data_6AMR # _entry.id 6AMR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6AMR pdb_00006amr 10.2210/pdb6amr/pdb WWPDB D_1000229477 ? ? BMRB 19452 ? 10.13018/BMR19452 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-20 2 'Structure model' 1 1 2018-01-10 3 'Structure model' 1 2 2019-02-13 4 'Structure model' 1 3 2019-12-11 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' Other 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' pdbx_audit_support 5 4 'Structure model' pdbx_nmr_software 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond 10 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_citation.journal_abbrev' 12 3 'Structure model' '_citation.pdbx_database_id_DOI' 13 3 'Structure model' '_citation.pdbx_database_id_PubMed' 14 3 'Structure model' '_citation.title' 15 3 'Structure model' '_citation_author.identifier_ORCID' 16 4 'Structure model' '_pdbx_audit_support.funding_organization' 17 4 'Structure model' '_pdbx_nmr_software.name' 18 5 'Structure model' '_database_2.pdbx_DOI' 19 5 'Structure model' '_database_2.pdbx_database_accession' 20 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 21 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2017-09-20 _pdbx_database_PDB_obs_spr.pdb_id 6AMR _pdbx_database_PDB_obs_spr.replace_pdb_id 2MCS _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6AMR _pdbx_database_status.recvd_initial_deposition_date 2017-08-11 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 19452 unspecified TargetTrack . SSGCID-EhchA.00546.a unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Buchko, G.W.' 1 ? 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr F Struct Biol Commun' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 74 _citation.language ? _citation.page_first 46 _citation.page_last 56 _citation.title ;Solution NMR structures of oxidized and reduced Ehrlichia chaffeensis thioredoxin: NMR-invisible structure owing to backbone dynamics. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X1701799X _citation.pdbx_database_id_PubMed 29372907 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 0000-0002-3639-1061 primary 'Hewitt, S.N.' 2 ? primary 'Van Voorhis, W.C.' 3 ? primary 'Myler, P.J.' 4 0000-0002-0056-0513 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Thioredoxin _entity.formula_weight 14362.208 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKIN IEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNNIN ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKIN IEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNNIN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SSGCID-EhchA.00546.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 GLN n 1 16 THR n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 GLY n 1 21 SER n 1 22 MET n 1 23 ILE n 1 24 GLU n 1 25 GLN n 1 26 ILE n 1 27 GLY n 1 28 ASP n 1 29 SER n 1 30 GLU n 1 31 PHE n 1 32 ASP n 1 33 ASN n 1 34 LYS n 1 35 VAL n 1 36 THR n 1 37 SER n 1 38 CYS n 1 39 ASN n 1 40 ASP n 1 41 ASN n 1 42 ILE n 1 43 LEU n 1 44 ILE n 1 45 LEU n 1 46 VAL n 1 47 ASP n 1 48 PHE n 1 49 TRP n 1 50 ALA n 1 51 PRO n 1 52 TRP n 1 53 CYS n 1 54 GLY n 1 55 PRO n 1 56 CYS n 1 57 ARG n 1 58 SER n 1 59 LEU n 1 60 GLU n 1 61 PRO n 1 62 GLN n 1 63 LEU n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 ALA n 1 68 GLN n 1 69 GLN n 1 70 TYR n 1 71 THR n 1 72 GLU n 1 73 ASN n 1 74 VAL n 1 75 LYS n 1 76 ILE n 1 77 TYR n 1 78 LYS n 1 79 ILE n 1 80 ASN n 1 81 ILE n 1 82 GLU n 1 83 ASP n 1 84 ASN n 1 85 GLN n 1 86 ASP n 1 87 VAL n 1 88 ALA n 1 89 THR n 1 90 GLN n 1 91 TYR n 1 92 GLY n 1 93 VAL n 1 94 SER n 1 95 ALA n 1 96 ILE n 1 97 PRO n 1 98 THR n 1 99 ILE n 1 100 LEU n 1 101 MET n 1 102 PHE n 1 103 LYS n 1 104 ASN n 1 105 GLY n 1 106 LYS n 1 107 LYS n 1 108 LEU n 1 109 SER n 1 110 GLN n 1 111 VAL n 1 112 ILE n 1 113 GLY n 1 114 ALA n 1 115 ASP n 1 116 ILE n 1 117 SER n 1 118 LYS n 1 119 ILE n 1 120 ILE n 1 121 SER n 1 122 GLU n 1 123 ILE n 1 124 ASN n 1 125 ASN n 1 126 ASN n 1 127 ILE n 1 128 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'trx, ECH_0218' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC CRL-10679 / Arkansas' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 205920 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-R3-PRARE2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name AVA0421 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 ASN 128 128 128 ASN ASN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AMR _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6AMR _struct.title ;Solution NMR structure of a putative thioredoxin (ECH_0218) in the reduced state from Ehrlichia chaffeensis, the etiological agent responsible for human monocytic ehrlichiosis. Seattle Structural Genomics Center for Infectious Disease target EhchA.00546.a ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AMR _struct_keywords.text ;INFECTIOUS DISEASES, SSGCID, TICK DISEASES, OXIDOREDUCTASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease ; _struct_keywords.pdbx_keywords OXIDOREDUCTASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2GHP2_EHRCR _struct_ref.pdbx_db_accession Q2GHP2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTILM FKNGKKLSQVIGADISKIISEINNNIN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6AMR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2GHP2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6AMR MET A 1 ? UNP Q2GHP2 ? ? 'initiating methionine' 1 1 1 6AMR ALA A 2 ? UNP Q2GHP2 ? ? 'expression tag' 2 2 1 6AMR HIS A 3 ? UNP Q2GHP2 ? ? 'expression tag' 3 3 1 6AMR HIS A 4 ? UNP Q2GHP2 ? ? 'expression tag' 4 4 1 6AMR HIS A 5 ? UNP Q2GHP2 ? ? 'expression tag' 5 5 1 6AMR HIS A 6 ? UNP Q2GHP2 ? ? 'expression tag' 6 6 1 6AMR HIS A 7 ? UNP Q2GHP2 ? ? 'expression tag' 7 7 1 6AMR HIS A 8 ? UNP Q2GHP2 ? ? 'expression tag' 8 8 1 6AMR MET A 9 ? UNP Q2GHP2 ? ? 'expression tag' 9 9 1 6AMR GLY A 10 ? UNP Q2GHP2 ? ? 'expression tag' 10 10 1 6AMR THR A 11 ? UNP Q2GHP2 ? ? 'expression tag' 11 11 1 6AMR LEU A 12 ? UNP Q2GHP2 ? ? 'expression tag' 12 12 1 6AMR GLU A 13 ? UNP Q2GHP2 ? ? 'expression tag' 13 13 1 6AMR ALA A 14 ? UNP Q2GHP2 ? ? 'expression tag' 14 14 1 6AMR GLN A 15 ? UNP Q2GHP2 ? ? 'expression tag' 15 15 1 6AMR THR A 16 ? UNP Q2GHP2 ? ? 'expression tag' 16 16 1 6AMR GLN A 17 ? UNP Q2GHP2 ? ? 'expression tag' 17 17 1 6AMR GLY A 18 ? UNP Q2GHP2 ? ? 'expression tag' 18 18 1 6AMR PRO A 19 ? UNP Q2GHP2 ? ? 'expression tag' 19 19 1 6AMR GLY A 20 ? UNP Q2GHP2 ? ? 'expression tag' 20 20 1 6AMR SER A 21 ? UNP Q2GHP2 ? ? 'expression tag' 21 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8090 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein was a monomer via SEC.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 27 ? THR A 36 ? GLY A 27 THR A 36 1 ? 10 HELX_P HELX_P2 AA2 PRO A 61 ? THR A 71 ? PRO A 61 THR A 71 1 ? 11 HELX_P HELX_P3 AA3 ASP A 86 ? GLY A 92 ? ASP A 86 GLY A 92 1 ? 7 HELX_P HELX_P4 AA4 ASP A 115 ? ILE A 127 ? ASP A 115 ILE A 127 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 1 -2.19 2 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 2 2.36 3 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 3 0.43 4 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 4 1.18 5 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 5 -1.36 6 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 6 -4.31 7 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 7 -0.36 8 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 8 -1.60 9 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 9 -1.63 10 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 10 -3.57 11 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 11 2.12 12 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 12 0.89 13 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 13 2.32 14 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 14 -1.71 15 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 15 -3.23 16 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 16 3.94 17 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 17 -0.90 18 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 18 1.11 19 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 19 -0.71 20 ILE 96 A . ? ILE 96 A PRO 97 A ? PRO 97 A 20 -0.38 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 23 ? ILE A 26 ? ILE A 23 ILE A 26 AA1 2 VAL A 74 ? ILE A 79 ? VAL A 74 ILE A 79 AA1 3 LEU A 43 ? ASP A 47 ? LEU A 43 ASP A 47 AA1 4 THR A 98 ? LYS A 103 ? THR A 98 LYS A 103 AA1 5 LYS A 106 ? ILE A 112 ? LYS A 106 ILE A 112 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 24 ? N GLU A 24 O ILE A 76 ? O ILE A 76 AA1 2 3 O LYS A 75 ? O LYS A 75 N LEU A 45 ? N LEU A 45 AA1 3 4 N ILE A 44 ? N ILE A 44 O PHE A 102 ? O PHE A 102 AA1 4 5 N MET A 101 ? N MET A 101 O SER A 109 ? O SER A 109 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -67.55 84.63 2 1 HIS A 4 ? ? -165.76 96.60 3 1 ALA A 14 ? ? -153.75 47.62 4 1 GLN A 15 ? ? -65.00 86.16 5 1 SER A 21 ? ? -87.00 -73.87 6 1 MET A 22 ? ? -173.37 -30.90 7 1 PHE A 31 ? ? -51.77 -70.58 8 1 ASN A 41 ? ? 59.22 13.42 9 1 PHE A 48 ? ? -77.81 -80.49 10 1 ARG A 57 ? ? -152.90 -60.40 11 1 SER A 58 ? ? -172.68 75.11 12 1 GLU A 60 ? ? -156.38 66.21 13 1 PRO A 97 ? ? -98.60 -155.09 14 2 ALA A 2 ? ? -168.39 97.11 15 2 HIS A 6 ? ? -75.00 -78.29 16 2 HIS A 7 ? ? 178.22 -172.76 17 2 HIS A 8 ? ? -124.51 -72.63 18 2 MET A 9 ? ? 176.16 143.36 19 2 GLU A 13 ? ? -86.47 49.33 20 2 ALA A 14 ? ? -173.55 139.37 21 2 GLN A 15 ? ? -160.36 115.07 22 2 PHE A 31 ? ? -47.84 -71.19 23 2 CYS A 38 ? ? -53.63 91.92 24 2 TRP A 49 ? ? -163.72 52.84 25 2 ALA A 50 ? ? 69.20 120.77 26 2 PRO A 51 ? ? -68.14 69.37 27 2 TRP A 52 ? ? 62.29 103.23 28 2 PRO A 55 ? ? -68.03 75.08 29 2 CYS A 56 ? ? 52.45 18.98 30 2 GLU A 60 ? ? -165.86 53.07 31 2 GLU A 82 ? ? -82.79 -72.47 32 3 HIS A 6 ? ? -173.16 137.17 33 3 HIS A 7 ? ? -164.35 118.10 34 3 THR A 11 ? ? -151.61 65.84 35 3 GLN A 17 ? ? -160.90 103.29 36 3 SER A 21 ? ? 62.00 154.47 37 3 MET A 22 ? ? -143.02 -50.64 38 3 PHE A 31 ? ? -48.77 -70.86 39 3 CYS A 38 ? ? -53.71 103.24 40 3 TRP A 49 ? ? 71.59 87.64 41 3 PRO A 55 ? ? -78.38 38.29 42 3 ARG A 57 ? ? -83.38 40.80 43 3 ALA A 114 ? ? -157.51 57.16 44 4 GLU A 13 ? ? -162.22 -62.98 45 4 PRO A 19 ? ? -68.05 -179.31 46 4 PHE A 31 ? ? -46.75 -71.11 47 4 CYS A 38 ? ? -57.96 91.11 48 4 TRP A 49 ? ? 166.49 -26.21 49 4 ALA A 50 ? ? 68.24 90.23 50 4 TRP A 52 ? ? -159.85 -54.75 51 4 PRO A 55 ? ? -77.32 24.81 52 4 CYS A 56 ? ? -66.87 94.95 53 4 GLU A 60 ? ? 41.39 98.49 54 4 GLU A 82 ? ? -60.00 -72.38 55 5 ALA A 2 ? ? -161.35 85.22 56 5 HIS A 4 ? ? -67.19 77.13 57 5 HIS A 5 ? ? 53.86 0.04 58 5 PHE A 31 ? ? -49.25 -70.79 59 5 PHE A 48 ? ? -65.46 -170.19 60 5 TRP A 49 ? ? -64.68 -166.24 61 5 ALA A 50 ? ? 60.94 97.38 62 5 PRO A 55 ? ? -52.17 100.09 63 5 SER A 58 ? ? -103.57 -168.80 64 5 GLU A 60 ? ? 65.93 157.45 65 5 ASN A 84 ? ? 2.33 102.73 66 5 VAL A 93 ? ? -69.51 85.32 67 5 ALA A 114 ? ? -96.59 56.99 68 6 MET A 9 ? ? -130.65 -73.61 69 6 THR A 11 ? ? 50.37 75.70 70 6 GLN A 17 ? ? -71.58 -164.26 71 6 PHE A 31 ? ? -47.15 -71.61 72 6 TRP A 52 ? ? -148.44 -57.46 73 6 CYS A 53 ? ? 68.95 -68.95 74 6 CYS A 56 ? ? -62.74 94.67 75 6 SER A 58 ? ? 61.14 90.70 76 6 LEU A 59 ? ? -84.45 34.50 77 6 ILE A 79 ? ? 67.43 66.86 78 6 SER A 94 ? ? -143.79 21.03 79 7 ALA A 2 ? ? 63.79 -97.60 80 7 ALA A 14 ? ? 63.20 95.71 81 7 THR A 16 ? ? -48.88 -79.91 82 7 SER A 21 ? ? -141.81 -157.58 83 7 PHE A 31 ? ? -53.04 -70.55 84 7 CYS A 56 ? ? -163.92 -167.21 85 7 ARG A 57 ? ? 71.66 -2.65 86 7 LEU A 59 ? ? 63.86 -81.81 87 7 ASP A 86 ? ? -64.63 0.55 88 7 LYS A 103 ? ? -169.27 115.37 89 8 PHE A 31 ? ? -47.80 -71.00 90 8 TRP A 49 ? ? 65.87 64.02 91 8 PRO A 51 ? ? -44.96 -80.87 92 8 LEU A 59 ? ? -69.74 76.45 93 8 GLU A 60 ? ? 62.97 110.36 94 8 ILE A 81 ? ? -68.12 85.04 95 8 GLU A 82 ? ? -82.75 -72.58 96 8 SER A 94 ? ? 67.43 -67.43 97 8 ALA A 114 ? ? -142.65 57.36 98 9 ALA A 2 ? ? -58.73 89.51 99 9 HIS A 7 ? ? -157.84 83.13 100 9 ALA A 14 ? ? -152.42 53.54 101 9 GLN A 15 ? ? -62.83 92.01 102 9 ILE A 23 ? ? -115.66 78.33 103 9 PHE A 31 ? ? -47.08 -71.15 104 9 CYS A 38 ? ? -59.24 90.90 105 9 ALA A 50 ? ? 64.68 170.56 106 9 CYS A 53 ? ? -67.76 86.81 107 9 PRO A 55 ? ? -59.78 97.07 108 9 ARG A 57 ? ? 72.94 -33.35 109 9 GLU A 60 ? ? -151.63 73.42 110 10 HIS A 3 ? ? -91.73 31.75 111 10 HIS A 6 ? ? -148.02 -156.44 112 10 MET A 9 ? ? -175.31 99.31 113 10 GLU A 13 ? ? -172.32 -54.09 114 10 GLN A 15 ? ? -141.50 22.13 115 10 PHE A 31 ? ? -46.34 -71.02 116 10 CYS A 38 ? ? -66.88 98.92 117 10 ALA A 50 ? ? 72.93 146.54 118 10 TRP A 52 ? ? 171.93 -43.85 119 10 CYS A 56 ? ? -147.62 -39.19 120 10 ARG A 57 ? ? 62.03 76.99 121 10 LEU A 59 ? ? -169.39 89.65 122 10 GLU A 60 ? ? 56.41 75.12 123 10 ILE A 79 ? ? 71.81 93.86 124 10 ASN A 80 ? ? -120.40 -68.64 125 10 GLU A 82 ? ? -85.61 -73.05 126 11 HIS A 3 ? ? 58.05 14.02 127 11 HIS A 6 ? ? -69.96 93.42 128 11 PHE A 31 ? ? -44.21 -71.09 129 11 CYS A 38 ? ? -67.48 95.65 130 11 CYS A 56 ? ? 59.37 16.26 131 11 ALA A 114 ? ? -157.55 89.19 132 12 THR A 16 ? ? -123.50 -160.85 133 12 MET A 22 ? ? -67.85 77.52 134 12 PHE A 31 ? ? -51.29 -70.96 135 12 CYS A 38 ? ? -46.02 99.58 136 12 TRP A 49 ? ? -170.22 140.58 137 12 TRP A 52 ? ? -69.09 86.63 138 12 CYS A 53 ? ? -147.10 -45.59 139 12 PRO A 55 ? ? -76.29 -159.77 140 12 CYS A 56 ? ? -66.99 79.85 141 12 GLU A 60 ? ? 63.12 75.61 142 12 GLU A 82 ? ? -85.33 -71.06 143 12 VAL A 93 ? ? -69.27 98.35 144 12 LYS A 103 ? ? -166.77 116.92 145 12 ALA A 114 ? ? -157.47 83.73 146 13 PHE A 31 ? ? -48.20 -71.01 147 13 CYS A 38 ? ? -60.19 90.73 148 13 TRP A 49 ? ? 35.83 76.13 149 13 PRO A 51 ? ? -64.24 85.86 150 13 TRP A 52 ? ? 40.34 -74.27 151 13 CYS A 53 ? ? 64.92 -76.55 152 13 PRO A 55 ? ? -56.61 94.16 153 13 ARG A 57 ? ? -156.94 7.21 154 13 ILE A 96 ? ? 68.44 128.10 155 13 ALA A 114 ? ? -157.61 57.27 156 14 HIS A 7 ? ? -56.87 92.12 157 14 MET A 9 ? ? -152.89 10.58 158 14 THR A 11 ? ? -69.87 96.96 159 14 PHE A 31 ? ? -50.45 -70.81 160 14 CYS A 38 ? ? -53.68 92.10 161 14 PRO A 51 ? ? -66.70 -171.50 162 14 PRO A 55 ? ? -77.67 42.01 163 14 GLU A 60 ? ? 57.64 78.30 164 14 SER A 94 ? ? -148.01 35.54 165 15 HIS A 5 ? ? -150.14 79.17 166 15 HIS A 8 ? ? -144.10 16.43 167 15 PRO A 19 ? ? -65.23 76.04 168 15 SER A 21 ? ? -61.06 92.29 169 15 PHE A 31 ? ? -49.13 -70.80 170 15 CYS A 38 ? ? -59.30 104.49 171 15 TRP A 49 ? ? -110.41 -164.00 172 15 TRP A 52 ? ? -95.94 -76.01 173 15 ILE A 79 ? ? 85.85 95.22 174 15 ASN A 80 ? ? -153.34 87.05 175 15 ILE A 81 ? ? -61.46 92.29 176 15 SER A 94 ? ? -66.81 81.27 177 15 ALA A 114 ? ? -157.21 57.37 178 16 LEU A 12 ? ? -77.91 -72.62 179 16 PRO A 19 ? ? -64.80 93.04 180 16 PHE A 31 ? ? -52.85 -71.63 181 16 TRP A 49 ? ? -40.09 104.96 182 16 PRO A 51 ? ? -57.72 109.13 183 16 CYS A 53 ? ? 72.56 -62.22 184 16 CYS A 56 ? ? 172.51 26.83 185 16 ASN A 84 ? ? -55.86 103.62 186 17 HIS A 6 ? ? -136.49 -50.67 187 17 THR A 16 ? ? -130.49 -73.02 188 17 PHE A 31 ? ? -46.23 -70.08 189 17 PRO A 51 ? ? -65.78 78.41 190 17 CYS A 56 ? ? 65.02 -73.70 191 17 GLU A 82 ? ? -84.93 -72.43 192 17 ALA A 114 ? ? -157.24 88.15 193 18 ALA A 2 ? ? 74.83 -51.30 194 18 HIS A 6 ? ? 69.31 152.45 195 18 HIS A 7 ? ? -157.83 75.00 196 18 MET A 9 ? ? -69.21 91.51 197 18 GLU A 13 ? ? -171.19 116.40 198 18 THR A 16 ? ? -69.74 89.65 199 18 PHE A 31 ? ? -51.61 -70.80 200 18 TRP A 49 ? ? 35.95 84.47 201 18 LYS A 103 ? ? -162.86 117.32 202 19 GLU A 13 ? ? -175.32 145.15 203 19 PHE A 31 ? ? -48.80 -70.15 204 19 CYS A 38 ? ? -28.93 101.17 205 19 PRO A 55 ? ? -76.82 48.64 206 19 ILE A 81 ? ? -115.97 76.33 207 19 ASN A 84 ? ? 75.50 143.44 208 19 VAL A 93 ? ? -61.71 98.90 209 19 ALA A 114 ? ? -157.41 57.22 210 20 GLU A 13 ? ? 70.03 115.80 211 20 SER A 21 ? ? -69.25 80.25 212 20 CYS A 38 ? ? -60.55 90.25 213 20 GLU A 60 ? ? 39.59 73.40 214 20 ASN A 84 ? ? 63.80 -170.27 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # _pdbx_nmr_ensemble.entry_id 6AMR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6AMR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label Sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium chloride' 100 ? mM 'natural abundance' 1 TRIS 20 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.003 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label Condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.5 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 3 anisotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 3 anisotropic 3 1 1 '2D 1H-13C HSQC aromatic' 3 anisotropic 4 1 1 '3D C(CO)NH' 1 anisotropic 5 1 1 '3D HNCACB' 1 anisotropic 11 1 1 '3D HNCO' 1 anisotropic 10 1 1 '3D 1H-15N NOESY' 3 anisotropic 9 1 1 '3D 1H-13C NOESY aliphatic' 2 anisotropic 8 1 1 '3D 1H-13C NOESY aromatic' 2 anisotropic 7 1 1 '2D 1H-15N HSQC Deuterium Exchange' 2 anisotropic # _pdbx_nmr_refine.entry_id 6AMR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;Proline-97 was constrained to the Cis configuration on the basis of other Trx structures. STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA (AUTOMATED NOESY ASSIGNMENTS). A TOTAL OF 20 STRUCTURES OUT OF 100 WITH LOWEST TARGET FUNCTION FROM THE FINAL CYANA CALCULATION WERE TAKEN AND REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS) AFTER ADDING 10% TO THE UPPER BOUNDARY LIMIT OF THE DISTANCE RESTRAINTS AND THE VDW LIMIT TO THE LOWER RESTRAINT. PARAM19 WAS USED FOR THE WATER REFINEMENT CALCULATIONS. ; _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS 1.1 'Brunger A. T. et.al.' 2 'data analysis' Sparky 3.115 Goddard 3 'data analysis' PSVS 1.5 'Bhattacharya and Montelione' 4 refinement CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 5 'data analysis' TALOS + 'Cornilescu, Delaglio and Bax' 6 processing Felix 2007 'Accelrys Software Inc.' 7 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272201200025C 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272200700057C 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 VXRS ? Varian 600 ? 2 VXRS ? Varian 750 ? 3 VXRS ? Varian 800 ? # _atom_sites.entry_id 6AMR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_