data_6AC0 # _entry.id 6AC0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6AC0 pdb_00006ac0 10.2210/pdb6ac0/pdb WWPDB D_1300008468 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-01 2 'Structure model' 1 1 2019-06-26 3 'Structure model' 1 2 2020-07-29 4 'Structure model' 1 3 2023-11-22 5 'Structure model' 1 4 2024-10-16 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Refinement description' 9 4 'Structure model' 'Structure summary' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp 3 3 'Structure model' entity 4 3 'Structure model' pdbx_chem_comp_identifier 5 3 'Structure model' pdbx_entity_nonpoly 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_site 8 3 'Structure model' struct_site_gen 9 4 'Structure model' chem_comp 10 4 'Structure model' chem_comp_atom 11 4 'Structure model' chem_comp_bond 12 4 'Structure model' database_2 13 4 'Structure model' pdbx_initial_refinement_model 14 5 'Structure model' pdbx_entry_details 15 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_ISSN' 3 2 'Structure model' '_citation.journal_volume' 4 2 'Structure model' '_citation.page_first' 5 3 'Structure model' '_chem_comp.name' 6 3 'Structure model' '_chem_comp.type' 7 3 'Structure model' '_entity.pdbx_description' 8 3 'Structure model' '_pdbx_entity_nonpoly.name' 9 3 'Structure model' '_struct_conn.pdbx_role' 10 4 'Structure model' '_chem_comp.pdbx_synonyms' 11 4 'Structure model' '_database_2.pdbx_DOI' 12 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6AC0 _pdbx_database_status.recvd_initial_deposition_date 2018-07-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ding, J.' 1 ? 'Shao, F.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 74 _citation.language ? _citation.page_first 922 _citation.page_last ? _citation.title 'Structural and Functional Insights into Host Death Domains Inactivation by the Bacterial Arginine GlcNAcyltransferase Effector.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2019.03.028 _citation.pdbx_database_id_PubMed 30979585 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ding, J.' 1 ? primary 'Pan, X.' 2 ? primary 'Du, L.' 3 ? primary 'Yao, Q.' 4 ? primary 'Xue, J.' 5 ? primary 'Yao, H.' 6 ? primary 'Wang, D.C.' 7 ? primary 'Li, S.' 8 ? primary 'Shao, F.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tumor necrosis factor receptor type 1-associated DEATH domain protein' 13325.075 1 ? ? ? ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 3 water nat water 18.015 104 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TNFR1-associated DEATH domain protein,TNFRSF1A-associated via death domain' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQ AEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA ; _entity_poly.pdbx_seq_one_letter_code_can ;PPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQ AEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 PRO n 1 3 PRO n 1 4 PRO n 1 5 ALA n 1 6 GLN n 1 7 THR n 1 8 PHE n 1 9 LEU n 1 10 PHE n 1 11 GLN n 1 12 GLY n 1 13 GLN n 1 14 PRO n 1 15 VAL n 1 16 VAL n 1 17 ASN n 1 18 ARG n 1 19 PRO n 1 20 LEU n 1 21 SER n 1 22 LEU n 1 23 LYS n 1 24 ASP n 1 25 GLN n 1 26 GLN n 1 27 THR n 1 28 PHE n 1 29 ALA n 1 30 ARG n 1 31 SER n 1 32 VAL n 1 33 GLY n 1 34 LEU n 1 35 LYS n 1 36 TRP n 1 37 ARG n 1 38 LYS n 1 39 VAL n 1 40 GLY n 1 41 ARG n 1 42 SER n 1 43 LEU n 1 44 GLN n 1 45 ARG n 1 46 GLY n 1 47 CYS n 1 48 ARG n 1 49 ALA n 1 50 LEU n 1 51 ARG n 1 52 ASP n 1 53 PRO n 1 54 ALA n 1 55 LEU n 1 56 ASP n 1 57 SER n 1 58 LEU n 1 59 ALA n 1 60 TYR n 1 61 GLU n 1 62 TYR n 1 63 GLU n 1 64 ARG n 1 65 GLU n 1 66 GLY n 1 67 LEU n 1 68 TYR n 1 69 GLU n 1 70 GLN n 1 71 ALA n 1 72 PHE n 1 73 GLN n 1 74 LEU n 1 75 LEU n 1 76 ARG n 1 77 ARG n 1 78 PHE n 1 79 VAL n 1 80 GLN n 1 81 ALA n 1 82 GLU n 1 83 GLY n 1 84 ARG n 1 85 ARG n 1 86 ALA n 1 87 THR n 1 88 LEU n 1 89 GLN n 1 90 ARG n 1 91 LEU n 1 92 VAL n 1 93 GLU n 1 94 ALA n 1 95 LEU n 1 96 GLU n 1 97 GLU n 1 98 ASN n 1 99 GLU n 1 100 LEU n 1 101 THR n 1 102 SER n 1 103 LEU n 1 104 ALA n 1 105 GLU n 1 106 ASP n 1 107 LEU n 1 108 LEU n 1 109 GLY n 1 110 LEU n 1 111 THR n 1 112 ASP n 1 113 PRO n 1 114 ASN n 1 115 GLY n 1 116 GLY n 1 117 LEU n 1 118 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 118 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TRADD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX6p _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 195 ? ? ? A . n A 1 2 PRO 2 196 ? ? ? A . n A 1 3 PRO 3 197 ? ? ? A . n A 1 4 PRO 4 198 198 PRO PRO A . n A 1 5 ALA 5 199 199 ALA ALA A . n A 1 6 GLN 6 200 200 GLN GLN A . n A 1 7 THR 7 201 201 THR THR A . n A 1 8 PHE 8 202 202 PHE PHE A . n A 1 9 LEU 9 203 203 LEU LEU A . n A 1 10 PHE 10 204 204 PHE PHE A . n A 1 11 GLN 11 205 205 GLN GLN A . n A 1 12 GLY 12 206 206 GLY GLY A . n A 1 13 GLN 13 207 207 GLN GLN A . n A 1 14 PRO 14 208 208 PRO PRO A . n A 1 15 VAL 15 209 209 VAL VAL A . n A 1 16 VAL 16 210 210 VAL VAL A . n A 1 17 ASN 17 211 211 ASN ASN A . n A 1 18 ARG 18 212 212 ARG ARG A . n A 1 19 PRO 19 213 213 PRO PRO A . n A 1 20 LEU 20 214 214 LEU LEU A . n A 1 21 SER 21 215 215 SER SER A . n A 1 22 LEU 22 216 216 LEU LEU A . n A 1 23 LYS 23 217 217 LYS LYS A . n A 1 24 ASP 24 218 218 ASP ASP A . n A 1 25 GLN 25 219 219 GLN GLN A . n A 1 26 GLN 26 220 220 GLN GLN A . n A 1 27 THR 27 221 221 THR THR A . n A 1 28 PHE 28 222 222 PHE PHE A . n A 1 29 ALA 29 223 223 ALA ALA A . n A 1 30 ARG 30 224 224 ARG ARG A . n A 1 31 SER 31 225 225 SER SER A . n A 1 32 VAL 32 226 226 VAL VAL A . n A 1 33 GLY 33 227 227 GLY GLY A . n A 1 34 LEU 34 228 228 LEU LEU A . n A 1 35 LYS 35 229 229 LYS LYS A . n A 1 36 TRP 36 230 230 TRP TRP A . n A 1 37 ARG 37 231 231 ARG ARG A . n A 1 38 LYS 38 232 232 LYS LYS A . n A 1 39 VAL 39 233 233 VAL VAL A . n A 1 40 GLY 40 234 234 GLY GLY A . n A 1 41 ARG 41 235 235 ARG ARG A . n A 1 42 SER 42 236 236 SER SER A . n A 1 43 LEU 43 237 237 LEU LEU A . n A 1 44 GLN 44 238 238 GLN GLN A . n A 1 45 ARG 45 239 239 ARG ARG A . n A 1 46 GLY 46 240 240 GLY GLY A . n A 1 47 CYS 47 241 241 CYS CYS A . n A 1 48 ARG 48 242 242 ARG ARG A . n A 1 49 ALA 49 243 243 ALA ALA A . n A 1 50 LEU 50 244 244 LEU LEU A . n A 1 51 ARG 51 245 245 ARG ARG A . n A 1 52 ASP 52 246 246 ASP ASP A . n A 1 53 PRO 53 247 247 PRO PRO A . n A 1 54 ALA 54 248 248 ALA ALA A . n A 1 55 LEU 55 249 249 LEU LEU A . n A 1 56 ASP 56 250 250 ASP ASP A . n A 1 57 SER 57 251 251 SER SER A . n A 1 58 LEU 58 252 252 LEU LEU A . n A 1 59 ALA 59 253 253 ALA ALA A . n A 1 60 TYR 60 254 254 TYR TYR A . n A 1 61 GLU 61 255 255 GLU GLU A . n A 1 62 TYR 62 256 256 TYR TYR A . n A 1 63 GLU 63 257 257 GLU GLU A . n A 1 64 ARG 64 258 258 ARG ARG A . n A 1 65 GLU 65 259 259 GLU GLU A . n A 1 66 GLY 66 260 260 GLY GLY A . n A 1 67 LEU 67 261 261 LEU LEU A . n A 1 68 TYR 68 262 262 TYR TYR A . n A 1 69 GLU 69 263 263 GLU GLU A . n A 1 70 GLN 70 264 264 GLN GLN A . n A 1 71 ALA 71 265 265 ALA ALA A . n A 1 72 PHE 72 266 266 PHE PHE A . n A 1 73 GLN 73 267 267 GLN GLN A . n A 1 74 LEU 74 268 268 LEU LEU A . n A 1 75 LEU 75 269 269 LEU LEU A . n A 1 76 ARG 76 270 270 ARG ARG A . n A 1 77 ARG 77 271 271 ARG ARG A . n A 1 78 PHE 78 272 272 PHE PHE A . n A 1 79 VAL 79 273 273 VAL VAL A . n A 1 80 GLN 80 274 274 GLN GLN A . n A 1 81 ALA 81 275 275 ALA ALA A . n A 1 82 GLU 82 276 276 GLU GLU A . n A 1 83 GLY 83 277 277 GLY GLY A . n A 1 84 ARG 84 278 278 ARG ARG A . n A 1 85 ARG 85 279 279 ARG ARG A . n A 1 86 ALA 86 280 280 ALA ALA A . n A 1 87 THR 87 281 281 THR THR A . n A 1 88 LEU 88 282 282 LEU LEU A . n A 1 89 GLN 89 283 283 GLN GLN A . n A 1 90 ARG 90 284 284 ARG ARG A . n A 1 91 LEU 91 285 285 LEU LEU A . n A 1 92 VAL 92 286 286 VAL VAL A . n A 1 93 GLU 93 287 287 GLU GLU A . n A 1 94 ALA 94 288 288 ALA ALA A . n A 1 95 LEU 95 289 289 LEU LEU A . n A 1 96 GLU 96 290 290 GLU GLU A . n A 1 97 GLU 97 291 291 GLU GLU A . n A 1 98 ASN 98 292 292 ASN ASN A . n A 1 99 GLU 99 293 293 GLU GLU A . n A 1 100 LEU 100 294 294 LEU LEU A . n A 1 101 THR 101 295 295 THR THR A . n A 1 102 SER 102 296 296 SER SER A . n A 1 103 LEU 103 297 297 LEU LEU A . n A 1 104 ALA 104 298 298 ALA ALA A . n A 1 105 GLU 105 299 299 GLU GLU A . n A 1 106 ASP 106 300 300 ASP ASP A . n A 1 107 LEU 107 301 301 LEU LEU A . n A 1 108 LEU 108 302 302 LEU LEU A . n A 1 109 GLY 109 303 303 GLY GLY A . n A 1 110 LEU 110 304 304 LEU LEU A . n A 1 111 THR 111 305 305 THR THR A . n A 1 112 ASP 112 306 306 ASP ASP A . n A 1 113 PRO 113 307 307 PRO PRO A . n A 1 114 ASN 114 308 308 ASN ASN A . n A 1 115 GLY 115 309 309 GLY GLY A . n A 1 116 GLY 116 310 310 GLY GLY A . n A 1 117 LEU 117 311 311 LEU LEU A . n A 1 118 ALA 118 312 312 ALA ALA A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NAG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NAG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 401 1 NAG NAG A . C 3 HOH 1 501 123 HOH HOH A . C 3 HOH 2 502 40 HOH HOH A . C 3 HOH 3 503 111 HOH HOH A . C 3 HOH 4 504 76 HOH HOH A . C 3 HOH 5 505 75 HOH HOH A . C 3 HOH 6 506 94 HOH HOH A . C 3 HOH 7 507 103 HOH HOH A . C 3 HOH 8 508 50 HOH HOH A . C 3 HOH 9 509 25 HOH HOH A . C 3 HOH 10 510 60 HOH HOH A . C 3 HOH 11 511 73 HOH HOH A . C 3 HOH 12 512 24 HOH HOH A . C 3 HOH 13 513 68 HOH HOH A . C 3 HOH 14 514 6 HOH HOH A . C 3 HOH 15 515 15 HOH HOH A . C 3 HOH 16 516 43 HOH HOH A . C 3 HOH 17 517 9 HOH HOH A . C 3 HOH 18 518 36 HOH HOH A . C 3 HOH 19 519 124 HOH HOH A . C 3 HOH 20 520 27 HOH HOH A . C 3 HOH 21 521 14 HOH HOH A . C 3 HOH 22 522 29 HOH HOH A . C 3 HOH 23 523 66 HOH HOH A . C 3 HOH 24 524 21 HOH HOH A . C 3 HOH 25 525 83 HOH HOH A . C 3 HOH 26 526 10 HOH HOH A . C 3 HOH 27 527 49 HOH HOH A . C 3 HOH 28 528 46 HOH HOH A . C 3 HOH 29 529 19 HOH HOH A . C 3 HOH 30 530 7 HOH HOH A . C 3 HOH 31 531 4 HOH HOH A . C 3 HOH 32 532 35 HOH HOH A . C 3 HOH 33 533 34 HOH HOH A . C 3 HOH 34 534 93 HOH HOH A . C 3 HOH 35 535 17 HOH HOH A . C 3 HOH 36 536 64 HOH HOH A . C 3 HOH 37 537 8 HOH HOH A . C 3 HOH 38 538 3 HOH HOH A . C 3 HOH 39 539 2 HOH HOH A . C 3 HOH 40 540 32 HOH HOH A . C 3 HOH 41 541 20 HOH HOH A . C 3 HOH 42 542 11 HOH HOH A . C 3 HOH 43 543 1 HOH HOH A . C 3 HOH 44 544 12 HOH HOH A . C 3 HOH 45 545 30 HOH HOH A . C 3 HOH 46 546 104 HOH HOH A . C 3 HOH 47 547 101 HOH HOH A . C 3 HOH 48 548 63 HOH HOH A . C 3 HOH 49 549 57 HOH HOH A . C 3 HOH 50 550 56 HOH HOH A . C 3 HOH 51 551 122 HOH HOH A . C 3 HOH 52 552 45 HOH HOH A . C 3 HOH 53 553 48 HOH HOH A . C 3 HOH 54 554 37 HOH HOH A . C 3 HOH 55 555 79 HOH HOH A . C 3 HOH 56 556 26 HOH HOH A . C 3 HOH 57 557 72 HOH HOH A . C 3 HOH 58 558 42 HOH HOH A . C 3 HOH 59 559 28 HOH HOH A . C 3 HOH 60 560 13 HOH HOH A . C 3 HOH 61 561 39 HOH HOH A . C 3 HOH 62 562 38 HOH HOH A . C 3 HOH 63 563 112 HOH HOH A . C 3 HOH 64 564 100 HOH HOH A . C 3 HOH 65 565 110 HOH HOH A . C 3 HOH 66 566 62 HOH HOH A . C 3 HOH 67 567 5 HOH HOH A . C 3 HOH 68 568 41 HOH HOH A . C 3 HOH 69 569 16 HOH HOH A . C 3 HOH 70 570 18 HOH HOH A . C 3 HOH 71 571 106 HOH HOH A . C 3 HOH 72 572 99 HOH HOH A . C 3 HOH 73 573 33 HOH HOH A . C 3 HOH 74 574 22 HOH HOH A . C 3 HOH 75 575 120 HOH HOH A . C 3 HOH 76 576 105 HOH HOH A . C 3 HOH 77 577 119 HOH HOH A . C 3 HOH 78 578 87 HOH HOH A . C 3 HOH 79 579 85 HOH HOH A . C 3 HOH 80 580 95 HOH HOH A . C 3 HOH 81 581 52 HOH HOH A . C 3 HOH 82 582 58 HOH HOH A . C 3 HOH 83 583 81 HOH HOH A . C 3 HOH 84 584 84 HOH HOH A . C 3 HOH 85 585 118 HOH HOH A . C 3 HOH 86 586 61 HOH HOH A . C 3 HOH 87 587 74 HOH HOH A . C 3 HOH 88 588 89 HOH HOH A . C 3 HOH 89 589 31 HOH HOH A . C 3 HOH 90 590 69 HOH HOH A . C 3 HOH 91 591 23 HOH HOH A . C 3 HOH 92 592 80 HOH HOH A . C 3 HOH 93 593 65 HOH HOH A . C 3 HOH 94 594 82 HOH HOH A . C 3 HOH 95 595 77 HOH HOH A . C 3 HOH 96 596 53 HOH HOH A . C 3 HOH 97 597 90 HOH HOH A . C 3 HOH 98 598 54 HOH HOH A . C 3 HOH 99 599 67 HOH HOH A . C 3 HOH 100 600 113 HOH HOH A . C 3 HOH 101 601 98 HOH HOH A . C 3 HOH 102 602 71 HOH HOH A . C 3 HOH 103 603 44 HOH HOH A . C 3 HOH 104 604 47 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6AC0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 28.600 _cell.length_a_esd ? _cell.length_b 28.600 _cell.length_b_esd ? _cell.length_c 264.720 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6AC0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AC0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.6 M Na/KPO4, pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-11-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97899 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97899 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6AC0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.449 _reflns.d_resolution_low 28.6 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20061 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.6 _reflns.pdbx_Rmerge_I_obs 0.111 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.449 _reflns_shell.d_res_low 1.53 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2913 _reflns_shell.percent_possible_all 99.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.349 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6AC0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.449 _refine.ls_d_res_low 28.435 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20047 _refine.ls_number_reflns_R_free 1022 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.28 _refine.ls_percent_reflns_R_free 5.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1864 _refine.ls_R_factor_R_free 0.2242 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1844 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3OQ9 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.74 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.17 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 919 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 104 _refine_hist.number_atoms_total 1037 _refine_hist.d_res_high 1.449 _refine_hist.d_res_low 28.435 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 958 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.873 ? 1296 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 20.633 ? 374 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.066 ? 143 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 174 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4490 1.5254 . . 152 2694 99.00 . . . 0.2693 . 0.2035 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5254 1.6210 . . 144 2750 99.00 . . . 0.2186 . 0.1648 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6210 1.7461 . . 155 2732 99.00 . . . 0.2271 . 0.1692 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7461 1.9218 . . 143 2762 98.00 . . . 0.2522 . 0.1733 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9218 2.1998 . . 162 2727 96.00 . . . 0.2329 . 0.1657 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1998 2.7711 . . 141 2677 93.00 . . . 0.2009 . 0.1870 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7711 28.4400 . . 125 2683 85.00 . . . 0.2216 . 0.1982 . . . . . . . . . . # _struct.entry_id 6AC0 _struct.title 'Crystal structure of TRADD death domain GlcNAcylated by EPEC effector NleB' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AC0 _struct_keywords.text 'apoptosis, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRADD_HUMAN _struct_ref.pdbx_db_accession Q15628 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQ AEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA ; _struct_ref.pdbx_align_begin 195 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6AC0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15628 _struct_ref_seq.db_align_beg 195 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 312 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 195 _struct_ref_seq.pdbx_auth_seq_align_end 312 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details monomer # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 21 ? VAL A 32 ? SER A 215 VAL A 226 1 ? 12 HELX_P HELX_P2 AA2 LYS A 35 ? ARG A 45 ? LYS A 229 ARG A 239 1 ? 11 HELX_P HELX_P3 AA3 GLY A 46 ? ARG A 51 ? GLY A 240 ARG A 245 5 ? 6 HELX_P HELX_P4 AA4 PRO A 53 ? GLU A 63 ? PRO A 247 GLU A 257 1 ? 11 HELX_P HELX_P5 AA5 GLY A 66 ? GLY A 83 ? GLY A 260 GLY A 277 1 ? 18 HELX_P HELX_P6 AA6 ARG A 84 ? ALA A 86 ? ARG A 278 ALA A 280 5 ? 3 HELX_P HELX_P7 AA7 THR A 87 ? ASN A 98 ? THR A 281 ASN A 292 1 ? 12 HELX_P HELX_P8 AA8 LEU A 100 ? LEU A 108 ? LEU A 294 LEU A 302 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ARG _struct_conn.ptnr1_label_seq_id 41 _struct_conn.ptnr1_label_atom_id NH2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id NAG _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ARG _struct_conn.ptnr1_auth_seq_id 235 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NAG _struct_conn.ptnr2_auth_seq_id 401 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.442 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role N-Glycosylation # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NAG _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id ARG _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 41 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id NAG _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 401 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id ARG _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 235 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom NH2 _pdbx_modification_feature.modified_residue_id ARG _pdbx_modification_feature.ref_pcm_id 3 _pdbx_modification_feature.ref_comp_id NAG _pdbx_modification_feature.type N-Glycosylation _pdbx_modification_feature.category Carbohydrate # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 52 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 246 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 53 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 247 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.13 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 7 ? PHE A 10 ? THR A 201 PHE A 204 AA1 2 GLN A 13 ? VAL A 16 ? GLN A 207 VAL A 210 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 10 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 204 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 13 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 207 # _pdbx_entry_details.entry_id 6AC0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH2 A ARG 231 ? ? O A HOH 501 ? ? 2.14 2 1 OG A SER 225 ? ? O A HOH 502 ? ? 2.16 3 1 OG1 A THR 305 ? ? O A HOH 503 ? ? 2.19 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 195 ? A PRO 1 2 1 Y 1 A PRO 196 ? A PRO 2 3 1 Y 1 A PRO 197 ? A PRO 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 LEU N N N N 140 LEU CA C N S 141 LEU C C N N 142 LEU O O N N 143 LEU CB C N N 144 LEU CG C N N 145 LEU CD1 C N N 146 LEU CD2 C N N 147 LEU OXT O N N 148 LEU H H N N 149 LEU H2 H N N 150 LEU HA H N N 151 LEU HB2 H N N 152 LEU HB3 H N N 153 LEU HG H N N 154 LEU HD11 H N N 155 LEU HD12 H N N 156 LEU HD13 H N N 157 LEU HD21 H N N 158 LEU HD22 H N N 159 LEU HD23 H N N 160 LEU HXT H N N 161 LYS N N N N 162 LYS CA C N S 163 LYS C C N N 164 LYS O O N N 165 LYS CB C N N 166 LYS CG C N N 167 LYS CD C N N 168 LYS CE C N N 169 LYS NZ N N N 170 LYS OXT O N N 171 LYS H H N N 172 LYS H2 H N N 173 LYS HA H N N 174 LYS HB2 H N N 175 LYS HB3 H N N 176 LYS HG2 H N N 177 LYS HG3 H N N 178 LYS HD2 H N N 179 LYS HD3 H N N 180 LYS HE2 H N N 181 LYS HE3 H N N 182 LYS HZ1 H N N 183 LYS HZ2 H N N 184 LYS HZ3 H N N 185 LYS HXT H N N 186 NAG C1 C N R 187 NAG C2 C N R 188 NAG C3 C N R 189 NAG C4 C N S 190 NAG C5 C N R 191 NAG C6 C N N 192 NAG C7 C N N 193 NAG C8 C N N 194 NAG N2 N N N 195 NAG O1 O N N 196 NAG O3 O N N 197 NAG O4 O N N 198 NAG O5 O N N 199 NAG O6 O N N 200 NAG O7 O N N 201 NAG H1 H N N 202 NAG H2 H N N 203 NAG H3 H N N 204 NAG H4 H N N 205 NAG H5 H N N 206 NAG H61 H N N 207 NAG H62 H N N 208 NAG H81 H N N 209 NAG H82 H N N 210 NAG H83 H N N 211 NAG HN2 H N N 212 NAG HO1 H N N 213 NAG HO3 H N N 214 NAG HO4 H N N 215 NAG HO6 H N N 216 PHE N N N N 217 PHE CA C N S 218 PHE C C N N 219 PHE O O N N 220 PHE CB C N N 221 PHE CG C Y N 222 PHE CD1 C Y N 223 PHE CD2 C Y N 224 PHE CE1 C Y N 225 PHE CE2 C Y N 226 PHE CZ C Y N 227 PHE OXT O N N 228 PHE H H N N 229 PHE H2 H N N 230 PHE HA H N N 231 PHE HB2 H N N 232 PHE HB3 H N N 233 PHE HD1 H N N 234 PHE HD2 H N N 235 PHE HE1 H N N 236 PHE HE2 H N N 237 PHE HZ H N N 238 PHE HXT H N N 239 PRO N N N N 240 PRO CA C N S 241 PRO C C N N 242 PRO O O N N 243 PRO CB C N N 244 PRO CG C N N 245 PRO CD C N N 246 PRO OXT O N N 247 PRO H H N N 248 PRO HA H N N 249 PRO HB2 H N N 250 PRO HB3 H N N 251 PRO HG2 H N N 252 PRO HG3 H N N 253 PRO HD2 H N N 254 PRO HD3 H N N 255 PRO HXT H N N 256 SER N N N N 257 SER CA C N S 258 SER C C N N 259 SER O O N N 260 SER CB C N N 261 SER OG O N N 262 SER OXT O N N 263 SER H H N N 264 SER H2 H N N 265 SER HA H N N 266 SER HB2 H N N 267 SER HB3 H N N 268 SER HG H N N 269 SER HXT H N N 270 THR N N N N 271 THR CA C N S 272 THR C C N N 273 THR O O N N 274 THR CB C N R 275 THR OG1 O N N 276 THR CG2 C N N 277 THR OXT O N N 278 THR H H N N 279 THR H2 H N N 280 THR HA H N N 281 THR HB H N N 282 THR HG1 H N N 283 THR HG21 H N N 284 THR HG22 H N N 285 THR HG23 H N N 286 THR HXT H N N 287 TRP N N N N 288 TRP CA C N S 289 TRP C C N N 290 TRP O O N N 291 TRP CB C N N 292 TRP CG C Y N 293 TRP CD1 C Y N 294 TRP CD2 C Y N 295 TRP NE1 N Y N 296 TRP CE2 C Y N 297 TRP CE3 C Y N 298 TRP CZ2 C Y N 299 TRP CZ3 C Y N 300 TRP CH2 C Y N 301 TRP OXT O N N 302 TRP H H N N 303 TRP H2 H N N 304 TRP HA H N N 305 TRP HB2 H N N 306 TRP HB3 H N N 307 TRP HD1 H N N 308 TRP HE1 H N N 309 TRP HE3 H N N 310 TRP HZ2 H N N 311 TRP HZ3 H N N 312 TRP HH2 H N N 313 TRP HXT H N N 314 TYR N N N N 315 TYR CA C N S 316 TYR C C N N 317 TYR O O N N 318 TYR CB C N N 319 TYR CG C Y N 320 TYR CD1 C Y N 321 TYR CD2 C Y N 322 TYR CE1 C Y N 323 TYR CE2 C Y N 324 TYR CZ C Y N 325 TYR OH O N N 326 TYR OXT O N N 327 TYR H H N N 328 TYR H2 H N N 329 TYR HA H N N 330 TYR HB2 H N N 331 TYR HB3 H N N 332 TYR HD1 H N N 333 TYR HD2 H N N 334 TYR HE1 H N N 335 TYR HE2 H N N 336 TYR HH H N N 337 TYR HXT H N N 338 VAL N N N N 339 VAL CA C N S 340 VAL C C N N 341 VAL O O N N 342 VAL CB C N N 343 VAL CG1 C N N 344 VAL CG2 C N N 345 VAL OXT O N N 346 VAL H H N N 347 VAL H2 H N N 348 VAL HA H N N 349 VAL HB H N N 350 VAL HG11 H N N 351 VAL HG12 H N N 352 VAL HG13 H N N 353 VAL HG21 H N N 354 VAL HG22 H N N 355 VAL HG23 H N N 356 VAL HXT H N N 357 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 LEU N CA sing N N 131 LEU N H sing N N 132 LEU N H2 sing N N 133 LEU CA C sing N N 134 LEU CA CB sing N N 135 LEU CA HA sing N N 136 LEU C O doub N N 137 LEU C OXT sing N N 138 LEU CB CG sing N N 139 LEU CB HB2 sing N N 140 LEU CB HB3 sing N N 141 LEU CG CD1 sing N N 142 LEU CG CD2 sing N N 143 LEU CG HG sing N N 144 LEU CD1 HD11 sing N N 145 LEU CD1 HD12 sing N N 146 LEU CD1 HD13 sing N N 147 LEU CD2 HD21 sing N N 148 LEU CD2 HD22 sing N N 149 LEU CD2 HD23 sing N N 150 LEU OXT HXT sing N N 151 LYS N CA sing N N 152 LYS N H sing N N 153 LYS N H2 sing N N 154 LYS CA C sing N N 155 LYS CA CB sing N N 156 LYS CA HA sing N N 157 LYS C O doub N N 158 LYS C OXT sing N N 159 LYS CB CG sing N N 160 LYS CB HB2 sing N N 161 LYS CB HB3 sing N N 162 LYS CG CD sing N N 163 LYS CG HG2 sing N N 164 LYS CG HG3 sing N N 165 LYS CD CE sing N N 166 LYS CD HD2 sing N N 167 LYS CD HD3 sing N N 168 LYS CE NZ sing N N 169 LYS CE HE2 sing N N 170 LYS CE HE3 sing N N 171 LYS NZ HZ1 sing N N 172 LYS NZ HZ2 sing N N 173 LYS NZ HZ3 sing N N 174 LYS OXT HXT sing N N 175 NAG C1 C2 sing N N 176 NAG C1 O1 sing N N 177 NAG C1 O5 sing N N 178 NAG C1 H1 sing N N 179 NAG C2 C3 sing N N 180 NAG C2 N2 sing N N 181 NAG C2 H2 sing N N 182 NAG C3 C4 sing N N 183 NAG C3 O3 sing N N 184 NAG C3 H3 sing N N 185 NAG C4 C5 sing N N 186 NAG C4 O4 sing N N 187 NAG C4 H4 sing N N 188 NAG C5 C6 sing N N 189 NAG C5 O5 sing N N 190 NAG C5 H5 sing N N 191 NAG C6 O6 sing N N 192 NAG C6 H61 sing N N 193 NAG C6 H62 sing N N 194 NAG C7 C8 sing N N 195 NAG C7 N2 sing N N 196 NAG C7 O7 doub N N 197 NAG C8 H81 sing N N 198 NAG C8 H82 sing N N 199 NAG C8 H83 sing N N 200 NAG N2 HN2 sing N N 201 NAG O1 HO1 sing N N 202 NAG O3 HO3 sing N N 203 NAG O4 HO4 sing N N 204 NAG O6 HO6 sing N N 205 PHE N CA sing N N 206 PHE N H sing N N 207 PHE N H2 sing N N 208 PHE CA C sing N N 209 PHE CA CB sing N N 210 PHE CA HA sing N N 211 PHE C O doub N N 212 PHE C OXT sing N N 213 PHE CB CG sing N N 214 PHE CB HB2 sing N N 215 PHE CB HB3 sing N N 216 PHE CG CD1 doub Y N 217 PHE CG CD2 sing Y N 218 PHE CD1 CE1 sing Y N 219 PHE CD1 HD1 sing N N 220 PHE CD2 CE2 doub Y N 221 PHE CD2 HD2 sing N N 222 PHE CE1 CZ doub Y N 223 PHE CE1 HE1 sing N N 224 PHE CE2 CZ sing Y N 225 PHE CE2 HE2 sing N N 226 PHE CZ HZ sing N N 227 PHE OXT HXT sing N N 228 PRO N CA sing N N 229 PRO N CD sing N N 230 PRO N H sing N N 231 PRO CA C sing N N 232 PRO CA CB sing N N 233 PRO CA HA sing N N 234 PRO C O doub N N 235 PRO C OXT sing N N 236 PRO CB CG sing N N 237 PRO CB HB2 sing N N 238 PRO CB HB3 sing N N 239 PRO CG CD sing N N 240 PRO CG HG2 sing N N 241 PRO CG HG3 sing N N 242 PRO CD HD2 sing N N 243 PRO CD HD3 sing N N 244 PRO OXT HXT sing N N 245 SER N CA sing N N 246 SER N H sing N N 247 SER N H2 sing N N 248 SER CA C sing N N 249 SER CA CB sing N N 250 SER CA HA sing N N 251 SER C O doub N N 252 SER C OXT sing N N 253 SER CB OG sing N N 254 SER CB HB2 sing N N 255 SER CB HB3 sing N N 256 SER OG HG sing N N 257 SER OXT HXT sing N N 258 THR N CA sing N N 259 THR N H sing N N 260 THR N H2 sing N N 261 THR CA C sing N N 262 THR CA CB sing N N 263 THR CA HA sing N N 264 THR C O doub N N 265 THR C OXT sing N N 266 THR CB OG1 sing N N 267 THR CB CG2 sing N N 268 THR CB HB sing N N 269 THR OG1 HG1 sing N N 270 THR CG2 HG21 sing N N 271 THR CG2 HG22 sing N N 272 THR CG2 HG23 sing N N 273 THR OXT HXT sing N N 274 TRP N CA sing N N 275 TRP N H sing N N 276 TRP N H2 sing N N 277 TRP CA C sing N N 278 TRP CA CB sing N N 279 TRP CA HA sing N N 280 TRP C O doub N N 281 TRP C OXT sing N N 282 TRP CB CG sing N N 283 TRP CB HB2 sing N N 284 TRP CB HB3 sing N N 285 TRP CG CD1 doub Y N 286 TRP CG CD2 sing Y N 287 TRP CD1 NE1 sing Y N 288 TRP CD1 HD1 sing N N 289 TRP CD2 CE2 doub Y N 290 TRP CD2 CE3 sing Y N 291 TRP NE1 CE2 sing Y N 292 TRP NE1 HE1 sing N N 293 TRP CE2 CZ2 sing Y N 294 TRP CE3 CZ3 doub Y N 295 TRP CE3 HE3 sing N N 296 TRP CZ2 CH2 doub Y N 297 TRP CZ2 HZ2 sing N N 298 TRP CZ3 CH2 sing Y N 299 TRP CZ3 HZ3 sing N N 300 TRP CH2 HH2 sing N N 301 TRP OXT HXT sing N N 302 TYR N CA sing N N 303 TYR N H sing N N 304 TYR N H2 sing N N 305 TYR CA C sing N N 306 TYR CA CB sing N N 307 TYR CA HA sing N N 308 TYR C O doub N N 309 TYR C OXT sing N N 310 TYR CB CG sing N N 311 TYR CB HB2 sing N N 312 TYR CB HB3 sing N N 313 TYR CG CD1 doub Y N 314 TYR CG CD2 sing Y N 315 TYR CD1 CE1 sing Y N 316 TYR CD1 HD1 sing N N 317 TYR CD2 CE2 doub Y N 318 TYR CD2 HD2 sing N N 319 TYR CE1 CZ doub Y N 320 TYR CE1 HE1 sing N N 321 TYR CE2 CZ sing Y N 322 TYR CE2 HE2 sing N N 323 TYR CZ OH sing N N 324 TYR OH HH sing N N 325 TYR OXT HXT sing N N 326 VAL N CA sing N N 327 VAL N H sing N N 328 VAL N H2 sing N N 329 VAL CA C sing N N 330 VAL CA CB sing N N 331 VAL CA HA sing N N 332 VAL C O doub N N 333 VAL C OXT sing N N 334 VAL CB CG1 sing N N 335 VAL CB CG2 sing N N 336 VAL CB HB sing N N 337 VAL CG1 HG11 sing N N 338 VAL CG1 HG12 sing N N 339 VAL CG1 HG13 sing N N 340 VAL CG2 HG21 sing N N 341 VAL CG2 HG22 sing N N 342 VAL CG2 HG23 sing N N 343 VAL OXT HXT sing N N 344 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3OQ9 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6AC0 _atom_sites.fract_transf_matrix[1][1] 0.034965 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.034965 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003778 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ # loop_ #