data_6AYH # _entry.id 6AYH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6AYH WWPDB D_1000229928 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6AYH _pdbx_database_status.recvd_initial_deposition_date 2017-09-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Little, M.S.' 1 ? 'Pellock, S.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first E152 _citation.page_last E161 _citation.title 'Structural basis for the regulation of beta-glucuronidase expression by human gut Enterobacteriaceae.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1716241115 _citation.pdbx_database_id_PubMed 29269393 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Little, M.S.' 1 ? primary 'Pellock, S.J.' 2 ? primary 'Walton, W.G.' 3 ? primary 'Tripathy, A.' 4 ? primary 'Redinbo, M.R.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6AYH _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.686 _cell.length_a_esd ? _cell.length_b 55.230 _cell.length_b_esd ? _cell.length_c 60.499 _cell.length_c_esd ? _cell.volume 176042.881 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6AYH _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall 'P 2 2ab' _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TetR family transcriptional regulator' 22552.506 1 ? ? ? ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 non-polymer syn '4-nitrophenyl beta-D-glucopyranosiduronic acid' 315.233 1 ? ? ? ? 4 water nat water 18.015 114 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)ENKLTEPLPTR(MSE)RILRAARQCFAENGFHSTS(MSE)KTICKASD(MSE)SPGTLYHHFPSKEALIEAI ILEDQERALTHFREPLEGVGLVDYLVESTIAVTREDYAQRALVVEI(MSE)AEG(MSE)RNPQVAE(MSE)LTNKYHTII ASLVARFNDAQAKGEIGADVDKE(MSE)AARLLLATTYGVLSDSSSAENARHVSFATTLRTMLTGLLKCNSAS ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMENKLTEPLPTRMRILRAARQCFAENGFHSTSMKTICKASDMSPGTLYHHFPSKEALIEAIILEDQERALTHFREPL EGVGLVDYLVESTIAVTREDYAQRALVVEIMAEGMRNPQVAEMLTNKYHTIIASLVARFNDAQAKGEIGADVDKEMAARL LLATTYGVLSDSSSAENARHVSFATTLRTMLTGLLKCNSAS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 GLU n 1 6 ASN n 1 7 LYS n 1 8 LEU n 1 9 THR n 1 10 GLU n 1 11 PRO n 1 12 LEU n 1 13 PRO n 1 14 THR n 1 15 ARG n 1 16 MSE n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 ARG n 1 21 ALA n 1 22 ALA n 1 23 ARG n 1 24 GLN n 1 25 CYS n 1 26 PHE n 1 27 ALA n 1 28 GLU n 1 29 ASN n 1 30 GLY n 1 31 PHE n 1 32 HIS n 1 33 SER n 1 34 THR n 1 35 SER n 1 36 MSE n 1 37 LYS n 1 38 THR n 1 39 ILE n 1 40 CYS n 1 41 LYS n 1 42 ALA n 1 43 SER n 1 44 ASP n 1 45 MSE n 1 46 SER n 1 47 PRO n 1 48 GLY n 1 49 THR n 1 50 LEU n 1 51 TYR n 1 52 HIS n 1 53 HIS n 1 54 PHE n 1 55 PRO n 1 56 SER n 1 57 LYS n 1 58 GLU n 1 59 ALA n 1 60 LEU n 1 61 ILE n 1 62 GLU n 1 63 ALA n 1 64 ILE n 1 65 ILE n 1 66 LEU n 1 67 GLU n 1 68 ASP n 1 69 GLN n 1 70 GLU n 1 71 ARG n 1 72 ALA n 1 73 LEU n 1 74 THR n 1 75 HIS n 1 76 PHE n 1 77 ARG n 1 78 GLU n 1 79 PRO n 1 80 LEU n 1 81 GLU n 1 82 GLY n 1 83 VAL n 1 84 GLY n 1 85 LEU n 1 86 VAL n 1 87 ASP n 1 88 TYR n 1 89 LEU n 1 90 VAL n 1 91 GLU n 1 92 SER n 1 93 THR n 1 94 ILE n 1 95 ALA n 1 96 VAL n 1 97 THR n 1 98 ARG n 1 99 GLU n 1 100 ASP n 1 101 TYR n 1 102 ALA n 1 103 GLN n 1 104 ARG n 1 105 ALA n 1 106 LEU n 1 107 VAL n 1 108 VAL n 1 109 GLU n 1 110 ILE n 1 111 MSE n 1 112 ALA n 1 113 GLU n 1 114 GLY n 1 115 MSE n 1 116 ARG n 1 117 ASN n 1 118 PRO n 1 119 GLN n 1 120 VAL n 1 121 ALA n 1 122 GLU n 1 123 MSE n 1 124 LEU n 1 125 THR n 1 126 ASN n 1 127 LYS n 1 128 TYR n 1 129 HIS n 1 130 THR n 1 131 ILE n 1 132 ILE n 1 133 ALA n 1 134 SER n 1 135 LEU n 1 136 VAL n 1 137 ALA n 1 138 ARG n 1 139 PHE n 1 140 ASN n 1 141 ASP n 1 142 ALA n 1 143 GLN n 1 144 ALA n 1 145 LYS n 1 146 GLY n 1 147 GLU n 1 148 ILE n 1 149 GLY n 1 150 ALA n 1 151 ASP n 1 152 VAL n 1 153 ASP n 1 154 LYS n 1 155 GLU n 1 156 MSE n 1 157 ALA n 1 158 ALA n 1 159 ARG n 1 160 LEU n 1 161 LEU n 1 162 LEU n 1 163 ALA n 1 164 THR n 1 165 THR n 1 166 TYR n 1 167 GLY n 1 168 VAL n 1 169 LEU n 1 170 SER n 1 171 ASP n 1 172 SER n 1 173 SER n 1 174 SER n 1 175 ALA n 1 176 GLU n 1 177 ASN n 1 178 ALA n 1 179 ARG n 1 180 HIS n 1 181 VAL n 1 182 SER n 1 183 PHE n 1 184 ALA n 1 185 THR n 1 186 THR n 1 187 LEU n 1 188 ARG n 1 189 THR n 1 190 MET n 1 191 LEU n 1 192 THR n 1 193 GLY n 1 194 LEU n 1 195 LEU n 1 196 LYS n 1 197 CYS n 1 198 ASN n 1 199 SER n 1 200 ALA n 1 201 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 201 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene A7R90_09440 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella choleraesuis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 28901 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-Gold(DE3)pLysS AG' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1S0ZXA5_SALCE _struct_ref.pdbx_db_accession A0A1S0ZXA5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MENKLTEPLPTRMRILRAARQCFAENGFHSTSMKTICKASDMSPGTLYHHFPSKEALIEAIILEDQERALTHFREPLEGV GLVDYLVESTIAVTREDYAQRALVVEIMAEGMRNPQVAEMLTNKYHTIIASLVARFNDAQAKGEIGADVDKEMAARLLLA TTYGVLSDSSSAENARHVSFATTLRTMLTGLLKCNSAS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6AYH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 201 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1S0ZXA5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 198 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 201 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6AYH SER A 1 ? UNP A0A1S0ZXA5 ? ? 'expression tag' 1 1 1 6AYH ASN A 2 ? UNP A0A1S0ZXA5 ? ? 'expression tag' 2 2 1 6AYH ALA A 3 ? UNP A0A1S0ZXA5 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C3G D-saccharide n '4-nitrophenyl beta-D-glucopyranosiduronic acid' ? 'C12 H13 N O9' 315.233 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6AYH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG3350, 0.2M Ammonium Acetate, 0.1M Bis-Tris pH6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97939 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97939 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 21.8340553132 _reflns.entry_id 6AYH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.05 _reflns.d_resolution_low 27.62 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20844 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.09 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 28.65 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6AYH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.05 _refine.ls_d_res_low 27.615 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20844 _refine.ls_number_reflns_R_free 2076 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.99 _refine.ls_percent_reflns_R_free 9.96 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1871 _refine.ls_R_factor_R_free 0.2220 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1833 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.335 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.123 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2101 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1450 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 114 _refine_hist.number_atoms_total 1592 _refine_hist.d_res_high 2.05 _refine_hist.d_res_low 27.615 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00272402179054 ? 1500 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.509157033278 ? 2035 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0337802547616 ? 246 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00306872902639 ? 260 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 10.6542364253 ? 903 ? f_dihedral_angle_d ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0546 _refine_ls_shell.d_res_low 2.1023 _refine_ls_shell.number_reflns_all . _refine_ls_shell.number_reflns_obs . _refine_ls_shell.number_reflns_R_free 116 _refine_ls_shell.number_reflns_R_work 1120 _refine_ls_shell.percent_reflns_obs 86.92 _refine_ls_shell.percent_reflns_R_free . _refine_ls_shell.R_factor_all . _refine_ls_shell.R_factor_obs . _refine_ls_shell.R_factor_R_free 0.2855 _refine_ls_shell.R_factor_R_free_error . _refine_ls_shell.R_factor_R_work 0.2812 _refine_ls_shell.redundancy_reflns_all . _refine_ls_shell.redundancy_reflns_obs . _refine_ls_shell.wR_factor_all . _refine_ls_shell.wR_factor_obs . _refine_ls_shell.wR_factor_R_free . _refine_ls_shell.wR_factor_R_work . _refine_ls_shell.pdbx_total_number_of_bins_used . _refine_ls_shell.pdbx_phase_error . _refine_ls_shell.pdbx_fsc_work . _refine_ls_shell.pdbx_fsc_free . # _struct.entry_id 6AYH _struct.title 'Salmonella enterica GusR' _struct.pdbx_descriptor 'TetR family transcriptional regulator' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6AYH _struct_keywords.text 'Transcriptional Repressor Protein, Glucuronide Binding Protein, DNA Binding Protein, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 11 ? GLY A 30 ? PRO A 11 GLY A 30 1 ? 20 HELX_P HELX_P2 AA2 SER A 35 ? ASP A 44 ? SER A 35 ASP A 44 1 ? 10 HELX_P HELX_P3 AA3 SER A 46 ? PHE A 54 ? SER A 46 PHE A 54 1 ? 9 HELX_P HELX_P4 AA4 SER A 56 ? ARG A 77 ? SER A 56 ARG A 77 1 ? 22 HELX_P HELX_P5 AA5 GLY A 84 ? GLU A 99 ? GLY A 84 GLU A 99 1 ? 16 HELX_P HELX_P6 AA6 ASP A 100 ? ASN A 117 ? ASP A 100 ASN A 117 1 ? 18 HELX_P HELX_P7 AA7 ASN A 117 ? LYS A 145 ? ASN A 117 LYS A 145 1 ? 29 HELX_P HELX_P8 AA8 ASP A 153 ? SER A 170 ? ASP A 153 SER A 170 1 ? 18 HELX_P HELX_P9 AA9 SER A 173 ? ALA A 178 ? SER A 173 ALA A 178 1 ? 6 HELX_P HELX_P10 AB1 HIS A 180 ? LEU A 195 ? HIS A 180 LEU A 195 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ARG 15 C ? ? ? 1_555 A MSE 16 N ? ? A ARG 15 A MSE 16 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A MSE 16 C ? ? ? 1_555 A ARG 17 N ? ? A MSE 16 A ARG 17 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale3 covale both ? A SER 35 C ? ? ? 1_555 A MSE 36 N ? ? A SER 35 A MSE 36 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A MSE 36 C ? ? ? 1_555 A LYS 37 N ? ? A MSE 36 A LYS 37 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale5 covale both ? A ASP 44 C ? ? ? 1_555 A MSE 45 N ? ? A ASP 44 A MSE 45 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale6 covale both ? A MSE 45 C ? ? ? 1_555 A SER 46 N ? ? A MSE 45 A SER 46 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale both ? A ILE 110 C ? ? ? 1_555 A MSE 111 N ? ? A ILE 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A MSE 111 C ? ? ? 1_555 A ALA 112 N ? ? A MSE 111 A ALA 112 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale9 covale both ? A GLY 114 C ? ? ? 1_555 A MSE 115 N ? ? A GLY 114 A MSE 115 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale10 covale both ? A MSE 115 C ? ? ? 1_555 A ARG 116 N ? ? A MSE 115 A ARG 116 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale11 covale both ? A GLU 122 C ? ? ? 1_555 A MSE 123 N ? ? A GLU 122 A MSE 123 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale12 covale both ? A MSE 123 C ? ? ? 1_555 A LEU 124 N ? ? A MSE 123 A LEU 124 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale13 covale both ? A GLU 155 C ? ? ? 1_555 A MSE 156 N ? ? A GLU 155 A MSE 156 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale14 covale both ? A MSE 156 C ? ? ? 1_555 A ALA 157 N ? ? A MSE 156 A ALA 157 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 10 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 10 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 11 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 11 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.92 # _atom_sites.entry_id 6AYH _atom_sites.fract_transf_matrix[1][1] 0.018980 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018106 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016529 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 3.49406 27.47979 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 1.54240 29.12501 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 MSE 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 MSE 16 16 16 MSE MSE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 MSE 36 36 36 MSE MSE A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 MSE 45 45 45 MSE MSE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 MSE 111 111 111 MSE MSE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 MSE 115 115 115 MSE MSE A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 MSE 123 123 123 MSE MSE A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 MSE 156 156 156 MSE MSE A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 MET 190 190 190 MET MET A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 CYS 197 197 197 CYS CYS A . n A 1 198 ASN 198 198 ? ? ? A . n A 1 199 SER 199 199 ? ? ? A . n A 1 200 ALA 200 200 ? ? ? A . n A 1 201 SER 201 201 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 301 2 GOL GOL A . C 3 C3G 1 302 1 C3G PNP A . D 4 HOH 1 401 108 HOH HOH A . D 4 HOH 2 402 27 HOH HOH A . D 4 HOH 3 403 61 HOH HOH A . D 4 HOH 4 404 96 HOH HOH A . D 4 HOH 5 405 37 HOH HOH A . D 4 HOH 6 406 3 HOH HOH A . D 4 HOH 7 407 113 HOH HOH A . D 4 HOH 8 408 7 HOH HOH A . D 4 HOH 9 409 14 HOH HOH A . D 4 HOH 10 410 57 HOH HOH A . D 4 HOH 11 411 5 HOH HOH A . D 4 HOH 12 412 20 HOH HOH A . D 4 HOH 13 413 109 HOH HOH A . D 4 HOH 14 414 70 HOH HOH A . D 4 HOH 15 415 46 HOH HOH A . D 4 HOH 16 416 13 HOH HOH A . D 4 HOH 17 417 6 HOH HOH A . D 4 HOH 18 418 48 HOH HOH A . D 4 HOH 19 419 101 HOH HOH A . D 4 HOH 20 420 2 HOH HOH A . D 4 HOH 21 421 47 HOH HOH A . D 4 HOH 22 422 45 HOH HOH A . D 4 HOH 23 423 55 HOH HOH A . D 4 HOH 24 424 34 HOH HOH A . D 4 HOH 25 425 9 HOH HOH A . D 4 HOH 26 426 17 HOH HOH A . D 4 HOH 27 427 12 HOH HOH A . D 4 HOH 28 428 24 HOH HOH A . D 4 HOH 29 429 64 HOH HOH A . D 4 HOH 30 430 32 HOH HOH A . D 4 HOH 31 431 52 HOH HOH A . D 4 HOH 32 432 43 HOH HOH A . D 4 HOH 33 433 53 HOH HOH A . D 4 HOH 34 434 54 HOH HOH A . D 4 HOH 35 435 1 HOH HOH A . D 4 HOH 36 436 4 HOH HOH A . D 4 HOH 37 437 60 HOH HOH A . D 4 HOH 38 438 68 HOH HOH A . D 4 HOH 39 439 28 HOH HOH A . D 4 HOH 40 440 36 HOH HOH A . D 4 HOH 41 441 15 HOH HOH A . D 4 HOH 42 442 66 HOH HOH A . D 4 HOH 43 443 74 HOH HOH A . D 4 HOH 44 444 35 HOH HOH A . D 4 HOH 45 445 30 HOH HOH A . D 4 HOH 46 446 10 HOH HOH A . D 4 HOH 47 447 19 HOH HOH A . D 4 HOH 48 448 76 HOH HOH A . D 4 HOH 49 449 100 HOH HOH A . D 4 HOH 50 450 8 HOH HOH A . D 4 HOH 51 451 107 HOH HOH A . D 4 HOH 52 452 42 HOH HOH A . D 4 HOH 53 453 22 HOH HOH A . D 4 HOH 54 454 26 HOH HOH A . D 4 HOH 55 455 21 HOH HOH A . D 4 HOH 56 456 79 HOH HOH A . D 4 HOH 57 457 33 HOH HOH A . D 4 HOH 58 458 58 HOH HOH A . D 4 HOH 59 459 65 HOH HOH A . D 4 HOH 60 460 92 HOH HOH A . D 4 HOH 61 461 25 HOH HOH A . D 4 HOH 62 462 11 HOH HOH A . D 4 HOH 63 463 49 HOH HOH A . D 4 HOH 64 464 81 HOH HOH A . D 4 HOH 65 465 75 HOH HOH A . D 4 HOH 66 466 18 HOH HOH A . D 4 HOH 67 467 40 HOH HOH A . D 4 HOH 68 468 62 HOH HOH A . D 4 HOH 69 469 88 HOH HOH A . D 4 HOH 70 470 16 HOH HOH A . D 4 HOH 71 471 102 HOH HOH A . D 4 HOH 72 472 71 HOH HOH A . D 4 HOH 73 473 98 HOH HOH A . D 4 HOH 74 474 77 HOH HOH A . D 4 HOH 75 475 105 HOH HOH A . D 4 HOH 76 476 38 HOH HOH A . D 4 HOH 77 477 84 HOH HOH A . D 4 HOH 78 478 91 HOH HOH A . D 4 HOH 79 479 39 HOH HOH A . D 4 HOH 80 480 114 HOH HOH A . D 4 HOH 81 481 72 HOH HOH A . D 4 HOH 82 482 63 HOH HOH A . D 4 HOH 83 483 29 HOH HOH A . D 4 HOH 84 484 99 HOH HOH A . D 4 HOH 85 485 104 HOH HOH A . D 4 HOH 86 486 23 HOH HOH A . D 4 HOH 87 487 110 HOH HOH A . D 4 HOH 88 488 80 HOH HOH A . D 4 HOH 89 489 82 HOH HOH A . D 4 HOH 90 490 95 HOH HOH A . D 4 HOH 91 491 56 HOH HOH A . D 4 HOH 92 492 31 HOH HOH A . D 4 HOH 93 493 41 HOH HOH A . D 4 HOH 94 494 86 HOH HOH A . D 4 HOH 95 495 83 HOH HOH A . D 4 HOH 96 496 85 HOH HOH A . D 4 HOH 97 497 44 HOH HOH A . D 4 HOH 98 498 106 HOH HOH A . D 4 HOH 99 499 69 HOH HOH A . D 4 HOH 100 500 51 HOH HOH A . D 4 HOH 101 501 103 HOH HOH A . D 4 HOH 102 502 59 HOH HOH A . D 4 HOH 103 503 50 HOH HOH A . D 4 HOH 104 504 90 HOH HOH A . D 4 HOH 105 505 93 HOH HOH A . D 4 HOH 106 506 78 HOH HOH A . D 4 HOH 107 507 94 HOH HOH A . D 4 HOH 108 508 112 HOH HOH A . D 4 HOH 109 509 67 HOH HOH A . D 4 HOH 110 510 111 HOH HOH A . D 4 HOH 111 511 89 HOH HOH A . D 4 HOH 112 512 87 HOH HOH A . D 4 HOH 113 513 73 HOH HOH A . D 4 HOH 114 514 97 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 16 A MSE 16 ? MET 'modified residue' 2 A MSE 36 A MSE 36 ? MET 'modified residue' 3 A MSE 45 A MSE 45 ? MET 'modified residue' 4 A MSE 111 A MSE 111 ? MET 'modified residue' 5 A MSE 115 A MSE 115 ? MET 'modified residue' 6 A MSE 123 A MSE 123 ? MET 'modified residue' 7 A MSE 156 A MSE 156 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3820 ? 1 MORE -33 ? 1 'SSA (A^2)' 16490 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 52.6860000000 0.0000000000 -1.0000000000 0.0000000000 55.2300000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 403 ? D HOH . 2 1 A HOH 500 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-20 2 'Structure model' 1 1 2018-01-03 3 'Structure model' 1 2 2018-01-17 4 'Structure model' 1 3 2018-01-31 5 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Atomic model' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' pdbx_related_exp_data_set 4 5 'Structure model' atom_site 5 5 'Structure model' atom_site_anisotrop 6 5 'Structure model' chem_comp 7 5 'Structure model' struct_site 8 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation.year' 8 5 'Structure model' '_atom_site.auth_atom_id' 9 5 'Structure model' '_atom_site.label_atom_id' 10 5 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 11 5 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 12 5 'Structure model' '_chem_comp.mon_nstd_flag' 13 5 'Structure model' '_chem_comp.type' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 23.9296949365 _pdbx_refine_tls.origin_y 16.1072807355 _pdbx_refine_tls.origin_z 19.882878876 _pdbx_refine_tls.T[1][1] 0.114834591062 _pdbx_refine_tls.T[2][2] 0.124999881342 _pdbx_refine_tls.T[3][3] 0.120721364124 _pdbx_refine_tls.T[1][2] 0.0128718231201 _pdbx_refine_tls.T[1][3] -0.00567637294381 _pdbx_refine_tls.T[2][3] -0.0484407643381 _pdbx_refine_tls.L[1][1] 0.673239656807 _pdbx_refine_tls.L[2][2] 0.307872381046 _pdbx_refine_tls.L[3][3] 0.104359294773 _pdbx_refine_tls.L[1][2] 0.212888240016 _pdbx_refine_tls.L[1][3] 0.126377290833 _pdbx_refine_tls.L[2][3] -0.0960701548418 _pdbx_refine_tls.S[1][1] 0.00448568363594 _pdbx_refine_tls.S[1][2] 0.177237811711 _pdbx_refine_tls.S[1][3] -0.125382879548 _pdbx_refine_tls.S[2][1] 0.0197092868551 _pdbx_refine_tls.S[2][2] -9.24054059013e-05 _pdbx_refine_tls.S[2][3] 0.0135158010497 _pdbx_refine_tls.S[3][1] 0.00565907309045 _pdbx_refine_tls.S[3][2] 0.0364577565946 _pdbx_refine_tls.S[3][3] 0.0375070123291 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 448 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 448 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_655 _pdbx_validate_symm_contact.dist 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 100 ? ? -37.60 121.76 2 1 ASP A 151 ? ? -97.21 52.26 3 1 LYS A 196 ? ? 45.91 70.51 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 514 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 7.14 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 7 ? CG ? A LYS 7 CG 2 1 Y 1 A LYS 7 ? CD ? A LYS 7 CD 3 1 Y 1 A LYS 7 ? CE ? A LYS 7 CE 4 1 Y 1 A LYS 7 ? NZ ? A LYS 7 NZ 5 1 Y 1 A GLN 24 ? CD ? A GLN 24 CD 6 1 Y 1 A GLN 24 ? OE1 ? A GLN 24 OE1 7 1 Y 1 A GLN 24 ? NE2 ? A GLN 24 NE2 8 1 Y 1 A LYS 37 ? CG ? A LYS 37 CG 9 1 Y 1 A LYS 37 ? CD ? A LYS 37 CD 10 1 Y 1 A LYS 37 ? CE ? A LYS 37 CE 11 1 Y 1 A LYS 37 ? NZ ? A LYS 37 NZ 12 1 Y 1 A LYS 41 ? CG ? A LYS 41 CG 13 1 Y 1 A LYS 41 ? CD ? A LYS 41 CD 14 1 Y 1 A LYS 41 ? CE ? A LYS 41 CE 15 1 Y 1 A LYS 41 ? NZ ? A LYS 41 NZ 16 1 Y 1 A GLU 78 ? CD ? A GLU 78 CD 17 1 Y 1 A GLU 78 ? OE1 ? A GLU 78 OE1 18 1 Y 1 A GLU 78 ? OE2 ? A GLU 78 OE2 19 1 Y 1 A GLU 81 ? CG ? A GLU 81 CG 20 1 Y 1 A GLU 81 ? CD ? A GLU 81 CD 21 1 Y 1 A GLU 81 ? OE1 ? A GLU 81 OE1 22 1 Y 1 A GLU 81 ? OE2 ? A GLU 81 OE2 23 1 Y 1 A LYS 145 ? CG ? A LYS 145 CG 24 1 Y 1 A LYS 145 ? CD ? A LYS 145 CD 25 1 Y 1 A LYS 145 ? CE ? A LYS 145 CE 26 1 Y 1 A LYS 145 ? NZ ? A LYS 145 NZ 27 1 Y 1 A GLU 147 ? CG ? A GLU 147 CG 28 1 Y 1 A GLU 147 ? CD ? A GLU 147 CD 29 1 Y 1 A GLU 147 ? OE1 ? A GLU 147 OE1 30 1 Y 1 A GLU 147 ? OE2 ? A GLU 147 OE2 31 1 Y 1 A ASP 151 ? CG ? A ASP 151 CG 32 1 Y 1 A ASP 151 ? OD1 ? A ASP 151 OD1 33 1 Y 1 A ASP 151 ? OD2 ? A ASP 151 OD2 34 1 Y 1 A LYS 196 ? CD ? A LYS 196 CD 35 1 Y 1 A LYS 196 ? CE ? A LYS 196 CE 36 1 Y 1 A LYS 196 ? NZ ? A LYS 196 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A MSE 4 ? A MSE 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A ASN 198 ? A ASN 198 7 1 Y 1 A SER 199 ? A SER 199 8 1 Y 1 A ALA 200 ? A ALA 200 9 1 Y 1 A SER 201 ? A SER 201 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id C3G _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id C3G _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 '4-nitrophenyl beta-D-glucopyranosiduronic acid' C3G 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 21 21 2' _space_group.name_Hall 'P 2 2ab' _space_group.IT_number 18 _space_group.crystal_system orthorhombic _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x+1/2,y+1/2,-z 4 -x,-y,z #