data_6B8X # _entry.id 6B8X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.357 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6B8X pdb_00006b8x 10.2210/pdb6b8x/pdb WWPDB D_1000230469 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6B8E unspecified PDB . 6B8T unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6B8X _pdbx_database_status.recvd_initial_deposition_date 2017-10-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Keedy, D.A.' 1 0000-0002-9184-7586 'Hill, Z.B.' 2 ? 'Biel, J.T.' 3 0000-0002-0935-8362 'Kang, E.' 4 ? 'Rettenmaier, T.J.' 5 ? 'Brandao-Neto, J.' 6 ? 'von Delft, F.' 7 0000-0003-0378-0017 'Wells, J.A.' 8 ? 'Fraser, J.S.' 9 0000-0002-5080-2859 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'An expanded allosteric network in PTP1B by multitemperature crystallography, fragment screening, and covalent tethering.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.36307 _citation.pdbx_database_id_PubMed 29877794 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Keedy, D.A.' 1 ? primary 'Hill, Z.B.' 2 ? primary 'Biel, J.T.' 3 ? primary 'Kang, E.' 4 ? primary 'Rettenmaier, T.J.' 5 ? primary 'Brandao-Neto, J.' 6 ? primary 'Pearce, N.M.' 7 ? primary 'von Delft, F.' 8 ? primary 'Wells, J.A.' 9 ? primary 'Fraser, J.S.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6B8X _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.520 _cell.length_a_esd ? _cell.length_b 89.520 _cell.length_b_esd ? _cell.length_c 106.250 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6B8X _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein phosphatase non-receptor type 1' 37345.562 1 3.1.3.48 'C32S, C92V' 'catalytic domain' ? 2 non-polymer syn GLYCEROL 92.094 4 ? ? ? ? 3 water nat water 18.015 211 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein-tyrosine phosphatase 1B,PTP-1B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPSRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTVGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _entity_poly.pdbx_seq_one_letter_code_can ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPSRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTVGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 MET n 1 4 GLU n 1 5 LYS n 1 6 GLU n 1 7 PHE n 1 8 GLU n 1 9 GLN n 1 10 ILE n 1 11 ASP n 1 12 LYS n 1 13 SER n 1 14 GLY n 1 15 SER n 1 16 TRP n 1 17 ALA n 1 18 ALA n 1 19 ILE n 1 20 TYR n 1 21 GLN n 1 22 ASP n 1 23 ILE n 1 24 ARG n 1 25 HIS n 1 26 GLU n 1 27 ALA n 1 28 SER n 1 29 ASP n 1 30 PHE n 1 31 PRO n 1 32 SER n 1 33 ARG n 1 34 VAL n 1 35 ALA n 1 36 LYS n 1 37 LEU n 1 38 PRO n 1 39 LYS n 1 40 ASN n 1 41 LYS n 1 42 ASN n 1 43 ARG n 1 44 ASN n 1 45 ARG n 1 46 TYR n 1 47 ARG n 1 48 ASP n 1 49 VAL n 1 50 SER n 1 51 PRO n 1 52 PHE n 1 53 ASP n 1 54 HIS n 1 55 SER n 1 56 ARG n 1 57 ILE n 1 58 LYS n 1 59 LEU n 1 60 HIS n 1 61 GLN n 1 62 GLU n 1 63 ASP n 1 64 ASN n 1 65 ASP n 1 66 TYR n 1 67 ILE n 1 68 ASN n 1 69 ALA n 1 70 SER n 1 71 LEU n 1 72 ILE n 1 73 LYS n 1 74 MET n 1 75 GLU n 1 76 GLU n 1 77 ALA n 1 78 GLN n 1 79 ARG n 1 80 SER n 1 81 TYR n 1 82 ILE n 1 83 LEU n 1 84 THR n 1 85 GLN n 1 86 GLY n 1 87 PRO n 1 88 LEU n 1 89 PRO n 1 90 ASN n 1 91 THR n 1 92 VAL n 1 93 GLY n 1 94 HIS n 1 95 PHE n 1 96 TRP n 1 97 GLU n 1 98 MET n 1 99 VAL n 1 100 TRP n 1 101 GLU n 1 102 GLN n 1 103 LYS n 1 104 SER n 1 105 ARG n 1 106 GLY n 1 107 VAL n 1 108 VAL n 1 109 MET n 1 110 LEU n 1 111 ASN n 1 112 ARG n 1 113 VAL n 1 114 MET n 1 115 GLU n 1 116 LYS n 1 117 GLY n 1 118 SER n 1 119 LEU n 1 120 LYS n 1 121 CYS n 1 122 ALA n 1 123 GLN n 1 124 TYR n 1 125 TRP n 1 126 PRO n 1 127 GLN n 1 128 LYS n 1 129 GLU n 1 130 GLU n 1 131 LYS n 1 132 GLU n 1 133 MET n 1 134 ILE n 1 135 PHE n 1 136 GLU n 1 137 ASP n 1 138 THR n 1 139 ASN n 1 140 LEU n 1 141 LYS n 1 142 LEU n 1 143 THR n 1 144 LEU n 1 145 ILE n 1 146 SER n 1 147 GLU n 1 148 ASP n 1 149 ILE n 1 150 LYS n 1 151 SER n 1 152 TYR n 1 153 TYR n 1 154 THR n 1 155 VAL n 1 156 ARG n 1 157 GLN n 1 158 LEU n 1 159 GLU n 1 160 LEU n 1 161 GLU n 1 162 ASN n 1 163 LEU n 1 164 THR n 1 165 THR n 1 166 GLN n 1 167 GLU n 1 168 THR n 1 169 ARG n 1 170 GLU n 1 171 ILE n 1 172 LEU n 1 173 HIS n 1 174 PHE n 1 175 HIS n 1 176 TYR n 1 177 THR n 1 178 THR n 1 179 TRP n 1 180 PRO n 1 181 ASP n 1 182 PHE n 1 183 GLY n 1 184 VAL n 1 185 PRO n 1 186 GLU n 1 187 SER n 1 188 PRO n 1 189 ALA n 1 190 SER n 1 191 PHE n 1 192 LEU n 1 193 ASN n 1 194 PHE n 1 195 LEU n 1 196 PHE n 1 197 LYS n 1 198 VAL n 1 199 ARG n 1 200 GLU n 1 201 SER n 1 202 GLY n 1 203 SER n 1 204 LEU n 1 205 SER n 1 206 PRO n 1 207 GLU n 1 208 HIS n 1 209 GLY n 1 210 PRO n 1 211 VAL n 1 212 VAL n 1 213 VAL n 1 214 HIS n 1 215 CYS n 1 216 SER n 1 217 ALA n 1 218 GLY n 1 219 ILE n 1 220 GLY n 1 221 ARG n 1 222 SER n 1 223 GLY n 1 224 THR n 1 225 PHE n 1 226 CYS n 1 227 LEU n 1 228 ALA n 1 229 ASP n 1 230 THR n 1 231 CYS n 1 232 LEU n 1 233 LEU n 1 234 LEU n 1 235 MET n 1 236 ASP n 1 237 LYS n 1 238 ARG n 1 239 LYS n 1 240 ASP n 1 241 PRO n 1 242 SER n 1 243 SER n 1 244 VAL n 1 245 ASP n 1 246 ILE n 1 247 LYS n 1 248 LYS n 1 249 VAL n 1 250 LEU n 1 251 LEU n 1 252 GLU n 1 253 MET n 1 254 ARG n 1 255 LYS n 1 256 PHE n 1 257 ARG n 1 258 MET n 1 259 GLY n 1 260 LEU n 1 261 ILE n 1 262 GLN n 1 263 THR n 1 264 ALA n 1 265 ASP n 1 266 GLN n 1 267 LEU n 1 268 ARG n 1 269 PHE n 1 270 SER n 1 271 TYR n 1 272 LEU n 1 273 ALA n 1 274 VAL n 1 275 ILE n 1 276 GLU n 1 277 GLY n 1 278 ALA n 1 279 LYS n 1 280 PHE n 1 281 ILE n 1 282 MET n 1 283 GLY n 1 284 ASP n 1 285 SER n 1 286 SER n 1 287 VAL n 1 288 GLN n 1 289 ASP n 1 290 GLN n 1 291 TRP n 1 292 LYS n 1 293 GLU n 1 294 LEU n 1 295 SER n 1 296 HIS n 1 297 GLU n 1 298 ASP n 1 299 LEU n 1 300 GLU n 1 301 PRO n 1 302 PRO n 1 303 PRO n 1 304 GLU n 1 305 HIS n 1 306 ILE n 1 307 PRO n 1 308 PRO n 1 309 PRO n 1 310 PRO n 1 311 ARG n 1 312 PRO n 1 313 PRO n 1 314 LYS n 1 315 ARG n 1 316 ILE n 1 317 LEU n 1 318 GLU n 1 319 PRO n 1 320 HIS n 1 321 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 321 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTPN1, PTP1B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTN1_HUMAN _struct_ref.pdbx_db_accession P18031 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6B8X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 321 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18031 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 321 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 321 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6B8X SER A 32 ? UNP P18031 CYS 32 'engineered mutation' 32 1 1 6B8X VAL A 92 ? UNP P18031 CYS 92 'engineered mutation' 92 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6B8X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'well solution: 0.3 M magnesium acetate, 0.1 M HEPES pH 7.5, 0.1% beta-mercaptoethanol, 16% PEG 8000, 2% ethanol, 10% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 278 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-23 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 19.470 _reflns.entry_id 6B8X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.740 _reflns.d_resolution_low 34.230 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 50498 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.923 _reflns.pdbx_Rmerge_I_obs 0.098 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.010 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.957 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.107 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.740 1.790 ? 1.510 ? ? ? ? 3644 98.300 ? ? ? ? 1.248 ? ? ? ? ? ? ? ? 6.204 ? ? ? ? 1.361 ? ? 1 1 0.484 ? 1.790 1.830 ? 1.950 ? ? ? ? 3591 98.800 ? ? ? ? 1.061 ? ? ? ? ? ? ? ? 6.129 ? ? ? ? 1.158 ? ? 2 1 0.572 ? 1.830 1.890 ? 2.800 ? ? ? ? 3501 99.100 ? ? ? ? 0.792 ? ? ? ? ? ? ? ? 5.929 ? ? ? ? 0.868 ? ? 3 1 0.772 ? 1.890 1.950 ? 3.840 ? ? ? ? 3407 99.000 ? ? ? ? 0.608 ? ? ? ? ? ? ? ? 5.761 ? ? ? ? 0.668 ? ? 4 1 0.867 ? 1.950 2.010 ? 4.990 ? ? ? ? 3266 98.000 ? ? ? ? 0.457 ? ? ? ? ? ? ? ? 5.432 ? ? ? ? 0.505 ? ? 5 1 0.912 ? 2.010 2.080 ? 7.140 ? ? ? ? 3230 99.600 ? ? ? ? 0.370 ? ? ? ? ? ? ? ? 6.064 ? ? ? ? 0.404 ? ? 6 1 0.952 ? 2.080 2.160 ? 8.820 ? ? ? ? 3098 99.500 ? ? ? ? 0.298 ? ? ? ? ? ? ? ? 6.093 ? ? ? ? 0.325 ? ? 7 1 0.970 ? 2.160 2.250 ? 11.450 ? ? ? ? 2982 99.500 ? ? ? ? 0.217 ? ? ? ? ? ? ? ? 6.134 ? ? ? ? 0.236 ? ? 8 1 0.984 ? 2.250 2.350 ? 12.650 ? ? ? ? 2891 99.800 ? ? ? ? 0.186 ? ? ? ? ? ? ? ? 5.978 ? ? ? ? 0.203 ? ? 9 1 0.987 ? 2.350 2.460 ? 15.410 ? ? ? ? 2691 98.100 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 5.760 ? ? ? ? 0.150 ? ? 10 1 0.990 ? 2.460 2.590 ? 18.110 ? ? ? ? 2633 99.700 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 6.242 ? ? ? ? 0.126 ? ? 11 1 0.994 ? 2.590 2.750 ? 21.560 ? ? ? ? 2470 99.500 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 6.163 ? ? ? ? 0.098 ? ? 12 1 0.996 ? 2.750 2.940 ? 25.470 ? ? ? ? 2357 99.900 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 6.037 ? ? ? ? 0.078 ? ? 13 1 0.997 ? 2.940 3.180 ? 30.250 ? ? ? ? 2160 98.200 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 5.605 ? ? ? ? 0.058 ? ? 14 1 0.997 ? 3.180 3.480 ? 39.510 ? ? ? ? 2034 100.000 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 6.107 ? ? ? ? 0.042 ? ? 15 1 0.999 ? 3.480 3.890 ? 47.130 ? ? ? ? 1836 99.800 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 5.879 ? ? ? ? 0.034 ? ? 16 1 0.999 ? 3.890 4.490 ? 50.780 ? ? ? ? 1634 99.700 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 5.445 ? ? ? ? 0.029 ? ? 17 1 0.999 ? 4.490 5.500 ? 54.650 ? ? ? ? 1357 97.300 ? ? ? ? 0.025 ? ? ? ? ? ? ? ? 5.562 ? ? ? ? 0.027 ? ? 18 1 0.999 ? 5.500 7.780 ? 53.520 ? ? ? ? 1098 99.200 ? ? ? ? 0.024 ? ? ? ? ? ? ? ? 5.532 ? ? ? ? 0.027 ? ? 19 1 0.999 ? 7.780 34.230 ? 57.820 ? ? ? ? 618 95.100 ? ? ? ? 0.021 ? ? ? ? ? ? ? ? 5.013 ? ? ? ? 0.024 ? ? 20 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 161.470 _refine.B_iso_mean 31.4347 _refine.B_iso_min 5.770 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6B8X _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7400 _refine.ls_d_res_low 34.2300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 50483 _refine.ls_number_reflns_R_free 1993 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0300 _refine.ls_percent_reflns_R_free 3.9500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1764 _refine.ls_R_factor_R_free 0.2059 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1752 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.4900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7400 _refine_hist.d_res_low 34.2300 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.number_atoms_solvent 225 _refine_hist.number_atoms_total 2708 _refine_hist.pdbx_number_residues_total 298 _refine_hist.pdbx_B_iso_mean_ligand 74.98 _refine_hist.pdbx_B_iso_mean_solvent 39.32 _refine_hist.pdbx_number_atoms_protein 2435 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 3135 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.076 ? 4270 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.185 ? 434 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 569 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.308 ? 1923 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7400 1.7835 3520 . 141 3379 98.0000 . . . 0.3670 0.0000 0.3321 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.7835 1.8317 3559 . 137 3422 99.0000 . . . 0.3481 0.0000 0.3093 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.8317 1.8856 3543 . 140 3403 99.0000 . . . 0.2898 0.0000 0.2812 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.8856 1.9464 3589 . 140 3449 99.0000 . . . 0.2767 0.0000 0.2520 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.9464 2.0160 3523 . 142 3381 98.0000 . . . 0.2489 0.0000 0.2263 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.0160 2.0967 3603 . 143 3460 99.0000 . . . 0.2005 0.0000 0.2006 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.0967 2.1921 3606 . 143 3463 100.0000 . . . 0.2388 0.0000 0.1854 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.1921 2.3077 3607 . 144 3463 100.0000 . . . 0.2109 0.0000 0.1749 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.3077 2.4522 3563 . 143 3420 99.0000 . . . 0.2076 0.0000 0.1737 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.4522 2.6415 3621 . 143 3478 100.0000 . . . 0.1846 0.0000 0.1507 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.6415 2.9072 3646 . 145 3501 100.0000 . . . 0.1924 0.0000 0.1500 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.9072 3.3275 3641 . 142 3499 99.0000 . . . 0.1659 0.0000 0.1445 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.3275 4.1912 3700 . 143 3557 100.0000 . . . 0.1654 0.0000 0.1326 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 4.1912 34.2367 3762 . 147 3615 98.0000 . . . 0.1891 0.0000 0.1599 . . . . . . 14 . . . # _struct.entry_id 6B8X _struct.title 'Multiconformer model of apo WT PTP1B with glycerol at 278 K' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6B8X _struct_keywords.text ;protein tyrosine phosphatase, PTP, protein tyrosine phosphatase 1B, PTP1B, enzyme, allostery, multitemperature, multiconformer, SIGNALING PROTEIN ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 2 ? GLY A 14 ? GLU A 2 GLY A 14 1 ? 13 HELX_P HELX_P2 AA2 SER A 15 ? ALA A 27 ? SER A 15 ALA A 27 1 ? 13 HELX_P HELX_P3 AA3 LEU A 37 ? ASN A 44 ? LEU A 37 ASN A 44 5 ? 8 HELX_P HELX_P4 AA4 PHE A 52 ? HIS A 54 ? PHE A 52 HIS A 54 5 ? 3 HELX_P HELX_P5 AA5 LEU A 88 ? ASN A 90 ? LEU A 88 ASN A 90 5 ? 3 HELX_P HELX_P6 AA6 THR A 91 ? LYS A 103 ? THR A 91 LYS A 103 1 ? 13 HELX_P HELX_P7 AA7 SER A 187 ? SER A 201 ? SER A 187 SER A 201 1 ? 15 HELX_P HELX_P8 AA8 GLY A 220 ? LYS A 239 ? GLY A 220 LYS A 239 1 ? 20 HELX_P HELX_P9 AA9 ASP A 245 ? ARG A 254 ? ASP A 245 ARG A 254 1 ? 10 HELX_P HELX_P10 AB1 THR A 263 ? MET A 282 ? THR A 263 MET A 282 1 ? 20 HELX_P HELX_P11 AB2 SER A 285 ? HIS A 296 ? SER A 285 HIS A 296 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 56 ? LYS A 58 ? ARG A 56 LYS A 58 AA1 2 TYR A 66 ? MET A 74 ? TYR A 66 MET A 74 AA1 3 ARG A 79 ? THR A 84 ? ARG A 79 THR A 84 AA1 4 VAL A 211 ? HIS A 214 ? VAL A 211 HIS A 214 AA1 5 GLY A 106 ? MET A 109 ? GLY A 106 MET A 109 AA1 6 THR A 168 ? TYR A 176 ? THR A 168 TYR A 176 AA1 7 TYR A 153 ? ASN A 162 ? TYR A 153 ASN A 162 AA1 8 LEU A 140 ? ILE A 149 ? LEU A 140 ILE A 149 AA1 9 MET A 133 ? PHE A 135 ? MET A 133 PHE A 135 AA2 1 MET A 114 ? GLU A 115 ? MET A 114 GLU A 115 AA2 2 SER A 118 ? LEU A 119 ? SER A 118 LEU A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 57 ? N ILE A 57 O ALA A 69 ? O ALA A 69 AA1 2 3 N ILE A 72 ? N ILE A 72 O TYR A 81 ? O TYR A 81 AA1 3 4 N ILE A 82 ? N ILE A 82 O VAL A 213 ? O VAL A 213 AA1 4 5 O VAL A 212 ? O VAL A 212 N VAL A 108 ? N VAL A 108 AA1 5 6 N VAL A 107 ? N VAL A 107 O PHE A 174 ? O PHE A 174 AA1 6 7 O ILE A 171 ? O ILE A 171 N LEU A 158 ? N LEU A 158 AA1 7 8 O GLU A 161 ? O GLU A 161 N LYS A 141 ? N LYS A 141 AA1 8 9 O LEU A 142 ? O LEU A 142 N MET A 133 ? N MET A 133 AA2 1 2 N GLU A 115 ? N GLU A 115 O SER A 118 ? O SER A 118 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 301 ? 6 'binding site for residue GOL A 301' AC2 Software A GOL 302 ? 6 'binding site for residue GOL A 302' AC3 Software A GOL 303 ? 5 'binding site for residue GOL A 303' AC4 Software A GOL 304 ? 4 'binding site for residue GOL A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 48 ? ASP A 48 . ? 1_555 ? 2 AC1 6 PHE A 182 ? PHE A 182 . ? 1_555 ? 3 AC1 6 ALA A 217 ? ALA A 217 . ? 1_555 ? 4 AC1 6 GLN A 262 ? GLN A 262 . ? 1_555 ? 5 AC1 6 SER A 285 ? SER A 285 . ? 2_655 ? 6 AC1 6 HOH F . ? HOH A 566 . ? 1_555 ? 7 AC2 6 SER A 146 ? SER A 146 . ? 1_555 ? 8 AC2 6 GLU A 147 ? GLU A 147 . ? 1_555 ? 9 AC2 6 ASP A 148 ? ASP A 148 . ? 1_555 ? 10 AC2 6 VAL A 155 ? VAL A 155 . ? 1_555 ? 11 AC2 6 GLN A 157 ? GLN A 157 . ? 1_555 ? 12 AC2 6 GOL D . ? GOL A 303 . ? 1_555 ? 13 AC3 5 ARG A 105 ? ARG A 105 . ? 1_555 ? 14 AC3 5 LEU A 172 ? LEU A 172 . ? 1_555 ? 15 AC3 5 SER A 201 ? SER A 201 . ? 1_555 ? 16 AC3 5 GOL C . ? GOL A 302 . ? 1_555 ? 17 AC3 5 HOH F . ? HOH A 553 . ? 1_555 ? 18 AC4 4 ASP A 48 ? ASP A 48 . ? 1_555 ? 19 AC4 4 HOH F . ? HOH A 417 . ? 1_555 ? 20 AC4 4 HOH F . ? HOH A 466 . ? 1_555 ? 21 AC4 4 HOH F . ? HOH A 572 . ? 1_555 ? # _atom_sites.entry_id 6B8X _atom_sites.fract_transf_matrix[1][1] 0.011171 _atom_sites.fract_transf_matrix[1][2] 0.006449 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012899 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009412 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 HIS 208 208 208 HIS HIS A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 HIS 214 214 214 HIS HIS A . n A 1 215 CYS 215 215 215 CYS CYS A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 CYS 226 226 226 CYS CYS A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 CYS 231 231 231 CYS CYS A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 LYS 247 247 247 LYS LYS A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 MET 253 253 253 MET MET A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 MET 258 258 258 MET MET A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 GLN 262 262 262 GLN GLN A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 MET 282 282 282 MET MET A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 ASP 284 284 284 ASP ASP A . n A 1 285 SER 285 285 285 SER SER A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 GLN 288 288 288 GLN GLN A . n A 1 289 ASP 289 289 289 ASP ASP A . n A 1 290 GLN 290 290 290 GLN GLN A . n A 1 291 TRP 291 291 291 TRP TRP A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 HIS 296 296 296 HIS HIS A . n A 1 297 GLU 297 297 297 GLU GLU A . n A 1 298 ASP 298 298 298 ASP ASP A . n A 1 299 LEU 299 299 ? ? ? A . n A 1 300 GLU 300 300 ? ? ? A . n A 1 301 PRO 301 301 ? ? ? A . n A 1 302 PRO 302 302 ? ? ? A . n A 1 303 PRO 303 303 ? ? ? A . n A 1 304 GLU 304 304 ? ? ? A . n A 1 305 HIS 305 305 ? ? ? A . n A 1 306 ILE 306 306 ? ? ? A . n A 1 307 PRO 307 307 ? ? ? A . n A 1 308 PRO 308 308 ? ? ? A . n A 1 309 PRO 309 309 ? ? ? A . n A 1 310 PRO 310 310 ? ? ? A . n A 1 311 ARG 311 311 ? ? ? A . n A 1 312 PRO 312 312 ? ? ? A . n A 1 313 PRO 313 313 ? ? ? A . n A 1 314 LYS 314 314 ? ? ? A . n A 1 315 ARG 315 315 ? ? ? A . n A 1 316 ILE 316 316 ? ? ? A . n A 1 317 LEU 317 317 ? ? ? A . n A 1 318 GLU 318 318 ? ? ? A . n A 1 319 PRO 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 ASN 321 321 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 301 403 GOL GOL A . C 2 GOL 1 302 404 GOL GOL A . D 2 GOL 1 303 405 GOL GOL A . E 2 GOL 1 304 406 GOL GOL A . F 3 HOH 1 401 229 HOH HOH A . F 3 HOH 2 402 249 HOH HOH A . F 3 HOH 3 403 98 HOH HOH A . F 3 HOH 4 404 128 HOH HOH A . F 3 HOH 5 405 105 HOH HOH A . F 3 HOH 6 406 80 HOH HOH A . F 3 HOH 7 407 61 HOH HOH A . F 3 HOH 8 408 256 HOH HOH A . F 3 HOH 9 409 41 HOH HOH A . F 3 HOH 10 410 230 HOH HOH A . F 3 HOH 11 411 235 HOH HOH A . F 3 HOH 12 412 5 HOH HOH A . F 3 HOH 13 413 35 HOH HOH A . F 3 HOH 14 414 258 HOH HOH A . F 3 HOH 15 415 248 HOH HOH A . F 3 HOH 16 416 212 HOH HOH A . F 3 HOH 17 417 118 HOH HOH A . F 3 HOH 18 418 189 HOH HOH A . F 3 HOH 19 419 160 HOH HOH A . F 3 HOH 20 420 93 HOH HOH A . F 3 HOH 21 421 48 HOH HOH A . F 3 HOH 22 422 216 HOH HOH A . F 3 HOH 23 423 3 HOH HOH A . F 3 HOH 24 424 172 HOH HOH A . F 3 HOH 25 425 40 HOH HOH A . F 3 HOH 26 426 157 HOH HOH A . F 3 HOH 27 427 2 HOH HOH A . F 3 HOH 28 428 114 HOH HOH A . F 3 HOH 29 429 233 HOH HOH A . F 3 HOH 30 430 195 HOH HOH A . F 3 HOH 31 431 47 HOH HOH A . F 3 HOH 32 432 19 HOH HOH A . F 3 HOH 33 433 71 HOH HOH A . F 3 HOH 34 434 198 HOH HOH A . F 3 HOH 35 435 176 HOH HOH A . F 3 HOH 36 436 55 HOH HOH A . F 3 HOH 37 437 15 HOH HOH A . F 3 HOH 38 438 174 HOH HOH A . F 3 HOH 39 439 38 HOH HOH A . F 3 HOH 40 440 50 HOH HOH A . F 3 HOH 41 441 207 HOH HOH A . F 3 HOH 42 442 4 HOH HOH A . F 3 HOH 43 443 18 HOH HOH A . F 3 HOH 44 444 29 HOH HOH A . F 3 HOH 45 445 110 HOH HOH A . F 3 HOH 46 446 46 HOH HOH A . F 3 HOH 47 447 173 HOH HOH A . F 3 HOH 48 448 188 HOH HOH A . F 3 HOH 49 449 8 HOH HOH A . F 3 HOH 50 450 181 HOH HOH A . F 3 HOH 51 451 1 HOH HOH A . F 3 HOH 52 452 85 HOH HOH A . F 3 HOH 53 453 97 HOH HOH A . F 3 HOH 54 454 9 HOH HOH A . F 3 HOH 55 455 21 HOH HOH A . F 3 HOH 56 456 113 HOH HOH A . F 3 HOH 57 457 99 HOH HOH A . F 3 HOH 58 458 91 HOH HOH A . F 3 HOH 59 459 42 HOH HOH A . F 3 HOH 60 460 217 HOH HOH A . F 3 HOH 61 461 219 HOH HOH A . F 3 HOH 62 462 143 HOH HOH A . F 3 HOH 63 463 238 HOH HOH A . F 3 HOH 64 464 102 HOH HOH A . F 3 HOH 65 465 87 HOH HOH A . F 3 HOH 66 466 204 HOH HOH A . F 3 HOH 67 467 64 HOH HOH A . F 3 HOH 68 468 125 HOH HOH A . F 3 HOH 69 469 187 HOH HOH A . F 3 HOH 70 470 223 HOH HOH A . F 3 HOH 71 471 14 HOH HOH A . F 3 HOH 72 472 22 HOH HOH A . F 3 HOH 73 473 127 HOH HOH A . F 3 HOH 74 474 37 HOH HOH A . F 3 HOH 75 475 24 HOH HOH A . F 3 HOH 76 476 51 HOH HOH A . F 3 HOH 77 477 135 HOH HOH A . F 3 HOH 78 478 60 HOH HOH A . F 3 HOH 79 479 122 HOH HOH A . F 3 HOH 80 480 138 HOH HOH A . F 3 HOH 81 481 43 HOH HOH A . F 3 HOH 82 482 6 HOH HOH A . F 3 HOH 83 483 180 HOH HOH A . F 3 HOH 84 484 70 HOH HOH A . F 3 HOH 85 485 177 HOH HOH A . F 3 HOH 86 486 151 HOH HOH A . F 3 HOH 87 487 11 HOH HOH A . F 3 HOH 88 488 28 HOH HOH A . F 3 HOH 89 489 86 HOH HOH A . F 3 HOH 90 490 65 HOH HOH A . F 3 HOH 91 491 34 HOH HOH A . F 3 HOH 92 492 241 HOH HOH A . F 3 HOH 93 493 155 HOH HOH A . F 3 HOH 94 494 194 HOH HOH A . F 3 HOH 95 495 72 HOH HOH A . F 3 HOH 96 496 81 HOH HOH A . F 3 HOH 97 497 190 HOH HOH A . F 3 HOH 98 498 30 HOH HOH A . F 3 HOH 99 499 12 HOH HOH A . F 3 HOH 100 500 214 HOH HOH A . F 3 HOH 101 501 25 HOH HOH A . F 3 HOH 102 502 149 HOH HOH A . F 3 HOH 103 503 126 HOH HOH A . F 3 HOH 104 504 96 HOH HOH A . F 3 HOH 105 505 184 HOH HOH A . F 3 HOH 106 506 16 HOH HOH A . F 3 HOH 107 507 23 HOH HOH A . F 3 HOH 108 508 7 HOH HOH A . F 3 HOH 109 509 100 HOH HOH A . F 3 HOH 110 510 83 HOH HOH A . F 3 HOH 111 511 131 HOH HOH A . F 3 HOH 112 512 17 HOH HOH A . F 3 HOH 113 513 132 HOH HOH A . F 3 HOH 114 514 260 HOH HOH A . F 3 HOH 115 515 171 HOH HOH A . F 3 HOH 116 516 69 HOH HOH A . F 3 HOH 117 517 185 HOH HOH A . F 3 HOH 118 518 54 HOH HOH A . F 3 HOH 119 519 162 HOH HOH A . F 3 HOH 120 520 89 HOH HOH A . F 3 HOH 121 521 27 HOH HOH A . F 3 HOH 122 522 159 HOH HOH A . F 3 HOH 123 523 124 HOH HOH A . F 3 HOH 124 524 49 HOH HOH A . F 3 HOH 125 525 236 HOH HOH A . F 3 HOH 126 526 74 HOH HOH A . F 3 HOH 127 527 90 HOH HOH A . F 3 HOH 128 528 179 HOH HOH A . F 3 HOH 129 529 218 HOH HOH A . F 3 HOH 130 530 10 HOH HOH A . F 3 HOH 131 531 32 HOH HOH A . F 3 HOH 132 532 103 HOH HOH A . F 3 HOH 133 533 13 HOH HOH A . F 3 HOH 134 534 44 HOH HOH A . F 3 HOH 135 535 239 HOH HOH A . F 3 HOH 136 536 240 HOH HOH A . F 3 HOH 137 537 129 HOH HOH A . F 3 HOH 138 538 139 HOH HOH A . F 3 HOH 139 539 20 HOH HOH A . F 3 HOH 140 540 136 HOH HOH A . F 3 HOH 141 541 134 HOH HOH A . F 3 HOH 142 542 196 HOH HOH A . F 3 HOH 143 543 82 HOH HOH A . F 3 HOH 144 544 78 HOH HOH A . F 3 HOH 145 545 79 HOH HOH A . F 3 HOH 146 546 26 HOH HOH A . F 3 HOH 147 547 150 HOH HOH A . F 3 HOH 148 548 201 HOH HOH A . F 3 HOH 149 549 106 HOH HOH A . F 3 HOH 150 550 94 HOH HOH A . F 3 HOH 151 551 117 HOH HOH A . F 3 HOH 152 552 145 HOH HOH A . F 3 HOH 153 553 247 HOH HOH A . F 3 HOH 154 554 31 HOH HOH A . F 3 HOH 155 555 144 HOH HOH A . F 3 HOH 156 556 183 HOH HOH A . F 3 HOH 157 557 68 HOH HOH A . F 3 HOH 158 558 63 HOH HOH A . F 3 HOH 159 559 175 HOH HOH A . F 3 HOH 160 560 73 HOH HOH A . F 3 HOH 161 561 228 HOH HOH A . F 3 HOH 162 562 251 HOH HOH A . F 3 HOH 163 563 130 HOH HOH A . F 3 HOH 164 564 227 HOH HOH A . F 3 HOH 165 565 57 HOH HOH A . F 3 HOH 166 566 200 HOH HOH A . F 3 HOH 167 567 116 HOH HOH A . F 3 HOH 168 568 252 HOH HOH A . F 3 HOH 169 569 208 HOH HOH A . F 3 HOH 170 570 243 HOH HOH A . F 3 HOH 171 571 33 HOH HOH A . F 3 HOH 172 572 234 HOH HOH A . F 3 HOH 173 573 36 HOH HOH A . F 3 HOH 174 574 222 HOH HOH A . F 3 HOH 175 575 62 HOH HOH A . F 3 HOH 176 576 76 HOH HOH A . F 3 HOH 177 577 152 HOH HOH A . F 3 HOH 178 578 237 HOH HOH A . F 3 HOH 179 579 84 HOH HOH A . F 3 HOH 180 580 95 HOH HOH A . F 3 HOH 181 581 142 HOH HOH A . F 3 HOH 182 582 186 HOH HOH A . F 3 HOH 183 583 169 HOH HOH A . F 3 HOH 184 584 104 HOH HOH A . F 3 HOH 185 585 242 HOH HOH A . F 3 HOH 186 586 253 HOH HOH A . F 3 HOH 187 587 59 HOH HOH A . F 3 HOH 188 588 254 HOH HOH A . F 3 HOH 189 589 163 HOH HOH A . F 3 HOH 190 590 178 HOH HOH A . F 3 HOH 191 591 210 HOH HOH A . F 3 HOH 192 592 75 HOH HOH A . F 3 HOH 193 593 246 HOH HOH A . F 3 HOH 194 594 107 HOH HOH A . F 3 HOH 195 595 119 HOH HOH A . F 3 HOH 196 596 231 HOH HOH A . F 3 HOH 197 597 77 HOH HOH A . F 3 HOH 198 598 168 HOH HOH A . F 3 HOH 199 599 121 HOH HOH A . F 3 HOH 200 600 92 HOH HOH A . F 3 HOH 201 601 259 HOH HOH A . F 3 HOH 202 602 257 HOH HOH A . F 3 HOH 203 603 202 HOH HOH A . F 3 HOH 204 604 255 HOH HOH A . F 3 HOH 205 605 52 HOH HOH A . F 3 HOH 206 606 146 HOH HOH A . F 3 HOH 207 607 164 HOH HOH A . F 3 HOH 208 608 209 HOH HOH A . F 3 HOH 209 609 250 HOH HOH A . F 3 HOH 210 610 140 HOH HOH A . F 3 HOH 211 611 213 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 960 ? 1 MORE -1 ? 1 'SSA (A^2)' 13690 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-20 2 'Structure model' 1 1 2019-02-20 3 'Structure model' 1 2 2022-03-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'March 1, 2015' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 'March 1, 2015' 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 473 ? ? O A HOH 572 ? ? 2.02 2 1 O A HOH 428 ? ? O A HOH 606 ? ? 2.06 3 1 O A HOH 428 ? ? O A HOH 464 ? ? 2.09 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 121 ? A -174.61 145.82 2 1 GLN A 166 ? ? 55.92 15.82 3 1 PHE A 182 ? A 72.36 -4.17 4 1 CYS A 215 ? ? -129.74 -133.94 5 1 CYS A 215 ? ? -129.74 -131.74 6 1 ILE A 219 ? ? -133.28 -30.48 7 1 LYS A 239 ? A 39.85 46.64 8 1 ILE A 261 ? ? 75.78 107.63 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 299 ? A LEU 299 2 1 Y 1 A GLU 300 ? A GLU 300 3 1 Y 1 A PRO 301 ? A PRO 301 4 1 Y 1 A PRO 302 ? A PRO 302 5 1 Y 1 A PRO 303 ? A PRO 303 6 1 Y 1 A GLU 304 ? A GLU 304 7 1 Y 1 A HIS 305 ? A HIS 305 8 1 Y 1 A ILE 306 ? A ILE 306 9 1 Y 1 A PRO 307 ? A PRO 307 10 1 Y 1 A PRO 308 ? A PRO 308 11 1 Y 1 A PRO 309 ? A PRO 309 12 1 Y 1 A PRO 310 ? A PRO 310 13 1 Y 1 A ARG 311 ? A ARG 311 14 1 Y 1 A PRO 312 ? A PRO 312 15 1 Y 1 A PRO 313 ? A PRO 313 16 1 Y 1 A LYS 314 ? A LYS 314 17 1 Y 1 A ARG 315 ? A ARG 315 18 1 Y 1 A ILE 316 ? A ILE 316 19 1 Y 1 A LEU 317 ? A LEU 317 20 1 Y 1 A GLU 318 ? A GLU 318 21 1 Y 1 A PRO 319 ? A PRO 319 22 1 Y 1 A HIS 320 ? A HIS 320 23 1 Y 1 A ASN 321 ? A ASN 321 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #