CG sing N N 144 GLU CB HB2 sing N N 145 GLU CB HB3 sing N N 146 GLU CG CD sing N N 147 GLU CG HG2 sing N N 148 GLU CG HG3 sing N N 149 GLU CD OE1 doub N N 150 GLU CD OE2 sing N N 151 GLU OE2 HE2 sing N N 152 GLU OXT HXT sing N N 153 GLY N CA sing N N 154 GLY N H sing N N 155 GLY N H2 sing N N 156 GLY CA C sing N N 157 GLY CA HA2 sing N N 158 GLY CA HA3 sing N N 159 GLY C O doub N N 160 GLY C OXT sing N N 161 GLY OXT HXT sing N N 162 HIS N CA sing N N 163 HIS N H sing N N 164 HIS N H2 sing N N 165 HIS CA C sing N N 166 HIS CA CB sing N N 167 HIS CA HA sing N N 168 HIS C O doub N N 169 HIS C OXT sing N N 170 HIS CB CG sing N N 171 HIS CB HB2 sing N N 172 HIS CB HB3 sing N N 173 HIS CG ND1 sing Y N 174 HIS CG CD2 doub Y N 175 HIS ND1 CE1 doub Y N 176 HIS ND1 HD1 sing N N 177 HIS CD2 NE2 sing Y N 178 HIS CD2 HD2 sing N N 179 HIS CE1 NE2 sing Y N 180 HIS CE1 HE1 sing N N 181 HIS NE2 HE2 sing N N 182 HIS OXT HXT sing N N 183 HOH O H1 sing N N 184 HOH O H2 sing N N 185 ILE N CA sing N N 186 ILE N H sing N N 187 ILE N H2 sing N N 188 ILE CA C sing N N 189 ILE CA CB sing N N 190 ILE CA HA sing N N 191 ILE C O doub N N 192 ILE C OXT sing N N 193 ILE CB CG1 sing N N 194 ILE CB CG2 sing N N 195 ILE CB HB sing N N 196 ILE CG1 CD1 sing N N 197 ILE CG1 HG12 sing N N 198 ILE CG1 HG13 sing N N 199 ILE CG2 HG21 sing N N 200 ILE CG2 HG22 sing N N 201 ILE CG2 HG23 sing N N 202 ILE CD1 HD11 sing N N 203 ILE CD1 HD12 sing N N 204 ILE CD1 HD13 sing N N 205 ILE OXT HXT sing N N 206 LEU N CA sing N N 207 LEU N H sing N N 208 LEU N H2 sing N N 209 LEU CA C sing N N 210 LEU CA CB sing N N 211 LEU CA HA sing N N 212 LEU C O doub N N 213 LEU C OXT sing N N 214 LEU CB CG sing N N 215 LEU CB HB2 sing N N 216 LEU CB HB3 sing N N 217 LEU CG CD1 sing N N 218 LEU CG CD2 sing N N 219 LEU CG HG sing N N 220 LEU CD1 HD11 sing N N 221 LEU CD1 HD12 sing N N 222 LEU CD1 HD13 sing N N 223 LEU CD2 HD21 sing N N 224 LEU CD2 HD22 sing N N 225 LEU CD2 HD23 sing N N 226 LEU OXT HXT sing N N 227 LYS N CA sing N N 228 LYS N H sing N N 229 LYS N H2 sing N N 230 LYS CA C sing N N 231 LYS CA CB sing N N 232 LYS CA HA sing N N 233 LYS C O doub N N 234 LYS C OXT sing N N 235 LYS CB CG sing N N 236 LYS CB HB2 sing N N 237 LYS CB HB3 sing N N 238 LYS CG CD sing N N 239 LYS CG HG2 sing N N 240 LYS CG HG3 sing N N 241 LYS CD CE sing N N 242 LYS CD HD2 sing N N 243 LYS CD HD3 sing N N 244 LYS CE NZ sing N N 245 LYS CE HE2 sing N N 246 LYS CE HE3 sing N N 247 LYS NZ HZ1 sing N N 248 LYS NZ HZ2 sing N N 249 LYS NZ HZ3 sing N N 250 LYS OXT HXT sing N N 251 MET N CA sing N N 252 MET N H sing N N 253 MET N H2 sing N N 254 MET CA C sing N N 255 MET CA CB sing N N 256 MET CA HA sing N N 257 MET C O doub N N 258 MET C OXT sing N N 259 MET CB CG sing N N 260 MET CB HB2 sing N N 261 MET CB HB3 sing N N 262 MET CG SD sing N N 263 MET CG HG2 sing N N 264 MET CG HG3 sing N N 265 MET SD CE sing N N 266 MET CE HE1 sing N N 267 MET CE HE2 sing N N 268 MET CE HE3 sing N N 269 MET OXT HXT sing N N 270 PHE N CA sing N N 271 PHE N H sing N N 272 PHE N H2 sing N N 273 PHE CA C sing N N 274 PHE CA CB sing N N 275 PHE CA HA sing N N 276 PHE C O doub N N 277 PHE C OXT sing N N 278 PHE CB CG sing N N 279 PHE CB HB2 sing N N 280 PHE CB HB3 sing N N 281 PHE CG CD1 doub Y N 282 PHE CG CD2 sing Y N 283 PHE CD1 CE1 sing Y N 284 PHE CD1 HD1 sing N N 285 PHE CD2 CE2 doub Y N 286 PHE CD2 HD2 sing N N 287 PHE CE1 CZ doub Y N 288 PHE CE1 HE1 sing N N 289 PHE CE2 CZ sing Y N 290 PHE CE2 HE2 sing N N 291 PHE CZ HZ sing N N 292 PHE OXT HXT sing N N 293 PRO N CA sing N N 294 PRO N CD sing N N 295 PRO N H sing N N 296 PRO CA C sing N N 297 PRO CA CB sing N N 298 PRO CA HA sing N N 299 PRO C O doub N N 300 PRO C OXT sing N N 301 PRO CB CG sing N N 302 PRO CB HB2 sing N N 303 PRO CB HB3 sing N N 304 PRO CG CD sing N N 305 PRO CG HG2 sing N N 306 PRO CG HG3 sing N N 307 PRO CD HD2 sing N N 308 PRO CD HD3 sing N N 309 PRO OXT HXT sing N N 310 SER N CA sing N N 311 SER N H sing N N 312 SER N H2 sing N N 313 SER CA C sing N N 314 SER CA CB sing N N 315 SER CA HA sing N N 316 SER C O doub N N 317 SER C OXT sing N N 318 SER CB OG sing N N 319 SER CB HB2 sing N N 320 SER CB HB3 sing N N 321 SER OG HG sing N N 322 SER OXT HXT sing N N 323 SO4 S O1 doub N N 324 SO4 S O2 doub N N 325 SO4 S O3 sing N N 326 SO4 S O4 sing N N 327 THR N CA sing N N 328 THR N H sing N N 329 THR N H2 sing N N 330 THR CA C sing N N 331 THR CA CB sing N N 332 THR CA HA sing N N 333 THR C O doub N N 334 THR C OXT sing N N 335 THR CB OG1 sing N N 336 THR CB CG2 sing N N 337 THR CB HB sing N N 338 THR OG1 HG1 sing N N 339 THR CG2 HG21 sing N N 340 THR CG2 HG22 sing N N 341 THR CG2 HG23 sing N N 342 THR OXT HXT sing N N 343 TRP N CA sing N N 344 TRP N H sing N N 345 TRP N H2 sing N N 346 TRP CA C sing N N 347 TRP CA CB sing N N 348 TRP CA HA sing N N 349 TRP C O doub N N 350 TRP C OXT sing N N 351 TRP CB CG sing N N 352 TRP CB HB2 sing N N 353 TRP CB HB3 sing N N 354 TRP CG CD1 doub Y N 355 TRP CG CD2 sing Y N 356 TRP CD1 NE1 sing Y N 357 TRP CD1 HD1 sing N N 358 TRP CD2 CE2 doub Y N 359 TRP CD2 CE3 sing Y N 360 TRP NE1 CE2 sing Y N 361 TRP NE1 HE1 sing N N 362 TRP CE2 CZ2 sing Y N 363 TRP CE3 CZ3 doub Y N 364 TRP CE3 HE3 sing N N 365 TRP CZ2 CH2 doub Y N 366 TRP CZ2 HZ2 sing N N 367 TRP CZ3 CH2 sing Y N 368 TRP CZ3 HZ3 sing N N 369 TRP CH2 HH2 sing N N 370 TRP OXT HXT sing N N 371 TYR N CA sing N N 372 TYR N H sing N N 373 TYR N H2 sing N N 374 TYR CA C sing N N 375 TYR CA CB sing N N 376 TYR CA HA sing N N 377 TYR C O doub N N 378 TYR C OXT sing N N 379 TYR CB CG sing N N 380 TYR CB HB2 sing N N 381 TYR CB HB3 sing N N 382 TYR CG CD1 doub Y N 383 TYR CG CD2 sing Y N 384 TYR CD1 CE1 sing Y N 385 TYR CD1 HD1 sing N N 386 TYR CD2 CE2 doub Y N 387 TYR CD2 HD2 sing N N 388 TYR CE1 CZ doub Y N 389 TYR CE1 HE1 sing N N 390 TYR CE2 CZ sing Y N 391 TYR CE2 HE2 sing N N 392 TYR CZ OH sing N N 393 TYR OH HH sing N N 394 TYR OXT HXT sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # _pdbx_audit_support.funding_organization 'Russian Foundation for Basic Research' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 19-04-00107 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1YFP _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6ZQO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017275 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017275 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005923 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #