data_6AKV # _entry.id 6AKV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6AKV pdb_00006akv 10.2210/pdb6akv/pdb WWPDB D_1300008950 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6AKV _pdbx_database_status.recvd_initial_deposition_date 2018-09-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hong, S.' 1 ? 'Ha, N.-C.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country KO _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Cells' _citation.journal_id_ASTM MOCEEK _citation.journal_id_CSD 2166 _citation.journal_id_ISSN 0219-1032 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 42 _citation.language ? _citation.page_first 79 _citation.page_last 86 _citation.title 'Crystal Structure of LysB4, an Endolysin fromBacillus cereus-Targeting Bacteriophage B4.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.14348/molcells.2018.0379 _citation.pdbx_database_id_PubMed 30518175 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hong, S.' 1 ? primary 'Son, B.' 2 ? primary 'Ryu, S.' 3 ? primary 'Ha, N.C.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6AKV _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.457 _cell.length_a_esd ? _cell.length_b 79.457 _cell.length_b_esd ? _cell.length_c 77.925 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6AKV _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man LysB4 30083.279 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Endolysin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMAMALQTLIDKANRKLNVSGMRKDVADRTRAVITQMHAQGIYICVAQGFRSFAEQNALYA QGRTKPGSIVTNARGGQSNHNYGVAVDLCLYTQDGSDVIWTVEGNFRKVIAAMKAQGFKWGGDWVSFKDYPHFELYDVVG GQKPPADNGGAVDNGGGSGSTGGSGGGSTGGGSTGGGYDSSWFTKETGTFVTNTSIKLRTAPFTSADVIATLPAGSPVNY NGFGIEYDGYVWIRQPRSNGYGYLATGESKGGKRQNYWGTFK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMAMALQTLIDKANRKLNVSGMRKDVADRTRAVITQMHAQGIYICVAQGFRSFAEQNALYA QGRTKPGSIVTNARGGQSNHNYGVAVDLCLYTQDGSDVIWTVEGNFRKVIAAMKAQGFKWGGDWVSFKDYPHFELYDVVG GQKPPADNGGAVDNGGGSGSTGGSGGGSTGGGSTGGGYDSSWFTKETGTFVTNTSIKLRTAPFTSADVIATLPAGSPVNY NGFGIEYDGYVWIRQPRSNGYGYLATGESKGGKRQNYWGTFK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 MET n 1 24 ALA n 1 25 LEU n 1 26 GLN n 1 27 THR n 1 28 LEU n 1 29 ILE n 1 30 ASP n 1 31 LYS n 1 32 ALA n 1 33 ASN n 1 34 ARG n 1 35 LYS n 1 36 LEU n 1 37 ASN n 1 38 VAL n 1 39 SER n 1 40 GLY n 1 41 MET n 1 42 ARG n 1 43 LYS n 1 44 ASP n 1 45 VAL n 1 46 ALA n 1 47 ASP n 1 48 ARG n 1 49 THR n 1 50 ARG n 1 51 ALA n 1 52 VAL n 1 53 ILE n 1 54 THR n 1 55 GLN n 1 56 MET n 1 57 HIS n 1 58 ALA n 1 59 GLN n 1 60 GLY n 1 61 ILE n 1 62 TYR n 1 63 ILE n 1 64 CYS n 1 65 VAL n 1 66 ALA n 1 67 GLN n 1 68 GLY n 1 69 PHE n 1 70 ARG n 1 71 SER n 1 72 PHE n 1 73 ALA n 1 74 GLU n 1 75 GLN n 1 76 ASN n 1 77 ALA n 1 78 LEU n 1 79 TYR n 1 80 ALA n 1 81 GLN n 1 82 GLY n 1 83 ARG n 1 84 THR n 1 85 LYS n 1 86 PRO n 1 87 GLY n 1 88 SER n 1 89 ILE n 1 90 VAL n 1 91 THR n 1 92 ASN n 1 93 ALA n 1 94 ARG n 1 95 GLY n 1 96 GLY n 1 97 GLN n 1 98 SER n 1 99 ASN n 1 100 HIS n 1 101 ASN n 1 102 TYR n 1 103 GLY n 1 104 VAL n 1 105 ALA n 1 106 VAL n 1 107 ASP n 1 108 LEU n 1 109 CYS n 1 110 LEU n 1 111 TYR n 1 112 THR n 1 113 GLN n 1 114 ASP n 1 115 GLY n 1 116 SER n 1 117 ASP n 1 118 VAL n 1 119 ILE n 1 120 TRP n 1 121 THR n 1 122 VAL n 1 123 GLU n 1 124 GLY n 1 125 ASN n 1 126 PHE n 1 127 ARG n 1 128 LYS n 1 129 VAL n 1 130 ILE n 1 131 ALA n 1 132 ALA n 1 133 MET n 1 134 LYS n 1 135 ALA n 1 136 GLN n 1 137 GLY n 1 138 PHE n 1 139 LYS n 1 140 TRP n 1 141 GLY n 1 142 GLY n 1 143 ASP n 1 144 TRP n 1 145 VAL n 1 146 SER n 1 147 PHE n 1 148 LYS n 1 149 ASP n 1 150 TYR n 1 151 PRO n 1 152 HIS n 1 153 PHE n 1 154 GLU n 1 155 LEU n 1 156 TYR n 1 157 ASP n 1 158 VAL n 1 159 VAL n 1 160 GLY n 1 161 GLY n 1 162 GLN n 1 163 LYS n 1 164 PRO n 1 165 PRO n 1 166 ALA n 1 167 ASP n 1 168 ASN n 1 169 GLY n 1 170 GLY n 1 171 ALA n 1 172 VAL n 1 173 ASP n 1 174 ASN n 1 175 GLY n 1 176 GLY n 1 177 GLY n 1 178 SER n 1 179 GLY n 1 180 SER n 1 181 THR n 1 182 GLY n 1 183 GLY n 1 184 SER n 1 185 GLY n 1 186 GLY n 1 187 GLY n 1 188 SER n 1 189 THR n 1 190 GLY n 1 191 GLY n 1 192 GLY n 1 193 SER n 1 194 THR n 1 195 GLY n 1 196 GLY n 1 197 GLY n 1 198 TYR n 1 199 ASP n 1 200 SER n 1 201 SER n 1 202 TRP n 1 203 PHE n 1 204 THR n 1 205 LYS n 1 206 GLU n 1 207 THR n 1 208 GLY n 1 209 THR n 1 210 PHE n 1 211 VAL n 1 212 THR n 1 213 ASN n 1 214 THR n 1 215 SER n 1 216 ILE n 1 217 LYS n 1 218 LEU n 1 219 ARG n 1 220 THR n 1 221 ALA n 1 222 PRO n 1 223 PHE n 1 224 THR n 1 225 SER n 1 226 ALA n 1 227 ASP n 1 228 VAL n 1 229 ILE n 1 230 ALA n 1 231 THR n 1 232 LEU n 1 233 PRO n 1 234 ALA n 1 235 GLY n 1 236 SER n 1 237 PRO n 1 238 VAL n 1 239 ASN n 1 240 TYR n 1 241 ASN n 1 242 GLY n 1 243 PHE n 1 244 GLY n 1 245 ILE n 1 246 GLU n 1 247 TYR n 1 248 ASP n 1 249 GLY n 1 250 TYR n 1 251 VAL n 1 252 TRP n 1 253 ILE n 1 254 ARG n 1 255 GLN n 1 256 PRO n 1 257 ARG n 1 258 SER n 1 259 ASN n 1 260 GLY n 1 261 TYR n 1 262 GLY n 1 263 TYR n 1 264 LEU n 1 265 ALA n 1 266 THR n 1 267 GLY n 1 268 GLU n 1 269 SER n 1 270 LYS n 1 271 GLY n 1 272 GLY n 1 273 LYS n 1 274 ARG n 1 275 GLN n 1 276 ASN n 1 277 TYR n 1 278 TRP n 1 279 GLY n 1 280 THR n 1 281 PHE n 1 282 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 282 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'lysB4, BCB4_0006' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus phage B4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1141133 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H9NAL3_9CAUD _struct_ref.pdbx_db_accession H9NAL3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAMALQTLIDKANRKLNVSGMRKDVADRTRAVITQMHAQGIYICVAQGFRSFAEQNALYAQGRTKPGSIVTNARGGQSNH NYGVAVDLCLYTQDGSDVIWTVEGNFRKVIAAMKAQGFKWGGDWVSFKDYPHFELYDVVGGQKPPADNGGAVDNGGGSGS TGGSGGGSTGGGSTGGGYDSSWFTKETGTFVTNTSIKLRTAPFTSADVIATLPAGSPVNYNGFGIEYDGYVWIRQPRSNG YGYLATGESKGGKRQNYWGTFK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6AKV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 282 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H9NAL3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 262 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6AKV MET A 1 ? UNP H9NAL3 ? ? 'expression tag' -19 1 1 6AKV GLY A 2 ? UNP H9NAL3 ? ? 'expression tag' -18 2 1 6AKV SER A 3 ? UNP H9NAL3 ? ? 'expression tag' -17 3 1 6AKV SER A 4 ? UNP H9NAL3 ? ? 'expression tag' -16 4 1 6AKV HIS A 5 ? UNP H9NAL3 ? ? 'expression tag' -15 5 1 6AKV HIS A 6 ? UNP H9NAL3 ? ? 'expression tag' -14 6 1 6AKV HIS A 7 ? UNP H9NAL3 ? ? 'expression tag' -13 7 1 6AKV HIS A 8 ? UNP H9NAL3 ? ? 'expression tag' -12 8 1 6AKV HIS A 9 ? UNP H9NAL3 ? ? 'expression tag' -11 9 1 6AKV HIS A 10 ? UNP H9NAL3 ? ? 'expression tag' -10 10 1 6AKV SER A 11 ? UNP H9NAL3 ? ? 'expression tag' -9 11 1 6AKV SER A 12 ? UNP H9NAL3 ? ? 'expression tag' -8 12 1 6AKV GLY A 13 ? UNP H9NAL3 ? ? 'expression tag' -7 13 1 6AKV LEU A 14 ? UNP H9NAL3 ? ? 'expression tag' -6 14 1 6AKV VAL A 15 ? UNP H9NAL3 ? ? 'expression tag' -5 15 1 6AKV PRO A 16 ? UNP H9NAL3 ? ? 'expression tag' -4 16 1 6AKV ARG A 17 ? UNP H9NAL3 ? ? 'expression tag' -3 17 1 6AKV GLY A 18 ? UNP H9NAL3 ? ? 'expression tag' -2 18 1 6AKV SER A 19 ? UNP H9NAL3 ? ? 'expression tag' -1 19 1 6AKV HIS A 20 ? UNP H9NAL3 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AKV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;2.0 M ammonium sulfate, 0.1 M Bis-Tris pH 6.5, 2% polyethylene glycol monomethyl ether 550 (PEGMME 550), 8 mM Tris(2-carboxyethyl)phosphine (TCEP) ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-05-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6AKV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8863 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.9 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.66 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.063 _reflns.pdbx_Rpim_I_all 0.025 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.44 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.36 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 449 _reflns_shell.percent_possible_all 92.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.351 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.419 _reflns_shell.pdbx_Rpim_I_all 0.222 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.353 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6AKV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4 _refine.ls_d_res_low 28.092 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7926 _refine.ls_number_reflns_R_free 769 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 81.79 _refine.ls_percent_reflns_R_free 9.70 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1805 _refine.ls_R_factor_R_free 0.2243 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1756 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.51 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2VO9 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.20 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.29 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1160 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1190 _refine_hist.d_res_high 2.4 _refine_hist.d_res_low 28.092 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1188 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.785 ? 1606 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 10.211 ? 692 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 169 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 211 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4 2.5715 . . 108 890 52.00 . . . 0.2834 . 0.2172 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5715 2.8301 . . 162 1576 91.00 . . . 0.2859 . 0.2260 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8301 3.2391 . . 183 1728 99.00 . . . 0.2864 . 0.2013 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2391 4.0789 . . 120 1194 68.00 . . . 0.2007 . 0.1781 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0789 28.092 . . 196 1769 99.00 . . . 0.1802 . 0.1402 . . . . . . . . . . # _struct.entry_id 6AKV _struct.title 'Crystal structure of LysB4, the endolysin from Bacillus cereus-targeting bacteriophage B4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AKV _struct_keywords.text 'endolysin, LAS type enzyme, L-Alanoyl D-Glutamate endopeptidase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 24 ? ASN A 37 ? ALA A 4 ASN A 17 1 ? 14 HELX_P HELX_P2 AA2 ARG A 42 ? ALA A 58 ? ARG A 22 ALA A 38 1 ? 17 HELX_P HELX_P3 AA3 SER A 71 ? GLN A 81 ? SER A 51 GLN A 61 1 ? 11 HELX_P HELX_P4 AA4 SER A 98 ? GLY A 103 ? SER A 78 GLY A 83 5 ? 6 HELX_P HELX_P5 AA5 ASN A 125 ? GLN A 136 ? ASN A 105 GLN A 116 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 100 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 80 A ZN 301 1_555 ? ? ? ? ? ? ? 2.118 ? ? metalc2 metalc ? ? A ASP 107 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 87 A ZN 301 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc3 metalc ? ? A ASP 107 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 87 A ZN 301 1_555 ? ? ? ? ? ? ? 2.691 ? ? metalc4 metalc ? ? A HIS 152 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 132 A ZN 301 1_555 ? ? ? ? ? ? ? 1.952 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 301 A HOH 401 1_555 ? ? ? ? ? ? ? 1.963 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 63 ? GLN A 67 ? ILE A 43 GLN A 47 AA1 2 ALA A 105 ? TYR A 111 ? ALA A 85 TYR A 91 AA1 3 VAL A 118 ? ILE A 119 ? VAL A 98 ILE A 99 AA2 1 ILE A 63 ? GLN A 67 ? ILE A 43 GLN A 47 AA2 2 ALA A 105 ? TYR A 111 ? ALA A 85 TYR A 91 AA2 3 HIS A 152 ? GLU A 154 ? HIS A 132 GLU A 134 AA2 4 LYS A 139 ? TRP A 140 ? LYS A 119 TRP A 120 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 64 ? N CYS A 44 O CYS A 109 ? O CYS A 89 AA1 2 3 N LEU A 110 ? N LEU A 90 O ILE A 119 ? O ILE A 99 AA2 1 2 N CYS A 64 ? N CYS A 44 O CYS A 109 ? O CYS A 89 AA2 2 3 N VAL A 106 ? N VAL A 86 O PHE A 153 ? O PHE A 133 AA2 3 4 O GLU A 154 ? O GLU A 134 N LYS A 139 ? N LYS A 119 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 5 'binding site for residue ZN A 301' AC2 Software A SO4 302 ? 5 'binding site for residue SO4 A 302' AC3 Software A CL 303 ? 2 'binding site for residue CL A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 100 ? HIS A 80 . ? 1_555 ? 2 AC1 5 ASP A 107 ? ASP A 87 . ? 1_555 ? 3 AC1 5 ASP A 149 ? ASP A 129 . ? 1_555 ? 4 AC1 5 HIS A 152 ? HIS A 132 . ? 1_555 ? 5 AC1 5 HOH E . ? HOH A 401 . ? 1_555 ? 6 AC2 5 ARG A 70 ? ARG A 50 . ? 1_555 ? 7 AC2 5 GLN A 75 ? GLN A 55 . ? 1_555 ? 8 AC2 5 THR A 91 ? THR A 71 . ? 1_555 ? 9 AC2 5 SER A 98 ? SER A 78 . ? 1_555 ? 10 AC2 5 HOH E . ? HOH A 401 . ? 1_555 ? 11 AC3 2 ARG A 127 ? ARG A 107 . ? 1_555 ? 12 AC3 2 VAL A 145 ? VAL A 125 . ? 6_545 ? # _atom_sites.entry_id 6AKV _atom_sites.fract_transf_matrix[1][1] 0.012585 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012585 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012833 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 ALA 22 2 2 ALA ALA A . n A 1 23 MET 23 3 3 MET MET A . n A 1 24 ALA 24 4 4 ALA ALA A . n A 1 25 LEU 25 5 5 LEU LEU A . n A 1 26 GLN 26 6 6 GLN GLN A . n A 1 27 THR 27 7 7 THR THR A . n A 1 28 LEU 28 8 8 LEU LEU A . n A 1 29 ILE 29 9 9 ILE ILE A . n A 1 30 ASP 30 10 10 ASP ASP A . n A 1 31 LYS 31 11 11 LYS LYS A . n A 1 32 ALA 32 12 12 ALA ALA A . n A 1 33 ASN 33 13 13 ASN ASN A . n A 1 34 ARG 34 14 14 ARG ARG A . n A 1 35 LYS 35 15 15 LYS LYS A . n A 1 36 LEU 36 16 16 LEU LEU A . n A 1 37 ASN 37 17 17 ASN ASN A . n A 1 38 VAL 38 18 18 VAL VAL A . n A 1 39 SER 39 19 19 SER SER A . n A 1 40 GLY 40 20 20 GLY GLY A . n A 1 41 MET 41 21 21 MET MET A . n A 1 42 ARG 42 22 22 ARG ARG A . n A 1 43 LYS 43 23 23 LYS LYS A . n A 1 44 ASP 44 24 24 ASP ASP A . n A 1 45 VAL 45 25 25 VAL VAL A . n A 1 46 ALA 46 26 26 ALA ALA A . n A 1 47 ASP 47 27 27 ASP ASP A . n A 1 48 ARG 48 28 28 ARG ARG A . n A 1 49 THR 49 29 29 THR THR A . n A 1 50 ARG 50 30 30 ARG ARG A . n A 1 51 ALA 51 31 31 ALA ALA A . n A 1 52 VAL 52 32 32 VAL VAL A . n A 1 53 ILE 53 33 33 ILE ILE A . n A 1 54 THR 54 34 34 THR THR A . n A 1 55 GLN 55 35 35 GLN GLN A . n A 1 56 MET 56 36 36 MET MET A . n A 1 57 HIS 57 37 37 HIS HIS A . n A 1 58 ALA 58 38 38 ALA ALA A . n A 1 59 GLN 59 39 39 GLN GLN A . n A 1 60 GLY 60 40 40 GLY GLY A . n A 1 61 ILE 61 41 41 ILE ILE A . n A 1 62 TYR 62 42 42 TYR TYR A . n A 1 63 ILE 63 43 43 ILE ILE A . n A 1 64 CYS 64 44 44 CYS CYS A . n A 1 65 VAL 65 45 45 VAL VAL A . n A 1 66 ALA 66 46 46 ALA ALA A . n A 1 67 GLN 67 47 47 GLN GLN A . n A 1 68 GLY 68 48 48 GLY GLY A . n A 1 69 PHE 69 49 49 PHE PHE A . n A 1 70 ARG 70 50 50 ARG ARG A . n A 1 71 SER 71 51 51 SER SER A . n A 1 72 PHE 72 52 52 PHE PHE A . n A 1 73 ALA 73 53 53 ALA ALA A . n A 1 74 GLU 74 54 54 GLU GLU A . n A 1 75 GLN 75 55 55 GLN GLN A . n A 1 76 ASN 76 56 56 ASN ASN A . n A 1 77 ALA 77 57 57 ALA ALA A . n A 1 78 LEU 78 58 58 LEU LEU A . n A 1 79 TYR 79 59 59 TYR TYR A . n A 1 80 ALA 80 60 60 ALA ALA A . n A 1 81 GLN 81 61 61 GLN GLN A . n A 1 82 GLY 82 62 62 GLY GLY A . n A 1 83 ARG 83 63 63 ARG ARG A . n A 1 84 THR 84 64 64 THR THR A . n A 1 85 LYS 85 65 65 LYS LYS A . n A 1 86 PRO 86 66 66 PRO PRO A . n A 1 87 GLY 87 67 67 GLY GLY A . n A 1 88 SER 88 68 68 SER SER A . n A 1 89 ILE 89 69 69 ILE ILE A . n A 1 90 VAL 90 70 70 VAL VAL A . n A 1 91 THR 91 71 71 THR THR A . n A 1 92 ASN 92 72 72 ASN ASN A . n A 1 93 ALA 93 73 73 ALA ALA A . n A 1 94 ARG 94 74 74 ARG ARG A . n A 1 95 GLY 95 75 75 GLY GLY A . n A 1 96 GLY 96 76 76 GLY GLY A . n A 1 97 GLN 97 77 77 GLN GLN A . n A 1 98 SER 98 78 78 SER SER A . n A 1 99 ASN 99 79 79 ASN ASN A . n A 1 100 HIS 100 80 80 HIS HIS A . n A 1 101 ASN 101 81 81 ASN ASN A . n A 1 102 TYR 102 82 82 TYR TYR A . n A 1 103 GLY 103 83 83 GLY GLY A . n A 1 104 VAL 104 84 84 VAL VAL A . n A 1 105 ALA 105 85 85 ALA ALA A . n A 1 106 VAL 106 86 86 VAL VAL A . n A 1 107 ASP 107 87 87 ASP ASP A . n A 1 108 LEU 108 88 88 LEU LEU A . n A 1 109 CYS 109 89 89 CYS CYS A . n A 1 110 LEU 110 90 90 LEU LEU A . n A 1 111 TYR 111 91 91 TYR TYR A . n A 1 112 THR 112 92 92 THR THR A . n A 1 113 GLN 113 93 93 GLN GLN A . n A 1 114 ASP 114 94 94 ASP ASP A . n A 1 115 GLY 115 95 95 GLY GLY A . n A 1 116 SER 116 96 96 SER SER A . n A 1 117 ASP 117 97 97 ASP ASP A . n A 1 118 VAL 118 98 98 VAL VAL A . n A 1 119 ILE 119 99 99 ILE ILE A . n A 1 120 TRP 120 100 100 TRP TRP A . n A 1 121 THR 121 101 101 THR THR A . n A 1 122 VAL 122 102 102 VAL VAL A . n A 1 123 GLU 123 103 103 GLU GLU A . n A 1 124 GLY 124 104 104 GLY GLY A . n A 1 125 ASN 125 105 105 ASN ASN A . n A 1 126 PHE 126 106 106 PHE PHE A . n A 1 127 ARG 127 107 107 ARG ARG A . n A 1 128 LYS 128 108 108 LYS LYS A . n A 1 129 VAL 129 109 109 VAL VAL A . n A 1 130 ILE 130 110 110 ILE ILE A . n A 1 131 ALA 131 111 111 ALA ALA A . n A 1 132 ALA 132 112 112 ALA ALA A . n A 1 133 MET 133 113 113 MET MET A . n A 1 134 LYS 134 114 114 LYS LYS A . n A 1 135 ALA 135 115 115 ALA ALA A . n A 1 136 GLN 136 116 116 GLN GLN A . n A 1 137 GLY 137 117 117 GLY GLY A . n A 1 138 PHE 138 118 118 PHE PHE A . n A 1 139 LYS 139 119 119 LYS LYS A . n A 1 140 TRP 140 120 120 TRP TRP A . n A 1 141 GLY 141 121 121 GLY GLY A . n A 1 142 GLY 142 122 122 GLY GLY A . n A 1 143 ASP 143 123 123 ASP ASP A . n A 1 144 TRP 144 124 124 TRP TRP A . n A 1 145 VAL 145 125 125 VAL VAL A . n A 1 146 SER 146 126 126 SER SER A . n A 1 147 PHE 147 127 127 PHE PHE A . n A 1 148 LYS 148 128 128 LYS LYS A . n A 1 149 ASP 149 129 129 ASP ASP A . n A 1 150 TYR 150 130 130 TYR TYR A . n A 1 151 PRO 151 131 131 PRO PRO A . n A 1 152 HIS 152 132 132 HIS HIS A . n A 1 153 PHE 153 133 133 PHE PHE A . n A 1 154 GLU 154 134 134 GLU GLU A . n A 1 155 LEU 155 135 135 LEU LEU A . n A 1 156 TYR 156 136 136 TYR TYR A . n A 1 157 ASP 157 137 137 ASP ASP A . n A 1 158 VAL 158 138 138 VAL VAL A . n A 1 159 VAL 159 139 139 VAL VAL A . n A 1 160 GLY 160 140 140 GLY GLY A . n A 1 161 GLY 161 141 141 GLY GLY A . n A 1 162 GLN 162 142 142 GLN GLN A . n A 1 163 LYS 163 143 143 LYS LYS A . n A 1 164 PRO 164 144 144 PRO PRO A . n A 1 165 PRO 165 145 145 PRO PRO A . n A 1 166 ALA 166 146 146 ALA ALA A . n A 1 167 ASP 167 147 147 ASP ASP A . n A 1 168 ASN 168 148 148 ASN ASN A . n A 1 169 GLY 169 149 149 GLY GLY A . n A 1 170 GLY 170 150 150 GLY GLY A . n A 1 171 ALA 171 151 151 ALA ALA A . n A 1 172 VAL 172 152 152 VAL VAL A . n A 1 173 ASP 173 153 ? ? ? A . n A 1 174 ASN 174 154 ? ? ? A . n A 1 175 GLY 175 155 ? ? ? A . n A 1 176 GLY 176 156 ? ? ? A . n A 1 177 GLY 177 157 ? ? ? A . n A 1 178 SER 178 158 ? ? ? A . n A 1 179 GLY 179 159 ? ? ? A . n A 1 180 SER 180 160 ? ? ? A . n A 1 181 THR 181 161 ? ? ? A . n A 1 182 GLY 182 162 ? ? ? A . n A 1 183 GLY 183 163 ? ? ? A . n A 1 184 SER 184 164 ? ? ? A . n A 1 185 GLY 185 165 ? ? ? A . n A 1 186 GLY 186 166 ? ? ? A . n A 1 187 GLY 187 167 ? ? ? A . n A 1 188 SER 188 168 ? ? ? A . n A 1 189 THR 189 169 ? ? ? A . n A 1 190 GLY 190 170 ? ? ? A . n A 1 191 GLY 191 171 ? ? ? A . n A 1 192 GLY 192 172 ? ? ? A . n A 1 193 SER 193 173 ? ? ? A . n A 1 194 THR 194 174 ? ? ? A . n A 1 195 GLY 195 175 ? ? ? A . n A 1 196 GLY 196 176 ? ? ? A . n A 1 197 GLY 197 177 ? ? ? A . n A 1 198 TYR 198 178 ? ? ? A . n A 1 199 ASP 199 179 ? ? ? A . n A 1 200 SER 200 180 ? ? ? A . n A 1 201 SER 201 181 ? ? ? A . n A 1 202 TRP 202 182 ? ? ? A . n A 1 203 PHE 203 183 ? ? ? A . n A 1 204 THR 204 184 ? ? ? A . n A 1 205 LYS 205 185 ? ? ? A . n A 1 206 GLU 206 186 ? ? ? A . n A 1 207 THR 207 187 ? ? ? A . n A 1 208 GLY 208 188 ? ? ? A . n A 1 209 THR 209 189 ? ? ? A . n A 1 210 PHE 210 190 ? ? ? A . n A 1 211 VAL 211 191 ? ? ? A . n A 1 212 THR 212 192 ? ? ? A . n A 1 213 ASN 213 193 ? ? ? A . n A 1 214 THR 214 194 ? ? ? A . n A 1 215 SER 215 195 ? ? ? A . n A 1 216 ILE 216 196 ? ? ? A . n A 1 217 LYS 217 197 ? ? ? A . n A 1 218 LEU 218 198 ? ? ? A . n A 1 219 ARG 219 199 ? ? ? A . n A 1 220 THR 220 200 ? ? ? A . n A 1 221 ALA 221 201 ? ? ? A . n A 1 222 PRO 222 202 ? ? ? A . n A 1 223 PHE 223 203 ? ? ? A . n A 1 224 THR 224 204 ? ? ? A . n A 1 225 SER 225 205 ? ? ? A . n A 1 226 ALA 226 206 ? ? ? A . n A 1 227 ASP 227 207 ? ? ? A . n A 1 228 VAL 228 208 ? ? ? A . n A 1 229 ILE 229 209 ? ? ? A . n A 1 230 ALA 230 210 ? ? ? A . n A 1 231 THR 231 211 ? ? ? A . n A 1 232 LEU 232 212 ? ? ? A . n A 1 233 PRO 233 213 ? ? ? A . n A 1 234 ALA 234 214 ? ? ? A . n A 1 235 GLY 235 215 ? ? ? A . n A 1 236 SER 236 216 ? ? ? A . n A 1 237 PRO 237 217 ? ? ? A . n A 1 238 VAL 238 218 ? ? ? A . n A 1 239 ASN 239 219 ? ? ? A . n A 1 240 TYR 240 220 ? ? ? A . n A 1 241 ASN 241 221 ? ? ? A . n A 1 242 GLY 242 222 ? ? ? A . n A 1 243 PHE 243 223 ? ? ? A . n A 1 244 GLY 244 224 ? ? ? A . n A 1 245 ILE 245 225 ? ? ? A . n A 1 246 GLU 246 226 ? ? ? A . n A 1 247 TYR 247 227 ? ? ? A . n A 1 248 ASP 248 228 ? ? ? A . n A 1 249 GLY 249 229 ? ? ? A . n A 1 250 TYR 250 230 ? ? ? A . n A 1 251 VAL 251 231 ? ? ? A . n A 1 252 TRP 252 232 ? ? ? A . n A 1 253 ILE 253 233 ? ? ? A . n A 1 254 ARG 254 234 ? ? ? A . n A 1 255 GLN 255 235 ? ? ? A . n A 1 256 PRO 256 236 ? ? ? A . n A 1 257 ARG 257 237 ? ? ? A . n A 1 258 SER 258 238 ? ? ? A . n A 1 259 ASN 259 239 ? ? ? A . n A 1 260 GLY 260 240 ? ? ? A . n A 1 261 TYR 261 241 ? ? ? A . n A 1 262 GLY 262 242 ? ? ? A . n A 1 263 TYR 263 243 ? ? ? A . n A 1 264 LEU 264 244 ? ? ? A . n A 1 265 ALA 265 245 ? ? ? A . n A 1 266 THR 266 246 ? ? ? A . n A 1 267 GLY 267 247 ? ? ? A . n A 1 268 GLU 268 248 ? ? ? A . n A 1 269 SER 269 249 ? ? ? A . n A 1 270 LYS 270 250 ? ? ? A . n A 1 271 GLY 271 251 ? ? ? A . n A 1 272 GLY 272 252 ? ? ? A . n A 1 273 LYS 273 253 ? ? ? A . n A 1 274 ARG 274 254 ? ? ? A . n A 1 275 GLN 275 255 ? ? ? A . n A 1 276 ASN 276 256 ? ? ? A . n A 1 277 TYR 277 257 ? ? ? A . n A 1 278 TRP 278 258 ? ? ? A . n A 1 279 GLY 279 259 ? ? ? A . n A 1 280 THR 280 260 ? ? ? A . n A 1 281 PHE 281 261 ? ? ? A . n A 1 282 LYS 282 262 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 153 ZN ZN A . C 3 SO4 1 302 154 SO4 SO4 A . D 4 CL 1 303 155 CL CL A . E 5 HOH 1 401 158 HOH HOH A . E 5 HOH 2 402 166 HOH HOH A . E 5 HOH 3 403 161 HOH HOH A . E 5 HOH 4 404 176 HOH HOH A . E 5 HOH 5 405 156 HOH HOH A . E 5 HOH 6 406 159 HOH HOH A . E 5 HOH 7 407 164 HOH HOH A . E 5 HOH 8 408 168 HOH HOH A . E 5 HOH 9 409 173 HOH HOH A . E 5 HOH 10 410 157 HOH HOH A . E 5 HOH 11 411 163 HOH HOH A . E 5 HOH 12 412 160 HOH HOH A . E 5 HOH 13 413 167 HOH HOH A . E 5 HOH 14 414 174 HOH HOH A . E 5 HOH 15 415 175 HOH HOH A . E 5 HOH 16 416 169 HOH HOH A . E 5 HOH 17 417 177 HOH HOH A . E 5 HOH 18 418 162 HOH HOH A . E 5 HOH 19 419 170 HOH HOH A . E 5 HOH 20 420 165 HOH HOH A . E 5 HOH 21 421 172 HOH HOH A . E 5 HOH 22 422 178 HOH HOH A . E 5 HOH 23 423 171 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 400 ? 1 MORE -61 ? 1 'SSA (A^2)' 7880 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 100 ? A HIS 80 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD1 ? A ASP 107 ? A ASP 87 ? 1_555 110.4 ? 2 NE2 ? A HIS 100 ? A HIS 80 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 107 ? A ASP 87 ? 1_555 85.0 ? 3 OD1 ? A ASP 107 ? A ASP 87 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 107 ? A ASP 87 ? 1_555 51.5 ? 4 NE2 ? A HIS 100 ? A HIS 80 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 152 ? A HIS 132 ? 1_555 109.6 ? 5 OD1 ? A ASP 107 ? A ASP 87 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 152 ? A HIS 132 ? 1_555 101.9 ? 6 OD2 ? A ASP 107 ? A ASP 87 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 152 ? A HIS 132 ? 1_555 153.3 ? 7 NE2 ? A HIS 100 ? A HIS 80 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 102.4 ? 8 OD1 ? A ASP 107 ? A ASP 87 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 117.6 ? 9 OD2 ? A ASP 107 ? A ASP 87 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 81.7 ? 10 ND1 ? A HIS 152 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 115.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-13 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 63 ? ? -124.00 -61.49 2 1 PHE A 127 ? ? -83.45 -75.79 3 1 LYS A 128 ? ? 64.58 92.16 4 1 ALA A 151 ? ? -90.39 -152.95 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 A ASP 153 ? A ASP 173 23 1 Y 1 A ASN 154 ? A ASN 174 24 1 Y 1 A GLY 155 ? A GLY 175 25 1 Y 1 A GLY 156 ? A GLY 176 26 1 Y 1 A GLY 157 ? A GLY 177 27 1 Y 1 A SER 158 ? A SER 178 28 1 Y 1 A GLY 159 ? A GLY 179 29 1 Y 1 A SER 160 ? A SER 180 30 1 Y 1 A THR 161 ? A THR 181 31 1 Y 1 A GLY 162 ? A GLY 182 32 1 Y 1 A GLY 163 ? A GLY 183 33 1 Y 1 A SER 164 ? A SER 184 34 1 Y 1 A GLY 165 ? A GLY 185 35 1 Y 1 A GLY 166 ? A GLY 186 36 1 Y 1 A GLY 167 ? A GLY 187 37 1 Y 1 A SER 168 ? A SER 188 38 1 Y 1 A THR 169 ? A THR 189 39 1 Y 1 A GLY 170 ? A GLY 190 40 1 Y 1 A GLY 171 ? A GLY 191 41 1 Y 1 A GLY 172 ? A GLY 192 42 1 Y 1 A SER 173 ? A SER 193 43 1 Y 1 A THR 174 ? A THR 194 44 1 Y 1 A GLY 175 ? A GLY 195 45 1 Y 1 A GLY 176 ? A GLY 196 46 1 Y 1 A GLY 177 ? A GLY 197 47 1 Y 1 A TYR 178 ? A TYR 198 48 1 Y 1 A ASP 179 ? A ASP 199 49 1 Y 1 A SER 180 ? A SER 200 50 1 Y 1 A SER 181 ? A SER 201 51 1 Y 1 A TRP 182 ? A TRP 202 52 1 Y 1 A PHE 183 ? A PHE 203 53 1 Y 1 A THR 184 ? A THR 204 54 1 Y 1 A LYS 185 ? A LYS 205 55 1 Y 1 A GLU 186 ? A GLU 206 56 1 Y 1 A THR 187 ? A THR 207 57 1 Y 1 A GLY 188 ? A GLY 208 58 1 Y 1 A THR 189 ? A THR 209 59 1 Y 1 A PHE 190 ? A PHE 210 60 1 Y 1 A VAL 191 ? A VAL 211 61 1 Y 1 A THR 192 ? A THR 212 62 1 Y 1 A ASN 193 ? A ASN 213 63 1 Y 1 A THR 194 ? A THR 214 64 1 Y 1 A SER 195 ? A SER 215 65 1 Y 1 A ILE 196 ? A ILE 216 66 1 Y 1 A LYS 197 ? A LYS 217 67 1 Y 1 A LEU 198 ? A LEU 218 68 1 Y 1 A ARG 199 ? A ARG 219 69 1 Y 1 A THR 200 ? A THR 220 70 1 Y 1 A ALA 201 ? A ALA 221 71 1 Y 1 A PRO 202 ? A PRO 222 72 1 Y 1 A PHE 203 ? A PHE 223 73 1 Y 1 A THR 204 ? A THR 224 74 1 Y 1 A SER 205 ? A SER 225 75 1 Y 1 A ALA 206 ? A ALA 226 76 1 Y 1 A ASP 207 ? A ASP 227 77 1 Y 1 A VAL 208 ? A VAL 228 78 1 Y 1 A ILE 209 ? A ILE 229 79 1 Y 1 A ALA 210 ? A ALA 230 80 1 Y 1 A THR 211 ? A THR 231 81 1 Y 1 A LEU 212 ? A LEU 232 82 1 Y 1 A PRO 213 ? A PRO 233 83 1 Y 1 A ALA 214 ? A ALA 234 84 1 Y 1 A GLY 215 ? A GLY 235 85 1 Y 1 A SER 216 ? A SER 236 86 1 Y 1 A PRO 217 ? A PRO 237 87 1 Y 1 A VAL 218 ? A VAL 238 88 1 Y 1 A ASN 219 ? A ASN 239 89 1 Y 1 A TYR 220 ? A TYR 240 90 1 Y 1 A ASN 221 ? A ASN 241 91 1 Y 1 A GLY 222 ? A GLY 242 92 1 Y 1 A PHE 223 ? A PHE 243 93 1 Y 1 A GLY 224 ? A GLY 244 94 1 Y 1 A ILE 225 ? A ILE 245 95 1 Y 1 A GLU 226 ? A GLU 246 96 1 Y 1 A TYR 227 ? A TYR 247 97 1 Y 1 A ASP 228 ? A ASP 248 98 1 Y 1 A GLY 229 ? A GLY 249 99 1 Y 1 A TYR 230 ? A TYR 250 100 1 Y 1 A VAL 231 ? A VAL 251 101 1 Y 1 A TRP 232 ? A TRP 252 102 1 Y 1 A ILE 233 ? A ILE 253 103 1 Y 1 A ARG 234 ? A ARG 254 104 1 Y 1 A GLN 235 ? A GLN 255 105 1 Y 1 A PRO 236 ? A PRO 256 106 1 Y 1 A ARG 237 ? A ARG 257 107 1 Y 1 A SER 238 ? A SER 258 108 1 Y 1 A ASN 239 ? A ASN 259 109 1 Y 1 A GLY 240 ? A GLY 260 110 1 Y 1 A TYR 241 ? A TYR 261 111 1 Y 1 A GLY 242 ? A GLY 262 112 1 Y 1 A TYR 243 ? A TYR 263 113 1 Y 1 A LEU 244 ? A LEU 264 114 1 Y 1 A ALA 245 ? A ALA 265 115 1 Y 1 A THR 246 ? A THR 266 116 1 Y 1 A GLY 247 ? A GLY 267 117 1 Y 1 A GLU 248 ? A GLU 268 118 1 Y 1 A SER 249 ? A SER 269 119 1 Y 1 A LYS 250 ? A LYS 270 120 1 Y 1 A GLY 251 ? A GLY 271 121 1 Y 1 A GLY 252 ? A GLY 272 122 1 Y 1 A LYS 253 ? A LYS 273 123 1 Y 1 A ARG 254 ? A ARG 274 124 1 Y 1 A GLN 255 ? A GLN 275 125 1 Y 1 A ASN 256 ? A ASN 276 126 1 Y 1 A TYR 257 ? A TYR 277 127 1 Y 1 A TRP 258 ? A TRP 278 128 1 Y 1 A GLY 259 ? A GLY 279 129 1 Y 1 A THR 260 ? A THR 280 130 1 Y 1 A PHE 261 ? A PHE 281 131 1 Y 1 A LYS 262 ? A LYS 282 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TRP N N N N 327 TRP CA C N S 328 TRP C C N N 329 TRP O O N N 330 TRP CB C N N 331 TRP CG C Y N 332 TRP CD1 C Y N 333 TRP CD2 C Y N 334 TRP NE1 N Y N 335 TRP CE2 C Y N 336 TRP CE3 C Y N 337 TRP CZ2 C Y N 338 TRP CZ3 C Y N 339 TRP CH2 C Y N 340 TRP OXT O N N 341 TRP H H N N 342 TRP H2 H N N 343 TRP HA H N N 344 TRP HB2 H N N 345 TRP HB3 H N N 346 TRP HD1 H N N 347 TRP HE1 H N N 348 TRP HE3 H N N 349 TRP HZ2 H N N 350 TRP HZ3 H N N 351 TRP HH2 H N N 352 TRP HXT H N N 353 TYR N N N N 354 TYR CA C N S 355 TYR C C N N 356 TYR O O N N 357 TYR CB C N N 358 TYR CG C Y N 359 TYR CD1 C Y N 360 TYR CD2 C Y N 361 TYR CE1 C Y N 362 TYR CE2 C Y N 363 TYR CZ C Y N 364 TYR OH O N N 365 TYR OXT O N N 366 TYR H H N N 367 TYR H2 H N N 368 TYR HA H N N 369 TYR HB2 H N N 370 TYR HB3 H N N 371 TYR HD1 H N N 372 TYR HD2 H N N 373 TYR HE1 H N N 374 TYR HE2 H N N 375 TYR HH H N N 376 TYR HXT H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 ZN ZN ZN N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'SULFATE ION' SO4 4 'CHLORIDE ION' CL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2VO9 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #