data_6ZZE # _entry.id 6ZZE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ZZE pdb_00006zze 10.2210/pdb6zze/pdb WWPDB D_1292109299 ? ? BMRB 34547 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2021-01-13 _pdbx_database_PDB_obs_spr.pdb_id 6ZZE _pdbx_database_PDB_obs_spr.replace_pdb_id 2MUO _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Structure of the trans-(Tyr39-Pro40) form of the Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1)' _pdbx_database_related.db_id 34547 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6ZZE _pdbx_database_status.recvd_initial_deposition_date 2020-08-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Paramonov, A.S.' 1 0000-0003-3614-560X 'Lyukmanova, E.N.' 2 0000-0002-9728-9407 'Shenkarev, Z.O.' 3 0000-0003-1383-3522 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 21 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural Diversity and Dynamics of Human Three-Finger Proteins Acting on Nicotinic Acetylcholine Receptors.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms21197280 _citation.pdbx_database_id_PubMed 33019770 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Paramonov, A.S.' 1 0000-0003-3614-560X primary 'Kocharovskaya, M.V.' 2 ? primary 'Tsarev, A.V.' 3 0000-0001-5085-749X primary 'Kulbatskii, D.S.' 4 ? primary 'Loktyushov, E.V.' 5 ? primary 'Shulepko, M.A.' 6 ? primary 'Kirpichnikov, M.P.' 7 ? primary 'Lyukmanova, E.N.' 8 ? primary 'Shenkarev, Z.O.' 9 0000-0003-1383-3522 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6ZZE _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ZZE _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Secreted Ly-6/uPAR-related protein 1' _entity.formula_weight 8992.360 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SLURP-1,ARS component B,ARS(component B)-81/S,Anti-neoplastic urinary protein,ANUP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNS EL ; _entity_poly.pdbx_seq_one_letter_code_can ;MLKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNS EL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 LYS n 1 4 CYS n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 LYS n 1 9 GLU n 1 10 PRO n 1 11 MET n 1 12 THR n 1 13 SER n 1 14 ALA n 1 15 SER n 1 16 CYS n 1 17 ARG n 1 18 THR n 1 19 ILE n 1 20 THR n 1 21 ARG n 1 22 CYS n 1 23 LYS n 1 24 PRO n 1 25 GLU n 1 26 ASP n 1 27 THR n 1 28 ALA n 1 29 CYS n 1 30 MET n 1 31 THR n 1 32 THR n 1 33 LEU n 1 34 VAL n 1 35 THR n 1 36 VAL n 1 37 GLU n 1 38 ALA n 1 39 GLU n 1 40 TYR n 1 41 PRO n 1 42 PHE n 1 43 ASN n 1 44 GLN n 1 45 SER n 1 46 PRO n 1 47 VAL n 1 48 VAL n 1 49 THR n 1 50 ARG n 1 51 SER n 1 52 CYS n 1 53 SER n 1 54 SER n 1 55 SER n 1 56 CYS n 1 57 VAL n 1 58 ALA n 1 59 THR n 1 60 ASP n 1 61 PRO n 1 62 ASP n 1 63 SER n 1 64 ILE n 1 65 GLY n 1 66 ALA n 1 67 ALA n 1 68 HIS n 1 69 LEU n 1 70 ILE n 1 71 PHE n 1 72 CYS n 1 73 CYS n 1 74 PHE n 1 75 ARG n 1 76 ASP n 1 77 LEU n 1 78 CYS n 1 79 ASN n 1 80 SER n 1 81 GLU n 1 82 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 82 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SLURP1, ARS' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-22b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SLUR1_HUMAN _struct_ref.pdbx_db_accession P55000 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE L ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ZZE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55000 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 101 _struct_ref_seq.pdbx_auth_seq_align_end 181 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6ZZE _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P55000 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 100 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 2 '3D HNCO' 1 isotropic 4 1 2 '3D HNCA' 1 isotropic 5 1 2 '3D HNCACB' 1 isotropic 9 1 2 '3D HN(CO)CA' 1 isotropic 8 1 1 '3D 1H-15N TOCSY' 2 isotropic 7 1 1 '3D HNHA' 1 isotropic 6 1 3 '3D HCCH-TOCSY' 2 isotropic 10 1 2 '2D 1H-13C HSQC' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 4.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 5 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label cnd1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.3 mM [U-15N] SLURP-1, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N solution ? 2 '0.3 mM [U-13C; U-15N] SLURP-1, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N13C solution ? 3 '0.3 mM [U-13C; U-15N] SLURP-1, 100% D2O' '100% D2O' 15N13CD2O solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 ? 2 AVANCE ? Bruker 700 ? # _pdbx_nmr_refine.entry_id 6ZZE _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6ZZE _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6ZZE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 2 'chemical shift assignment' CARA 1.8 'Keller and Wuthrich' 3 collection TopSpin ? 'Bruker Biospin' 4 processing MddNMR ? 'V. Orekhov, V. Jaravine, M. Mayzel, K. Kazimierczuk, Swedish NMR Center, University of Gothenburg' 5 'peak picking' CARA ? 'Keller and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ZZE _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6ZZE _struct.title 'Structure of the trans-(Tyr39-Pro40) form of the Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ZZE _struct_keywords.text 'SLURP, Ly-6, three-finger protein, nicotinic acetylcholine receptor, Lynx, Lynx1, snake neurotoxin, NEUROPEPTIDE' _struct_keywords.pdbx_keywords NEUROPEPTIDE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 103 A CYS 121 1_555 ? ? ? ? ? ? ? 2.837 ? ? disulf2 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 103 A CYS 128 1_555 ? ? ? ? ? ? ? 1.922 ? ? disulf3 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 106 A CYS 115 1_555 ? ? ? ? ? ? ? 2.089 ? ? disulf4 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 121 A CYS 151 1_555 ? ? ? ? ? ? ? 2.106 ? ? disulf5 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 155 A CYS 171 1_555 ? ? ? ? ? ? ? 1.952 ? ? disulf6 disulf ? ? A CYS 73 SG ? ? ? 1_555 A CYS 78 SG ? ? A CYS 172 A CYS 177 1_555 ? ? ? ? ? ? ? 1.991 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 3 ? TYR A 5 ? LYS A 102 TYR A 104 AA1 2 ILE A 19 ? ARG A 21 ? ILE A 118 ARG A 120 AA2 1 VAL A 47 ? SER A 53 ? VAL A 146 SER A 152 AA2 2 ALA A 28 ? VAL A 34 ? ALA A 127 VAL A 133 AA2 3 LEU A 69 ? CYS A 73 ? LEU A 168 CYS A 172 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O CYS A 4 ? O CYS A 103 N THR A 20 ? N THR A 119 AA2 1 2 O SER A 53 ? O SER A 152 N ALA A 28 ? N ALA A 127 AA2 2 3 N CYS A 29 ? N CYS A 128 O CYS A 73 ? O CYS A 172 # _database_PDB_matrix.entry_id 6ZZE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6ZZE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 100 100 MET MET A . n A 1 2 LEU 2 101 101 LEU LEU A . n A 1 3 LYS 3 102 102 LYS LYS A . n A 1 4 CYS 4 103 103 CYS CYS A . n A 1 5 TYR 5 104 104 TYR TYR A . n A 1 6 THR 6 105 105 THR THR A . n A 1 7 CYS 7 106 106 CYS CYS A . n A 1 8 LYS 8 107 107 LYS LYS A . n A 1 9 GLU 9 108 108 GLU GLU A . n A 1 10 PRO 10 109 109 PRO PRO A . n A 1 11 MET 11 110 110 MET MET A . n A 1 12 THR 12 111 111 THR THR A . n A 1 13 SER 13 112 112 SER SER A . n A 1 14 ALA 14 113 113 ALA ALA A . n A 1 15 SER 15 114 114 SER SER A . n A 1 16 CYS 16 115 115 CYS CYS A . n A 1 17 ARG 17 116 116 ARG ARG A . n A 1 18 THR 18 117 117 THR THR A . n A 1 19 ILE 19 118 118 ILE ILE A . n A 1 20 THR 20 119 119 THR THR A . n A 1 21 ARG 21 120 120 ARG ARG A . n A 1 22 CYS 22 121 121 CYS CYS A . n A 1 23 LYS 23 122 122 LYS LYS A . n A 1 24 PRO 24 123 123 PRO PRO A . n A 1 25 GLU 25 124 124 GLU GLU A . n A 1 26 ASP 26 125 125 ASP ASP A . n A 1 27 THR 27 126 126 THR THR A . n A 1 28 ALA 28 127 127 ALA ALA A . n A 1 29 CYS 29 128 128 CYS CYS A . n A 1 30 MET 30 129 129 MET MET A . n A 1 31 THR 31 130 130 THR THR A . n A 1 32 THR 32 131 131 THR THR A . n A 1 33 LEU 33 132 132 LEU LEU A . n A 1 34 VAL 34 133 133 VAL VAL A . n A 1 35 THR 35 134 134 THR THR A . n A 1 36 VAL 36 135 135 VAL VAL A . n A 1 37 GLU 37 136 136 GLU GLU A . n A 1 38 ALA 38 137 137 ALA ALA A . n A 1 39 GLU 39 138 138 GLU GLU A . n A 1 40 TYR 40 139 139 TYR TYR A . n A 1 41 PRO 41 140 140 PRO PRO A . n A 1 42 PHE 42 141 141 PHE PHE A . n A 1 43 ASN 43 142 142 ASN ASN A . n A 1 44 GLN 44 143 143 GLN GLN A . n A 1 45 SER 45 144 144 SER SER A . n A 1 46 PRO 46 145 145 PRO PRO A . n A 1 47 VAL 47 146 146 VAL VAL A . n A 1 48 VAL 48 147 147 VAL VAL A . n A 1 49 THR 49 148 148 THR THR A . n A 1 50 ARG 50 149 149 ARG ARG A . n A 1 51 SER 51 150 150 SER SER A . n A 1 52 CYS 52 151 151 CYS CYS A . n A 1 53 SER 53 152 152 SER SER A . n A 1 54 SER 54 153 153 SER SER A . n A 1 55 SER 55 154 154 SER SER A . n A 1 56 CYS 56 155 155 CYS CYS A . n A 1 57 VAL 57 156 156 VAL VAL A . n A 1 58 ALA 58 157 157 ALA ALA A . n A 1 59 THR 59 158 158 THR THR A . n A 1 60 ASP 60 159 159 ASP ASP A . n A 1 61 PRO 61 160 160 PRO PRO A . n A 1 62 ASP 62 161 161 ASP ASP A . n A 1 63 SER 63 162 162 SER SER A . n A 1 64 ILE 64 163 163 ILE ILE A . n A 1 65 GLY 65 164 164 GLY GLY A . n A 1 66 ALA 66 165 165 ALA ALA A . n A 1 67 ALA 67 166 166 ALA ALA A . n A 1 68 HIS 68 167 167 HIS HIS A . n A 1 69 LEU 69 168 168 LEU LEU A . n A 1 70 ILE 70 169 169 ILE ILE A . n A 1 71 PHE 71 170 170 PHE PHE A . n A 1 72 CYS 72 171 171 CYS CYS A . n A 1 73 CYS 73 172 172 CYS CYS A . n A 1 74 PHE 74 173 173 PHE PHE A . n A 1 75 ARG 75 174 174 ARG ARG A . n A 1 76 ASP 76 175 175 ASP ASP A . n A 1 77 LEU 77 176 176 LEU LEU A . n A 1 78 CYS 78 177 177 CYS CYS A . n A 1 79 ASN 79 178 178 ASN ASN A . n A 1 80 SER 80 179 179 SER SER A . n A 1 81 GLU 81 180 180 GLU GLU A . n A 1 82 LEU 82 181 181 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6000 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2021-03-10 3 'Structure model' 1 2 2021-03-17 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 3 'Structure model' Advisory 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_PDB_obs_spr 2 3 'Structure model' pdbx_database_PDB_obs_spr 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_PDB_obs_spr.id' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 SLURP-1 0.3 ? mM '[U-15N]' 2 SLURP-1 0.3 ? mM '[U-13C; U-15N]' 3 SLURP-1 0.3 ? mM '[U-13C; U-15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 109 ? ? -69.75 -165.77 2 1 ALA A 113 ? ? -76.57 -76.12 3 1 THR A 126 ? ? -151.30 -36.56 4 1 SER A 144 ? ? -50.46 108.47 5 1 THR A 148 ? ? -160.22 111.26 6 1 SER A 154 ? ? 179.83 99.09 7 1 ALA A 166 ? ? -100.80 70.86 8 1 HIS A 167 ? ? -68.48 -168.51 9 2 GLU A 108 ? ? -113.80 73.34 10 2 PRO A 109 ? ? -69.78 83.19 11 2 MET A 110 ? ? -151.76 -73.30 12 2 THR A 111 ? ? -153.77 70.82 13 2 SER A 114 ? ? -165.30 91.23 14 2 CYS A 115 ? ? -64.50 91.25 15 2 THR A 126 ? ? -151.10 -37.14 16 2 VAL A 135 ? ? 39.74 38.56 17 2 PRO A 140 ? ? -69.80 -169.99 18 2 SER A 154 ? ? -177.59 92.88 19 2 THR A 158 ? ? -171.13 112.89 20 3 GLU A 108 ? ? -113.95 72.01 21 3 PRO A 109 ? ? -69.75 78.05 22 3 MET A 110 ? ? -173.90 -40.15 23 3 SER A 114 ? ? -130.05 -39.92 24 3 CYS A 115 ? ? 57.05 70.87 25 3 ASP A 125 ? ? -68.89 -179.85 26 3 THR A 126 ? ? -150.92 -39.79 27 3 ALA A 137 ? ? -169.71 107.37 28 3 PHE A 141 ? ? -172.72 112.86 29 3 SER A 154 ? ? -174.56 98.17 30 4 LYS A 107 ? ? -74.05 -71.06 31 4 PRO A 109 ? ? -69.73 93.99 32 4 CYS A 115 ? ? 61.29 76.95 33 4 THR A 126 ? ? -151.57 -36.30 34 4 ALA A 137 ? ? -74.94 -74.72 35 4 PRO A 140 ? ? -69.72 -171.18 36 4 PRO A 145 ? ? -69.74 -172.84 37 4 SER A 154 ? ? -179.69 98.30 38 4 THR A 158 ? ? -73.94 -165.44 39 4 SER A 179 ? ? -72.07 -70.14 40 5 GLU A 108 ? ? -112.43 74.70 41 5 PRO A 109 ? ? -69.80 92.96 42 5 MET A 110 ? ? -162.46 -52.61 43 5 SER A 114 ? ? -158.43 89.50 44 5 CYS A 115 ? ? -117.63 72.80 45 5 ARG A 116 ? ? -144.40 38.54 46 5 ASP A 125 ? ? -69.73 -179.68 47 5 THR A 126 ? ? -151.44 -37.71 48 5 ALA A 137 ? ? -98.41 -64.96 49 5 TYR A 139 ? ? -117.81 67.71 50 5 PRO A 140 ? ? -69.79 -170.29 51 5 GLN A 143 ? ? -69.77 -70.07 52 5 SER A 144 ? ? 62.49 72.95 53 5 SER A 154 ? ? -179.84 97.29 54 5 SER A 179 ? ? -172.52 90.30 55 6 SER A 112 ? ? -51.72 170.15 56 6 SER A 114 ? ? -162.28 -74.65 57 6 CYS A 115 ? ? 49.20 73.19 58 6 THR A 126 ? ? -151.09 -38.92 59 6 ALA A 137 ? ? -95.55 35.33 60 6 TYR A 139 ? ? -115.45 75.92 61 6 PRO A 140 ? ? -69.78 -179.01 62 6 SER A 144 ? ? -164.21 82.24 63 6 SER A 154 ? ? -177.61 95.88 64 6 ALA A 157 ? ? -69.13 -171.47 65 6 THR A 158 ? ? -68.70 97.04 66 6 SER A 179 ? ? -68.96 -76.74 67 7 GLU A 108 ? ? -150.62 68.68 68 7 THR A 111 ? ? -47.71 -74.48 69 7 SER A 112 ? ? -168.30 -169.75 70 7 SER A 114 ? ? -49.46 103.07 71 7 ASP A 125 ? ? -69.64 -178.79 72 7 THR A 126 ? ? -150.95 -39.82 73 7 TYR A 139 ? ? -118.76 67.86 74 7 PRO A 140 ? ? -69.75 -173.55 75 7 SER A 154 ? ? 179.83 96.02 76 8 PRO A 109 ? ? -69.81 -169.78 77 8 CYS A 115 ? ? -69.87 84.83 78 8 THR A 126 ? ? -150.88 -34.21 79 8 ALA A 137 ? ? -99.30 -75.06 80 8 SER A 144 ? ? -174.28 72.16 81 8 SER A 154 ? ? -179.19 95.11 82 8 THR A 158 ? ? -179.45 100.13 83 9 TYR A 104 ? ? -69.45 88.95 84 9 PRO A 109 ? ? -69.79 85.80 85 9 THR A 111 ? ? -50.55 103.00 86 9 SER A 114 ? ? -94.73 -69.92 87 9 THR A 126 ? ? -151.23 -37.52 88 9 ALA A 137 ? ? -168.82 107.23 89 9 PRO A 140 ? ? -69.77 75.13 90 9 GLN A 143 ? ? -100.11 -62.50 91 9 PRO A 145 ? ? -69.81 -169.37 92 9 SER A 154 ? ? -178.88 96.25 93 9 SER A 179 ? ? -155.50 85.59 94 9 GLU A 180 ? ? -69.60 -77.48 95 10 PRO A 109 ? ? -69.72 82.59 96 10 THR A 111 ? ? -50.88 102.94 97 10 SER A 114 ? ? -169.14 111.47 98 10 CYS A 115 ? ? -68.73 85.86 99 10 THR A 126 ? ? -150.32 -38.73 100 10 PRO A 140 ? ? -69.77 74.63 101 10 PHE A 141 ? ? -177.18 104.73 102 10 SER A 144 ? ? 63.44 107.96 103 10 PRO A 145 ? ? -69.76 -167.68 104 10 SER A 154 ? ? -179.53 96.25 105 11 GLU A 108 ? ? -112.57 74.51 106 11 PRO A 109 ? ? -69.75 82.38 107 11 MET A 110 ? ? -176.56 -36.65 108 11 SER A 114 ? ? -171.30 64.41 109 11 THR A 126 ? ? -151.34 -36.41 110 11 TYR A 139 ? ? -113.71 73.12 111 11 PRO A 140 ? ? -69.76 -169.40 112 11 SER A 144 ? ? 63.87 156.32 113 11 PRO A 145 ? ? -69.80 -167.80 114 11 SER A 154 ? ? -178.75 93.93 115 11 THR A 158 ? ? -98.30 39.87 116 11 ASP A 161 ? ? -100.26 -62.64 117 12 TYR A 104 ? ? -68.97 86.64 118 12 LYS A 107 ? ? -94.59 40.41 119 12 PRO A 109 ? ? -69.77 -167.77 120 12 MET A 110 ? ? -56.73 100.32 121 12 CYS A 115 ? ? 51.73 76.92 122 12 ASP A 125 ? ? -68.82 -179.00 123 12 THR A 126 ? ? -150.79 -39.42 124 12 VAL A 135 ? ? 36.06 49.30 125 12 ALA A 137 ? ? -179.09 116.03 126 12 PHE A 141 ? ? -94.18 36.12 127 12 ASN A 142 ? ? -56.89 179.60 128 12 SER A 154 ? ? 179.49 96.74 129 13 GLU A 108 ? ? -111.93 77.71 130 13 PRO A 109 ? ? -69.81 93.74 131 13 MET A 110 ? ? -142.59 -54.10 132 13 THR A 126 ? ? -150.14 -39.28 133 13 TYR A 139 ? ? -118.50 67.76 134 13 PRO A 140 ? ? -69.81 -169.78 135 13 SER A 154 ? ? -179.48 95.43 136 13 ALA A 166 ? ? -100.54 69.70 137 13 HIS A 167 ? ? -68.18 -168.47 138 13 SER A 179 ? ? -169.35 92.24 139 14 GLU A 108 ? ? -114.00 72.06 140 14 PRO A 109 ? ? -69.78 84.01 141 14 MET A 110 ? ? -174.62 113.89 142 14 SER A 114 ? ? -127.99 -54.05 143 14 CYS A 115 ? ? 60.33 76.27 144 14 THR A 126 ? ? -150.61 -36.45 145 14 VAL A 135 ? ? 37.54 42.75 146 14 GLU A 136 ? ? 51.96 83.08 147 14 ALA A 137 ? ? -179.87 118.99 148 14 SER A 144 ? ? -174.20 73.18 149 14 SER A 154 ? ? 179.70 96.66 150 15 TYR A 104 ? ? -69.74 86.44 151 15 GLU A 108 ? ? -111.40 79.38 152 15 MET A 110 ? ? -152.15 -54.06 153 15 ALA A 113 ? ? -50.90 104.47 154 15 SER A 114 ? ? 57.98 71.76 155 15 THR A 126 ? ? -151.28 -37.28 156 15 PRO A 140 ? ? -69.80 82.42 157 15 ASN A 142 ? ? -63.27 96.10 158 15 SER A 144 ? ? 63.82 156.71 159 15 SER A 154 ? ? 179.79 99.15 160 15 HIS A 167 ? ? -68.22 -70.57 161 15 SER A 179 ? ? -172.56 93.70 162 16 PRO A 109 ? ? -69.75 -166.53 163 16 ALA A 113 ? ? -55.17 -76.69 164 16 CYS A 115 ? ? -90.23 51.25 165 16 THR A 126 ? ? -151.05 -37.91 166 16 ALA A 137 ? ? 179.01 123.49 167 16 TYR A 139 ? ? -150.75 65.84 168 16 PRO A 140 ? ? -69.73 -171.12 169 16 SER A 144 ? ? -179.20 76.23 170 16 SER A 154 ? ? -176.38 92.11 171 17 PRO A 109 ? ? -69.74 70.19 172 17 MET A 110 ? ? 178.40 88.43 173 17 SER A 114 ? ? 179.24 149.62 174 17 CYS A 115 ? ? -67.11 87.00 175 17 THR A 126 ? ? -150.91 -36.99 176 17 GLU A 136 ? ? -93.65 43.11 177 17 ALA A 137 ? ? -174.22 90.81 178 17 ASN A 142 ? ? -167.32 119.04 179 17 SER A 144 ? ? 62.99 77.42 180 17 PRO A 145 ? ? -69.69 -173.53 181 17 THR A 148 ? ? -163.09 109.24 182 17 SER A 154 ? ? -179.78 95.48 183 17 PRO A 160 ? ? -69.71 -87.69 184 17 ALA A 166 ? ? -100.99 73.22 185 18 LYS A 107 ? ? -69.58 -76.47 186 18 PRO A 109 ? ? -69.80 89.39 187 18 SER A 112 ? ? -50.98 109.00 188 18 SER A 114 ? ? -49.38 -72.64 189 18 CYS A 115 ? ? 52.60 72.43 190 18 ASP A 125 ? ? -69.53 -178.64 191 18 THR A 126 ? ? -150.09 -39.38 192 18 THR A 134 ? ? -61.81 98.14 193 18 ALA A 137 ? ? -152.52 81.45 194 18 SER A 144 ? ? -178.06 68.71 195 18 SER A 154 ? ? -179.30 96.06 196 18 CYS A 155 ? ? -68.49 98.23 197 18 THR A 158 ? ? -175.96 139.75 198 18 PRO A 160 ? ? -69.77 -86.41 199 18 ALA A 166 ? ? -101.35 66.93 200 18 HIS A 167 ? ? -69.31 -79.68 201 18 SER A 179 ? ? -99.58 -74.92 202 19 GLU A 108 ? ? -112.48 75.04 203 19 PRO A 109 ? ? -69.73 80.61 204 19 MET A 110 ? ? -156.58 -71.91 205 19 CYS A 115 ? ? -67.51 87.80 206 19 THR A 126 ? ? -151.43 -36.30 207 19 TYR A 139 ? ? -113.90 73.20 208 19 SER A 154 ? ? -179.74 94.03 209 19 PRO A 160 ? ? -69.76 -86.57 210 19 ALA A 166 ? ? -97.62 51.42 211 19 HIS A 167 ? ? -85.28 -78.55 212 19 SER A 179 ? ? -102.18 -74.96 213 20 PRO A 109 ? ? -69.78 89.37 214 20 THR A 111 ? ? -50.95 102.79 215 20 SER A 114 ? ? -173.77 94.89 216 20 CYS A 115 ? ? -67.75 85.22 217 20 THR A 126 ? ? -150.97 -34.38 218 20 GLU A 136 ? ? -94.59 -62.93 219 20 PHE A 141 ? ? -98.86 -69.15 220 20 SER A 154 ? ? -179.14 95.11 221 20 THR A 158 ? ? -179.95 118.00 222 20 PRO A 160 ? ? -69.78 -86.96 223 20 HIS A 167 ? ? -85.53 -79.23 224 20 SER A 179 ? ? -70.07 -74.30 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #