data_6BIK # _entry.id 6BIK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.305 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6BIK WWPDB D_1000230916 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 6BKE PDB . unspecified 6BKH PDB . unspecified 6BKW PDB . unspecified 6BLN PDB . unspecified 6AUA PDB . unspecified 6AUB PDB . unspecified 6EP9 PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BIK _pdbx_database_status.recvd_initial_deposition_date 2017-11-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kiefer, J.R.' 1 ? 'Eigenbrot, C.' 2 ? 'Yu, C.L.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Comput. Aided Mol. Des.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1573-4951 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 33 _citation.language ? _citation.page_first 307 _citation.page_last 330 _citation.title 'Water molecules in protein-ligand interfaces. Evaluation of software tools and SAR comparison.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s10822-019-00187-y _citation.pdbx_database_id_PubMed 30756207 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nittinger, E.' 1 ? primary 'Gibbons, P.' 2 ? primary 'Eigenbrot, C.' 3 ? primary 'Davies, D.R.' 4 ? primary 'Maurer, B.' 5 ? primary 'Yu, C.L.' 6 ? primary 'Kiefer, J.R.' 7 ? primary 'Kuglstatter, A.' 8 ? primary 'Murray, J.' 9 ? primary 'Ortwine, D.F.' 10 ? primary 'Tang, Y.' 11 ? primary 'Tsui, V.' 12 ? # _cell.entry_id 6BIK _cell.length_a 108.016 _cell.length_b 108.016 _cell.length_c 41.631 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BIK _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase BTK' 33878.723 1 2.7.10.2 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 non-polymer syn ;4-tert-butyl-N-[2-(hydroxymethyl)-3-(1-methyl-5-{[5-(morpholine-4-carbonyl)pyridin-2-yl]amino}-6-oxo-1,6-dihydropyridazin-3-yl)phenyl]benzamide ; 596.676 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 171 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Agammaglobulinemia tyrosine kinase,ATK,B-cell progenitor kinase,BPK,Bruton tyrosine kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIF IITEYMANG(OCS)LLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVL DDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVY TIMYSCWHEKADERPTFKILLSNILDVMDENLYFQGEEYMPTEHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIF IITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEY TSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMY SCWHEKADERPTFKILLSNILDVMDENLYFQGEEYMPTEHHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 TRP n 1 5 GLU n 1 6 ILE n 1 7 ASP n 1 8 PRO n 1 9 LYS n 1 10 ASP n 1 11 LEU n 1 12 THR n 1 13 PHE n 1 14 LEU n 1 15 LYS n 1 16 GLU n 1 17 LEU n 1 18 GLY n 1 19 THR n 1 20 GLY n 1 21 GLN n 1 22 PHE n 1 23 GLY n 1 24 VAL n 1 25 VAL n 1 26 LYS n 1 27 TYR n 1 28 GLY n 1 29 LYS n 1 30 TRP n 1 31 ARG n 1 32 GLY n 1 33 GLN n 1 34 TYR n 1 35 ASP n 1 36 VAL n 1 37 ALA n 1 38 ILE n 1 39 LYS n 1 40 MET n 1 41 ILE n 1 42 LYS n 1 43 GLU n 1 44 GLY n 1 45 SER n 1 46 MET n 1 47 SER n 1 48 GLU n 1 49 ASP n 1 50 GLU n 1 51 PHE n 1 52 ILE n 1 53 GLU n 1 54 GLU n 1 55 ALA n 1 56 LYS n 1 57 VAL n 1 58 MET n 1 59 MET n 1 60 ASN n 1 61 LEU n 1 62 SER n 1 63 HIS n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 VAL n 1 68 GLN n 1 69 LEU n 1 70 TYR n 1 71 GLY n 1 72 VAL n 1 73 CYS n 1 74 THR n 1 75 LYS n 1 76 GLN n 1 77 ARG n 1 78 PRO n 1 79 ILE n 1 80 PHE n 1 81 ILE n 1 82 ILE n 1 83 THR n 1 84 GLU n 1 85 TYR n 1 86 MET n 1 87 ALA n 1 88 ASN n 1 89 GLY n 1 90 OCS n 1 91 LEU n 1 92 LEU n 1 93 ASN n 1 94 TYR n 1 95 LEU n 1 96 ARG n 1 97 GLU n 1 98 MET n 1 99 ARG n 1 100 HIS n 1 101 ARG n 1 102 PHE n 1 103 GLN n 1 104 THR n 1 105 GLN n 1 106 GLN n 1 107 LEU n 1 108 LEU n 1 109 GLU n 1 110 MET n 1 111 CYS n 1 112 LYS n 1 113 ASP n 1 114 VAL n 1 115 CYS n 1 116 GLU n 1 117 ALA n 1 118 MET n 1 119 GLU n 1 120 TYR n 1 121 LEU n 1 122 GLU n 1 123 SER n 1 124 LYS n 1 125 GLN n 1 126 PHE n 1 127 LEU n 1 128 HIS n 1 129 ARG n 1 130 ASP n 1 131 LEU n 1 132 ALA n 1 133 ALA n 1 134 ARG n 1 135 ASN n 1 136 CYS n 1 137 LEU n 1 138 VAL n 1 139 ASN n 1 140 ASP n 1 141 GLN n 1 142 GLY n 1 143 VAL n 1 144 VAL n 1 145 LYS n 1 146 VAL n 1 147 SER n 1 148 ASP n 1 149 PHE n 1 150 GLY n 1 151 LEU n 1 152 SER n 1 153 ARG n 1 154 TYR n 1 155 VAL n 1 156 LEU n 1 157 ASP n 1 158 ASP n 1 159 GLU n 1 160 TYR n 1 161 THR n 1 162 SER n 1 163 SER n 1 164 VAL n 1 165 GLY n 1 166 SER n 1 167 LYS n 1 168 PHE n 1 169 PRO n 1 170 VAL n 1 171 ARG n 1 172 TRP n 1 173 SER n 1 174 PRO n 1 175 PRO n 1 176 GLU n 1 177 VAL n 1 178 LEU n 1 179 MET n 1 180 TYR n 1 181 SER n 1 182 LYS n 1 183 PHE n 1 184 SER n 1 185 SER n 1 186 LYS n 1 187 SER n 1 188 ASP n 1 189 ILE n 1 190 TRP n 1 191 ALA n 1 192 PHE n 1 193 GLY n 1 194 VAL n 1 195 LEU n 1 196 MET n 1 197 TRP n 1 198 GLU n 1 199 ILE n 1 200 TYR n 1 201 SER n 1 202 LEU n 1 203 GLY n 1 204 LYS n 1 205 MET n 1 206 PRO n 1 207 TYR n 1 208 GLU n 1 209 ARG n 1 210 PHE n 1 211 THR n 1 212 ASN n 1 213 SER n 1 214 GLU n 1 215 THR n 1 216 ALA n 1 217 GLU n 1 218 HIS n 1 219 ILE n 1 220 ALA n 1 221 GLN n 1 222 GLY n 1 223 LEU n 1 224 ARG n 1 225 LEU n 1 226 TYR n 1 227 ARG n 1 228 PRO n 1 229 HIS n 1 230 LEU n 1 231 ALA n 1 232 SER n 1 233 GLU n 1 234 LYS n 1 235 VAL n 1 236 TYR n 1 237 THR n 1 238 ILE n 1 239 MET n 1 240 TYR n 1 241 SER n 1 242 CYS n 1 243 TRP n 1 244 HIS n 1 245 GLU n 1 246 LYS n 1 247 ALA n 1 248 ASP n 1 249 GLU n 1 250 ARG n 1 251 PRO n 1 252 THR n 1 253 PHE n 1 254 LYS n 1 255 ILE n 1 256 LEU n 1 257 LEU n 1 258 SER n 1 259 ASN n 1 260 ILE n 1 261 LEU n 1 262 ASP n 1 263 VAL n 1 264 MET n 1 265 ASP n 1 266 GLU n 1 267 ASN n 1 268 LEU n 1 269 TYR n 1 270 PHE n 1 271 GLN n 1 272 GLY n 1 273 GLU n 1 274 GLU n 1 275 TYR n 1 276 MET n 1 277 PRO n 1 278 THR n 1 279 GLU n 1 280 HIS n 1 281 HIS n 1 282 HIS n 1 283 HIS n 1 284 HIS n 1 285 HIS n 1 286 HIS n 1 287 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 287 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BTK, AGMX1, ATK, BPK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BTK_HUMAN _struct_ref.pdbx_db_accession Q06187 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFI ITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYT SSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYS CWHEKADERPTFKILLSNILDVMDE ; _struct_ref.pdbx_align_begin 393 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BIK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 266 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q06187 _struct_ref_seq.db_align_beg 393 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 657 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 393 _struct_ref_seq.pdbx_auth_seq_align_end 657 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6BIK MET A 1 ? UNP Q06187 ? ? 'initiating methionine' 392 1 1 6BIK ASN A 267 ? UNP Q06187 ? ? 'expression tag' 658 2 1 6BIK LEU A 268 ? UNP Q06187 ? ? 'expression tag' 659 3 1 6BIK TYR A 269 ? UNP Q06187 ? ? 'expression tag' 660 4 1 6BIK PHE A 270 ? UNP Q06187 ? ? 'expression tag' 661 5 1 6BIK GLN A 271 ? UNP Q06187 ? ? 'expression tag' 662 6 1 6BIK GLY A 272 ? UNP Q06187 ? ? 'expression tag' 663 7 1 6BIK GLU A 273 ? UNP Q06187 ? ? 'expression tag' 664 8 1 6BIK GLU A 274 ? UNP Q06187 ? ? 'expression tag' 665 9 1 6BIK TYR A 275 ? UNP Q06187 ? ? 'expression tag' 666 10 1 6BIK MET A 276 ? UNP Q06187 ? ? 'expression tag' 667 11 1 6BIK PRO A 277 ? UNP Q06187 ? ? 'expression tag' 668 12 1 6BIK THR A 278 ? UNP Q06187 ? ? 'expression tag' 669 13 1 6BIK GLU A 279 ? UNP Q06187 ? ? 'expression tag' 670 14 1 6BIK HIS A 280 ? UNP Q06187 ? ? 'expression tag' 671 15 1 6BIK HIS A 281 ? UNP Q06187 ? ? 'expression tag' 672 16 1 6BIK HIS A 282 ? UNP Q06187 ? ? 'expression tag' 673 17 1 6BIK HIS A 283 ? UNP Q06187 ? ? 'expression tag' 674 18 1 6BIK HIS A 284 ? UNP Q06187 ? ? 'expression tag' 675 19 1 6BIK HIS A 285 ? UNP Q06187 ? ? 'expression tag' 676 20 1 6BIK HIS A 286 ? UNP Q06187 ? ? 'expression tag' 677 21 1 6BIK HIS A 287 ? UNP Q06187 ? ? 'expression tag' 678 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DTJ non-polymer . ;4-tert-butyl-N-[2-(hydroxymethyl)-3-(1-methyl-5-{[5-(morpholine-4-carbonyl)pyridin-2-yl]amino}-6-oxo-1,6-dihydropyridazin-3-yl)phenyl]benzamide ; ? 'C33 H36 N6 O5' 596.676 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ? 'C3 H7 N O5 S' 169.156 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BIK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.07 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 10000, Li2SO4, pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-08-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL7-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL7-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 23.020 _reflns.entry_id 6BIK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 40.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20603 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.000 _reflns.pdbx_Rmerge_I_obs 0.099 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.010 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.113 _reflns.pdbx_Rpim_I_all 0.053 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.900 1.930 ? ? ? ? ? ? 661 61.200 ? ? ? ? 0.495 ? ? ? ? ? ? ? ? 2.100 ? 0.710 ? ? 0.623 0.370 ? 1 1 0.538 ? 1.930 1.970 ? ? ? ? ? ? 763 68.800 ? ? ? ? 0.427 ? ? ? ? ? ? ? ? 2.200 ? 0.687 ? ? 0.534 0.314 ? 2 1 0.647 ? 1.970 2.010 ? ? ? ? ? ? 877 81.100 ? ? ? ? 0.428 ? ? ? ? ? ? ? ? 2.500 ? 0.755 ? ? 0.526 0.298 ? 3 1 0.657 ? 2.010 2.050 ? ? ? ? ? ? 955 87.300 ? ? ? ? 0.416 ? ? ? ? ? ? ? ? 2.600 ? 0.741 ? ? 0.512 0.292 ? 4 1 0.693 ? 2.050 2.090 ? ? ? ? ? ? 1032 92.300 ? ? ? ? 0.359 ? ? ? ? ? ? ? ? 3.000 ? 0.777 ? ? 0.433 0.236 ? 5 1 0.793 ? 2.090 2.140 ? ? ? ? ? ? 1072 97.800 ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 3.200 ? 0.858 ? ? 0.400 0.211 ? 6 1 0.858 ? 2.140 2.190 ? ? ? ? ? ? 1028 94.200 ? ? ? ? 0.340 ? ? ? ? ? ? ? ? 3.600 ? 0.834 ? ? 0.399 0.204 ? 7 1 0.851 ? 2.190 2.250 ? ? ? ? ? ? 1091 99.500 ? ? ? ? 0.321 ? ? ? ? ? ? ? ? 3.900 ? 0.914 ? ? 0.371 0.182 ? 8 1 0.880 ? 2.250 2.320 ? ? ? ? ? ? 1054 95.600 ? ? ? ? 0.312 ? ? ? ? ? ? ? ? 4.200 ? 0.935 ? ? 0.357 0.170 ? 9 1 0.894 ? 2.320 2.390 ? ? ? ? ? ? 1083 99.600 ? ? ? ? 0.294 ? ? ? ? ? ? ? ? 4.400 ? 0.951 ? ? 0.335 0.158 ? 10 1 0.920 ? 2.390 2.480 ? ? ? ? ? ? 1064 96.400 ? ? ? ? 0.262 ? ? ? ? ? ? ? ? 4.500 ? 1.007 ? ? 0.296 0.136 ? 11 1 0.936 ? 2.480 2.580 ? ? ? ? ? ? 1107 98.700 ? ? ? ? 0.231 ? ? ? ? ? ? ? ? 4.600 ? 1.004 ? ? 0.261 0.119 ? 12 1 0.956 ? 2.580 2.700 ? ? ? ? ? ? 1068 98.500 ? ? ? ? 0.198 ? ? ? ? ? ? ? ? 4.700 ? 1.079 ? ? 0.223 0.101 ? 13 1 0.973 ? 2.700 2.840 ? ? ? ? ? ? 1095 98.100 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 4.700 ? 1.113 ? ? 0.186 0.084 ? 14 1 0.980 ? 2.840 3.020 ? ? ? ? ? ? 1084 98.500 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 4.700 ? 1.147 ? ? 0.146 0.066 ? 15 1 0.986 ? 3.020 3.250 ? ? ? ? ? ? 1108 98.800 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 4.800 ? 1.093 ? ? 0.104 0.046 ? 16 1 0.993 ? 3.250 3.580 ? ? ? ? ? ? 1084 99.100 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 4.800 ? 1.107 ? ? 0.076 0.034 ? 17 1 0.996 ? 3.580 4.090 ? ? ? ? ? ? 1116 99.300 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 4.900 ? 1.102 ? ? 0.059 0.026 ? 18 1 0.998 ? 4.090 5.150 ? ? ? ? ? ? 1099 97.200 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 4.900 ? 1.229 ? ? 0.053 0.024 ? 19 1 0.998 ? 5.150 40.000 ? ? ? ? ? ? 1162 98.800 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 4.700 ? 1.024 ? ? 0.046 0.021 ? 20 1 0.998 ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 6BIK _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 20598 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 35.357 _refine.ls_d_res_high 1.901 _refine.ls_percent_reflns_obs 93.16 _refine.ls_R_factor_obs 0.1639 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1609 _refine.ls_R_factor_R_free 0.2224 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.14 _refine.ls_number_reflns_R_free 1058 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.20 _refine.pdbx_overall_phase_error 20.56 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2138 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 65 _refine_hist.number_atoms_solvent 171 _refine_hist.number_atoms_total 2374 _refine_hist.d_res_high 1.901 _refine_hist.d_res_low 35.357 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.006 ? ? 2293 'X-RAY DIFFRACTION' ? f_angle_d 0.863 ? ? 3108 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 18.914 ? ? 1347 'X-RAY DIFFRACTION' ? f_chiral_restr 0.047 ? ? 322 'X-RAY DIFFRACTION' ? f_plane_restr 0.004 ? ? 395 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.9005 1.9870 1759 0.2424 67.00 0.2580 . . 85 . . 'X-RAY DIFFRACTION' . 1.9870 2.0918 2292 0.2042 89.00 0.2886 . . 152 . . 'X-RAY DIFFRACTION' . 2.0918 2.2228 2499 0.1879 97.00 0.2438 . . 143 . . 'X-RAY DIFFRACTION' . 2.2228 2.3944 2545 0.1801 98.00 0.2298 . . 141 . . 'X-RAY DIFFRACTION' . 2.3944 2.6353 2550 0.1650 98.00 0.2236 . . 150 . . 'X-RAY DIFFRACTION' . 2.6353 3.0165 2562 0.1622 99.00 0.2272 . . 154 . . 'X-RAY DIFFRACTION' . 3.0165 3.7997 2642 0.1418 99.00 0.2272 . . 114 . . 'X-RAY DIFFRACTION' . 3.7997 35.3626 2691 0.1423 99.00 0.1789 . . 119 . . # _struct.entry_id 6BIK _struct.title 'BTK complex with compound 7' _struct.pdbx_descriptor 'Tyrosine-protein kinase BTK (E.C.2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BIK _struct_keywords.text 'BTK, inhibitor, water structure, kinase, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 2 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 7 ? LYS A 9 ? ASP A 398 LYS A 400 5 ? 3 HELX_P HELX_P2 AA2 SER A 47 ? GLU A 54 ? SER A 438 GLU A 445 1 ? 8 HELX_P HELX_P3 AA3 GLU A 54 ? LEU A 61 ? GLU A 445 LEU A 452 1 ? 8 HELX_P HELX_P4 AA4 OCS A 90 ? MET A 98 ? OCS A 481 MET A 489 1 ? 9 HELX_P HELX_P5 AA5 GLN A 103 ? LYS A 124 ? GLN A 494 LYS A 515 1 ? 22 HELX_P HELX_P6 AA6 ALA A 132 ? ARG A 134 ? ALA A 523 ARG A 525 5 ? 3 HELX_P HELX_P7 AA7 GLY A 150 ? VAL A 155 ? GLY A 541 VAL A 546 5 ? 6 HELX_P HELX_P8 AA8 ASP A 157 ? SER A 162 ? ASP A 548 SER A 553 1 ? 6 HELX_P HELX_P9 AA9 PRO A 169 ? SER A 173 ? PRO A 560 SER A 564 5 ? 5 HELX_P HELX_P10 AB1 PRO A 174 ? SER A 181 ? PRO A 565 SER A 572 1 ? 8 HELX_P HELX_P11 AB2 SER A 184 ? SER A 201 ? SER A 575 SER A 592 1 ? 18 HELX_P HELX_P12 AB3 THR A 211 ? GLN A 221 ? THR A 602 GLN A 612 1 ? 11 HELX_P HELX_P13 AB4 SER A 232 ? CYS A 242 ? SER A 623 CYS A 633 1 ? 11 HELX_P HELX_P14 AB5 LYS A 246 ? ARG A 250 ? LYS A 637 ARG A 641 5 ? 5 HELX_P HELX_P15 AB6 THR A 252 ? ASN A 267 ? THR A 643 ASN A 658 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A GLY 89 C ? ? ? 1_555 A OCS 90 N ? ? A GLY 480 A OCS 481 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale both ? A OCS 90 C ? ? ? 1_555 A LEU 91 N ? ? A OCS 481 A LEU 482 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 77 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 468 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 78 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 469 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.10 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 11 ? GLY A 20 ? LEU A 402 GLY A 411 AA1 2 GLY A 23 ? TRP A 30 ? GLY A 414 TRP A 421 AA1 3 TYR A 34 ? MET A 40 ? TYR A 425 MET A 431 AA1 4 PHE A 80 ? GLU A 84 ? PHE A 471 GLU A 475 AA1 5 LEU A 69 ? CYS A 73 ? LEU A 460 CYS A 464 AA2 1 CYS A 136 ? VAL A 138 ? CYS A 527 VAL A 529 AA2 2 VAL A 144 ? VAL A 146 ? VAL A 535 VAL A 537 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 15 ? N LYS A 406 O TYR A 27 ? O TYR A 418 AA1 2 3 N LYS A 26 ? N LYS A 417 O ILE A 38 ? O ILE A 429 AA1 3 4 N LYS A 39 ? N LYS A 430 O ILE A 81 ? O ILE A 472 AA1 4 5 O ILE A 82 ? O ILE A 473 N GLY A 71 ? N GLY A 462 AA2 1 2 N LEU A 137 ? N LEU A 528 O LYS A 145 ? O LYS A 536 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 701 ? 7 'binding site for residue SO4 A 701' AC2 Software A SO4 702 ? 6 'binding site for residue SO4 A 702' AC3 Software A DTJ 703 ? 20 'binding site for residue DTJ A 703' AC4 Software A SO4 704 ? 3 'binding site for residue SO4 A 704' AC5 Software A GOL 705 ? 5 'binding site for residue GOL A 705' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 SER A 201 ? SER A 592 . ? 1_555 ? 2 AC1 7 LYS A 204 ? LYS A 595 . ? 1_555 ? 3 AC1 7 TYR A 226 ? TYR A 617 . ? 1_555 ? 4 AC1 7 PRO A 228 ? PRO A 619 . ? 1_555 ? 5 AC1 7 HIS A 229 ? HIS A 620 . ? 1_555 ? 6 AC1 7 HOH G . ? HOH A 802 . ? 1_555 ? 7 AC1 7 HOH G . ? HOH A 822 . ? 1_555 ? 8 AC2 6 LYS A 75 ? LYS A 466 . ? 3_754 ? 9 AC2 6 ARG A 96 ? ARG A 487 . ? 1_555 ? 10 AC2 6 ARG A 99 ? ARG A 490 . ? 1_555 ? 11 AC2 6 LYS A 204 ? LYS A 595 . ? 1_555 ? 12 AC2 6 HOH G . ? HOH A 816 . ? 1_555 ? 13 AC2 6 HOH G . ? HOH A 897 . ? 6_545 ? 14 AC3 20 LEU A 17 ? LEU A 408 . ? 1_555 ? 15 AC3 20 VAL A 25 ? VAL A 416 . ? 1_555 ? 16 AC3 20 ALA A 37 ? ALA A 428 . ? 1_555 ? 17 AC3 20 LYS A 39 ? LYS A 430 . ? 1_555 ? 18 AC3 20 THR A 83 ? THR A 474 . ? 1_555 ? 19 AC3 20 GLU A 84 ? GLU A 475 . ? 1_555 ? 20 AC3 20 TYR A 85 ? TYR A 476 . ? 1_555 ? 21 AC3 20 MET A 86 ? MET A 477 . ? 1_555 ? 22 AC3 20 ALA A 87 ? ALA A 478 . ? 1_555 ? 23 AC3 20 GLY A 89 ? GLY A 480 . ? 1_555 ? 24 AC3 20 ASP A 130 ? ASP A 521 . ? 1_555 ? 25 AC3 20 ASN A 135 ? ASN A 526 . ? 1_555 ? 26 AC3 20 LEU A 137 ? LEU A 528 . ? 1_555 ? 27 AC3 20 ASP A 148 ? ASP A 539 . ? 1_555 ? 28 AC3 20 VAL A 155 ? VAL A 546 . ? 1_555 ? 29 AC3 20 TYR A 160 ? TYR A 551 . ? 1_555 ? 30 AC3 20 HOH G . ? HOH A 871 . ? 1_555 ? 31 AC3 20 HOH G . ? HOH A 879 . ? 1_555 ? 32 AC3 20 HOH G . ? HOH A 885 . ? 1_555 ? 33 AC3 20 HOH G . ? HOH A 898 . ? 1_555 ? 34 AC4 3 ARG A 99 ? ARG A 490 . ? 1_555 ? 35 AC4 3 HIS A 100 ? HIS A 491 . ? 1_555 ? 36 AC4 3 LYS A 246 ? LYS A 637 . ? 1_554 ? 37 AC5 5 HIS A 244 ? HIS A 635 . ? 1_555 ? 38 AC5 5 GLU A 245 ? GLU A 636 . ? 1_555 ? 39 AC5 5 LYS A 246 ? LYS A 637 . ? 1_555 ? 40 AC5 5 GLU A 249 ? GLU A 640 . ? 1_555 ? 41 AC5 5 HOH G . ? HOH A 930 . ? 1_555 ? # _atom_sites.entry_id 6BIK _atom_sites.fract_transf_matrix[1][1] 0.009258 _atom_sites.fract_transf_matrix[1][2] 0.005345 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010690 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024021 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 392 ? ? ? A . n A 1 2 GLY 2 393 ? ? ? A . n A 1 3 SER 3 394 ? ? ? A . n A 1 4 TRP 4 395 395 TRP TRP A . n A 1 5 GLU 5 396 396 GLU GLU A . n A 1 6 ILE 6 397 397 ILE ILE A . n A 1 7 ASP 7 398 398 ASP ASP A . n A 1 8 PRO 8 399 399 PRO PRO A . n A 1 9 LYS 9 400 400 LYS LYS A . n A 1 10 ASP 10 401 401 ASP ASP A . n A 1 11 LEU 11 402 402 LEU LEU A . n A 1 12 THR 12 403 403 THR THR A . n A 1 13 PHE 13 404 404 PHE PHE A . n A 1 14 LEU 14 405 405 LEU LEU A . n A 1 15 LYS 15 406 406 LYS LYS A . n A 1 16 GLU 16 407 407 GLU GLU A . n A 1 17 LEU 17 408 408 LEU LEU A . n A 1 18 GLY 18 409 409 GLY GLY A . n A 1 19 THR 19 410 410 THR THR A . n A 1 20 GLY 20 411 411 GLY GLY A . n A 1 21 GLN 21 412 412 GLN GLN A . n A 1 22 PHE 22 413 413 PHE PHE A . n A 1 23 GLY 23 414 414 GLY GLY A . n A 1 24 VAL 24 415 415 VAL VAL A . n A 1 25 VAL 25 416 416 VAL VAL A . n A 1 26 LYS 26 417 417 LYS LYS A . n A 1 27 TYR 27 418 418 TYR TYR A . n A 1 28 GLY 28 419 419 GLY GLY A . n A 1 29 LYS 29 420 420 LYS LYS A . n A 1 30 TRP 30 421 421 TRP TRP A . n A 1 31 ARG 31 422 422 ARG ARG A . n A 1 32 GLY 32 423 423 GLY GLY A . n A 1 33 GLN 33 424 424 GLN GLN A . n A 1 34 TYR 34 425 425 TYR TYR A . n A 1 35 ASP 35 426 426 ASP ASP A . n A 1 36 VAL 36 427 427 VAL VAL A . n A 1 37 ALA 37 428 428 ALA ALA A . n A 1 38 ILE 38 429 429 ILE ILE A . n A 1 39 LYS 39 430 430 LYS LYS A . n A 1 40 MET 40 431 431 MET MET A . n A 1 41 ILE 41 432 432 ILE ILE A . n A 1 42 LYS 42 433 433 LYS LYS A . n A 1 43 GLU 43 434 434 GLU GLU A . n A 1 44 GLY 44 435 435 GLY GLY A . n A 1 45 SER 45 436 436 SER SER A . n A 1 46 MET 46 437 437 MET MET A . n A 1 47 SER 47 438 438 SER SER A . n A 1 48 GLU 48 439 439 GLU GLU A . n A 1 49 ASP 49 440 440 ASP ASP A . n A 1 50 GLU 50 441 441 GLU GLU A . n A 1 51 PHE 51 442 442 PHE PHE A . n A 1 52 ILE 52 443 443 ILE ILE A . n A 1 53 GLU 53 444 444 GLU GLU A . n A 1 54 GLU 54 445 445 GLU GLU A . n A 1 55 ALA 55 446 446 ALA ALA A . n A 1 56 LYS 56 447 447 LYS LYS A . n A 1 57 VAL 57 448 448 VAL VAL A . n A 1 58 MET 58 449 449 MET MET A . n A 1 59 MET 59 450 450 MET MET A . n A 1 60 ASN 60 451 451 ASN ASN A . n A 1 61 LEU 61 452 452 LEU LEU A . n A 1 62 SER 62 453 453 SER SER A . n A 1 63 HIS 63 454 454 HIS HIS A . n A 1 64 GLU 64 455 455 GLU GLU A . n A 1 65 LYS 65 456 456 LYS LYS A . n A 1 66 LEU 66 457 457 LEU LEU A . n A 1 67 VAL 67 458 458 VAL VAL A . n A 1 68 GLN 68 459 459 GLN GLN A . n A 1 69 LEU 69 460 460 LEU LEU A . n A 1 70 TYR 70 461 461 TYR TYR A . n A 1 71 GLY 71 462 462 GLY GLY A . n A 1 72 VAL 72 463 463 VAL VAL A . n A 1 73 CYS 73 464 464 CYS CYS A . n A 1 74 THR 74 465 465 THR THR A . n A 1 75 LYS 75 466 466 LYS LYS A . n A 1 76 GLN 76 467 467 GLN GLN A . n A 1 77 ARG 77 468 468 ARG ARG A . n A 1 78 PRO 78 469 469 PRO PRO A . n A 1 79 ILE 79 470 470 ILE ILE A . n A 1 80 PHE 80 471 471 PHE PHE A . n A 1 81 ILE 81 472 472 ILE ILE A . n A 1 82 ILE 82 473 473 ILE ILE A . n A 1 83 THR 83 474 474 THR THR A . n A 1 84 GLU 84 475 475 GLU GLU A . n A 1 85 TYR 85 476 476 TYR TYR A . n A 1 86 MET 86 477 477 MET MET A . n A 1 87 ALA 87 478 478 ALA ALA A . n A 1 88 ASN 88 479 479 ASN ASN A . n A 1 89 GLY 89 480 480 GLY GLY A . n A 1 90 OCS 90 481 481 OCS OCS A . n A 1 91 LEU 91 482 482 LEU LEU A . n A 1 92 LEU 92 483 483 LEU LEU A . n A 1 93 ASN 93 484 484 ASN ASN A . n A 1 94 TYR 94 485 485 TYR TYR A . n A 1 95 LEU 95 486 486 LEU LEU A . n A 1 96 ARG 96 487 487 ARG ARG A . n A 1 97 GLU 97 488 488 GLU GLU A . n A 1 98 MET 98 489 489 MET MET A . n A 1 99 ARG 99 490 490 ARG ARG A . n A 1 100 HIS 100 491 491 HIS HIS A . n A 1 101 ARG 101 492 492 ARG ARG A . n A 1 102 PHE 102 493 493 PHE PHE A . n A 1 103 GLN 103 494 494 GLN GLN A . n A 1 104 THR 104 495 495 THR THR A . n A 1 105 GLN 105 496 496 GLN GLN A . n A 1 106 GLN 106 497 497 GLN GLN A . n A 1 107 LEU 107 498 498 LEU LEU A . n A 1 108 LEU 108 499 499 LEU LEU A . n A 1 109 GLU 109 500 500 GLU GLU A . n A 1 110 MET 110 501 501 MET MET A . n A 1 111 CYS 111 502 502 CYS CYS A . n A 1 112 LYS 112 503 503 LYS LYS A . n A 1 113 ASP 113 504 504 ASP ASP A . n A 1 114 VAL 114 505 505 VAL VAL A . n A 1 115 CYS 115 506 506 CYS CYS A . n A 1 116 GLU 116 507 507 GLU GLU A . n A 1 117 ALA 117 508 508 ALA ALA A . n A 1 118 MET 118 509 509 MET MET A . n A 1 119 GLU 119 510 510 GLU GLU A . n A 1 120 TYR 120 511 511 TYR TYR A . n A 1 121 LEU 121 512 512 LEU LEU A . n A 1 122 GLU 122 513 513 GLU GLU A . n A 1 123 SER 123 514 514 SER SER A . n A 1 124 LYS 124 515 515 LYS LYS A . n A 1 125 GLN 125 516 516 GLN GLN A . n A 1 126 PHE 126 517 517 PHE PHE A . n A 1 127 LEU 127 518 518 LEU LEU A . n A 1 128 HIS 128 519 519 HIS HIS A . n A 1 129 ARG 129 520 520 ARG ARG A . n A 1 130 ASP 130 521 521 ASP ASP A . n A 1 131 LEU 131 522 522 LEU LEU A . n A 1 132 ALA 132 523 523 ALA ALA A . n A 1 133 ALA 133 524 524 ALA ALA A . n A 1 134 ARG 134 525 525 ARG ARG A . n A 1 135 ASN 135 526 526 ASN ASN A . n A 1 136 CYS 136 527 527 CYS CYS A . n A 1 137 LEU 137 528 528 LEU LEU A . n A 1 138 VAL 138 529 529 VAL VAL A . n A 1 139 ASN 139 530 530 ASN ASN A . n A 1 140 ASP 140 531 531 ASP ASP A . n A 1 141 GLN 141 532 532 GLN GLN A . n A 1 142 GLY 142 533 533 GLY GLY A . n A 1 143 VAL 143 534 534 VAL VAL A . n A 1 144 VAL 144 535 535 VAL VAL A . n A 1 145 LYS 145 536 536 LYS LYS A . n A 1 146 VAL 146 537 537 VAL VAL A . n A 1 147 SER 147 538 538 SER SER A . n A 1 148 ASP 148 539 539 ASP ASP A . n A 1 149 PHE 149 540 540 PHE PHE A . n A 1 150 GLY 150 541 541 GLY GLY A . n A 1 151 LEU 151 542 542 LEU LEU A . n A 1 152 SER 152 543 543 SER SER A . n A 1 153 ARG 153 544 544 ARG ARG A . n A 1 154 TYR 154 545 545 TYR TYR A . n A 1 155 VAL 155 546 546 VAL VAL A . n A 1 156 LEU 156 547 547 LEU LEU A . n A 1 157 ASP 157 548 548 ASP ASP A . n A 1 158 ASP 158 549 549 ASP ASP A . n A 1 159 GLU 159 550 550 GLU GLU A . n A 1 160 TYR 160 551 551 TYR TYR A . n A 1 161 THR 161 552 552 THR THR A . n A 1 162 SER 162 553 553 SER SER A . n A 1 163 SER 163 554 554 SER SER A . n A 1 164 VAL 164 555 555 VAL VAL A . n A 1 165 GLY 165 556 556 GLY GLY A . n A 1 166 SER 166 557 557 SER SER A . n A 1 167 LYS 167 558 558 LYS LYS A . n A 1 168 PHE 168 559 559 PHE PHE A . n A 1 169 PRO 169 560 560 PRO PRO A . n A 1 170 VAL 170 561 561 VAL VAL A . n A 1 171 ARG 171 562 562 ARG ARG A . n A 1 172 TRP 172 563 563 TRP TRP A . n A 1 173 SER 173 564 564 SER SER A . n A 1 174 PRO 174 565 565 PRO PRO A . n A 1 175 PRO 175 566 566 PRO PRO A . n A 1 176 GLU 176 567 567 GLU GLU A . n A 1 177 VAL 177 568 568 VAL VAL A . n A 1 178 LEU 178 569 569 LEU LEU A . n A 1 179 MET 179 570 570 MET MET A . n A 1 180 TYR 180 571 571 TYR TYR A . n A 1 181 SER 181 572 572 SER SER A . n A 1 182 LYS 182 573 573 LYS LYS A . n A 1 183 PHE 183 574 574 PHE PHE A . n A 1 184 SER 184 575 575 SER SER A . n A 1 185 SER 185 576 576 SER SER A . n A 1 186 LYS 186 577 577 LYS LYS A . n A 1 187 SER 187 578 578 SER SER A . n A 1 188 ASP 188 579 579 ASP ASP A . n A 1 189 ILE 189 580 580 ILE ILE A . n A 1 190 TRP 190 581 581 TRP TRP A . n A 1 191 ALA 191 582 582 ALA ALA A . n A 1 192 PHE 192 583 583 PHE PHE A . n A 1 193 GLY 193 584 584 GLY GLY A . n A 1 194 VAL 194 585 585 VAL VAL A . n A 1 195 LEU 195 586 586 LEU LEU A . n A 1 196 MET 196 587 587 MET MET A . n A 1 197 TRP 197 588 588 TRP TRP A . n A 1 198 GLU 198 589 589 GLU GLU A . n A 1 199 ILE 199 590 590 ILE ILE A . n A 1 200 TYR 200 591 591 TYR TYR A . n A 1 201 SER 201 592 592 SER SER A . n A 1 202 LEU 202 593 593 LEU LEU A . n A 1 203 GLY 203 594 594 GLY GLY A . n A 1 204 LYS 204 595 595 LYS LYS A . n A 1 205 MET 205 596 596 MET MET A . n A 1 206 PRO 206 597 597 PRO PRO A . n A 1 207 TYR 207 598 598 TYR TYR A . n A 1 208 GLU 208 599 599 GLU GLU A . n A 1 209 ARG 209 600 600 ARG ARG A . n A 1 210 PHE 210 601 601 PHE PHE A . n A 1 211 THR 211 602 602 THR THR A . n A 1 212 ASN 212 603 603 ASN ASN A . n A 1 213 SER 213 604 604 SER SER A . n A 1 214 GLU 214 605 605 GLU GLU A . n A 1 215 THR 215 606 606 THR THR A . n A 1 216 ALA 216 607 607 ALA ALA A . n A 1 217 GLU 217 608 608 GLU GLU A . n A 1 218 HIS 218 609 609 HIS HIS A . n A 1 219 ILE 219 610 610 ILE ILE A . n A 1 220 ALA 220 611 611 ALA ALA A . n A 1 221 GLN 221 612 612 GLN GLN A . n A 1 222 GLY 222 613 613 GLY GLY A . n A 1 223 LEU 223 614 614 LEU LEU A . n A 1 224 ARG 224 615 615 ARG ARG A . n A 1 225 LEU 225 616 616 LEU LEU A . n A 1 226 TYR 226 617 617 TYR TYR A . n A 1 227 ARG 227 618 618 ARG ARG A . n A 1 228 PRO 228 619 619 PRO PRO A . n A 1 229 HIS 229 620 620 HIS HIS A . n A 1 230 LEU 230 621 621 LEU LEU A . n A 1 231 ALA 231 622 622 ALA ALA A . n A 1 232 SER 232 623 623 SER SER A . n A 1 233 GLU 233 624 624 GLU GLU A . n A 1 234 LYS 234 625 625 LYS LYS A . n A 1 235 VAL 235 626 626 VAL VAL A . n A 1 236 TYR 236 627 627 TYR TYR A . n A 1 237 THR 237 628 628 THR THR A . n A 1 238 ILE 238 629 629 ILE ILE A . n A 1 239 MET 239 630 630 MET MET A . n A 1 240 TYR 240 631 631 TYR TYR A . n A 1 241 SER 241 632 632 SER SER A . n A 1 242 CYS 242 633 633 CYS CYS A . n A 1 243 TRP 243 634 634 TRP TRP A . n A 1 244 HIS 244 635 635 HIS HIS A . n A 1 245 GLU 245 636 636 GLU GLU A . n A 1 246 LYS 246 637 637 LYS LYS A . n A 1 247 ALA 247 638 638 ALA ALA A . n A 1 248 ASP 248 639 639 ASP ASP A . n A 1 249 GLU 249 640 640 GLU GLU A . n A 1 250 ARG 250 641 641 ARG ARG A . n A 1 251 PRO 251 642 642 PRO PRO A . n A 1 252 THR 252 643 643 THR THR A . n A 1 253 PHE 253 644 644 PHE PHE A . n A 1 254 LYS 254 645 645 LYS LYS A . n A 1 255 ILE 255 646 646 ILE ILE A . n A 1 256 LEU 256 647 647 LEU LEU A . n A 1 257 LEU 257 648 648 LEU LEU A . n A 1 258 SER 258 649 649 SER SER A . n A 1 259 ASN 259 650 650 ASN ASN A . n A 1 260 ILE 260 651 651 ILE ILE A . n A 1 261 LEU 261 652 652 LEU LEU A . n A 1 262 ASP 262 653 653 ASP ASP A . n A 1 263 VAL 263 654 654 VAL VAL A . n A 1 264 MET 264 655 655 MET MET A . n A 1 265 ASP 265 656 656 ASP ASP A . n A 1 266 GLU 266 657 657 GLU GLU A . n A 1 267 ASN 267 658 658 ASN ASN A . n A 1 268 LEU 268 659 ? ? ? A . n A 1 269 TYR 269 660 ? ? ? A . n A 1 270 PHE 270 661 ? ? ? A . n A 1 271 GLN 271 662 ? ? ? A . n A 1 272 GLY 272 663 ? ? ? A . n A 1 273 GLU 273 664 ? ? ? A . n A 1 274 GLU 274 665 ? ? ? A . n A 1 275 TYR 275 666 ? ? ? A . n A 1 276 MET 276 667 ? ? ? A . n A 1 277 PRO 277 668 ? ? ? A . n A 1 278 THR 278 669 ? ? ? A . n A 1 279 GLU 279 670 ? ? ? A . n A 1 280 HIS 280 671 ? ? ? A . n A 1 281 HIS 281 672 ? ? ? A . n A 1 282 HIS 282 673 ? ? ? A . n A 1 283 HIS 283 674 ? ? ? A . n A 1 284 HIS 284 675 ? ? ? A . n A 1 285 HIS 285 676 ? ? ? A . n A 1 286 HIS 286 677 ? ? ? A . n A 1 287 HIS 287 678 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 701 1 SO4 SO4 A . C 2 SO4 1 702 2 SO4 SO4 A . D 3 DTJ 1 703 1 DTJ DRG A . E 2 SO4 1 704 1 SO4 SO4 A . F 4 GOL 1 705 1 GOL GOL A . G 5 HOH 1 801 101 HOH HOH A . G 5 HOH 2 802 25 HOH HOH A . G 5 HOH 3 803 81 HOH HOH A . G 5 HOH 4 804 9 HOH HOH A . G 5 HOH 5 805 28 HOH HOH A . G 5 HOH 6 806 162 HOH HOH A . G 5 HOH 7 807 26 HOH HOH A . G 5 HOH 8 808 87 HOH HOH A . G 5 HOH 9 809 38 HOH HOH A . G 5 HOH 10 810 5 HOH HOH A . G 5 HOH 11 811 146 HOH HOH A . G 5 HOH 12 812 78 HOH HOH A . G 5 HOH 13 813 66 HOH HOH A . G 5 HOH 14 814 73 HOH HOH A . G 5 HOH 15 815 60 HOH HOH A . G 5 HOH 16 816 11 HOH HOH A . G 5 HOH 17 817 4 HOH HOH A . G 5 HOH 18 818 17 HOH HOH A . G 5 HOH 19 819 14 HOH HOH A . G 5 HOH 20 820 34 HOH HOH A . G 5 HOH 21 821 99 HOH HOH A . G 5 HOH 22 822 20 HOH HOH A . G 5 HOH 23 823 30 HOH HOH A . G 5 HOH 24 824 113 HOH HOH A . G 5 HOH 25 825 29 HOH HOH A . G 5 HOH 26 826 59 HOH HOH A . G 5 HOH 27 827 93 HOH HOH A . G 5 HOH 28 828 138 HOH HOH A . G 5 HOH 29 829 102 HOH HOH A . G 5 HOH 30 830 72 HOH HOH A . G 5 HOH 31 831 3 HOH HOH A . G 5 HOH 32 832 54 HOH HOH A . G 5 HOH 33 833 21 HOH HOH A . G 5 HOH 34 834 47 HOH HOH A . G 5 HOH 35 835 158 HOH HOH A . G 5 HOH 36 836 116 HOH HOH A . G 5 HOH 37 837 76 HOH HOH A . G 5 HOH 38 838 74 HOH HOH A . G 5 HOH 39 839 58 HOH HOH A . G 5 HOH 40 840 7 HOH HOH A . G 5 HOH 41 841 82 HOH HOH A . G 5 HOH 42 842 85 HOH HOH A . G 5 HOH 43 843 114 HOH HOH A . G 5 HOH 44 844 122 HOH HOH A . G 5 HOH 45 845 27 HOH HOH A . G 5 HOH 46 846 86 HOH HOH A . G 5 HOH 47 847 43 HOH HOH A . G 5 HOH 48 848 92 HOH HOH A . G 5 HOH 49 849 179 HOH HOH A . G 5 HOH 50 850 3 HOH HOH A . G 5 HOH 51 851 41 HOH HOH A . G 5 HOH 52 852 182 HOH HOH A . G 5 HOH 53 853 19 HOH HOH A . G 5 HOH 54 854 7 HOH HOH A . G 5 HOH 55 855 39 HOH HOH A . G 5 HOH 56 856 15 HOH HOH A . G 5 HOH 57 857 75 HOH HOH A . G 5 HOH 58 858 83 HOH HOH A . G 5 HOH 59 859 107 HOH HOH A . G 5 HOH 60 860 130 HOH HOH A . G 5 HOH 61 861 50 HOH HOH A . G 5 HOH 62 862 174 HOH HOH A . G 5 HOH 63 863 70 HOH HOH A . G 5 HOH 64 864 166 HOH HOH A . G 5 HOH 65 865 4 HOH HOH A . G 5 HOH 66 866 57 HOH HOH A . G 5 HOH 67 867 97 HOH HOH A . G 5 HOH 68 868 33 HOH HOH A . G 5 HOH 69 869 8 HOH HOH A . G 5 HOH 70 870 69 HOH HOH A . G 5 HOH 71 871 48 HOH HOH A . G 5 HOH 72 872 79 HOH HOH A . G 5 HOH 73 873 22 HOH HOH A . G 5 HOH 74 874 32 HOH HOH A . G 5 HOH 75 875 11 HOH HOH A . G 5 HOH 76 876 169 HOH HOH A . G 5 HOH 77 877 18 HOH HOH A . G 5 HOH 78 878 100 HOH HOH A . G 5 HOH 79 879 55 HOH HOH A . G 5 HOH 80 880 1 HOH HOH A . G 5 HOH 81 881 115 HOH HOH A . G 5 HOH 82 882 61 HOH HOH A . G 5 HOH 83 883 6 HOH HOH A . G 5 HOH 84 884 178 HOH HOH A . G 5 HOH 85 885 5 HOH HOH A . G 5 HOH 86 886 108 HOH HOH A . G 5 HOH 87 887 171 HOH HOH A . G 5 HOH 88 888 136 HOH HOH A . G 5 HOH 89 889 35 HOH HOH A . G 5 HOH 90 890 12 HOH HOH A . G 5 HOH 91 891 12 HOH HOH A . G 5 HOH 92 892 68 HOH HOH A . G 5 HOH 93 893 126 HOH HOH A . G 5 HOH 94 894 144 HOH HOH A . G 5 HOH 95 895 164 HOH HOH A . G 5 HOH 96 896 40 HOH HOH A . G 5 HOH 97 897 161 HOH HOH A . G 5 HOH 98 898 23 HOH HOH A . G 5 HOH 99 899 95 HOH HOH A . G 5 HOH 100 900 104 HOH HOH A . G 5 HOH 101 901 117 HOH HOH A . G 5 HOH 102 902 172 HOH HOH A . G 5 HOH 103 903 53 HOH HOH A . G 5 HOH 104 904 121 HOH HOH A . G 5 HOH 105 905 37 HOH HOH A . G 5 HOH 106 906 98 HOH HOH A . G 5 HOH 107 907 103 HOH HOH A . G 5 HOH 108 908 45 HOH HOH A . G 5 HOH 109 909 9 HOH HOH A . G 5 HOH 110 910 31 HOH HOH A . G 5 HOH 111 911 91 HOH HOH A . G 5 HOH 112 912 150 HOH HOH A . G 5 HOH 113 913 134 HOH HOH A . G 5 HOH 114 914 49 HOH HOH A . G 5 HOH 115 915 147 HOH HOH A . G 5 HOH 116 916 110 HOH HOH A . G 5 HOH 117 917 157 HOH HOH A . G 5 HOH 118 918 44 HOH HOH A . G 5 HOH 119 919 141 HOH HOH A . G 5 HOH 120 920 24 HOH HOH A . G 5 HOH 121 921 106 HOH HOH A . G 5 HOH 122 922 148 HOH HOH A . G 5 HOH 123 923 132 HOH HOH A . G 5 HOH 124 924 118 HOH HOH A . G 5 HOH 125 925 175 HOH HOH A . G 5 HOH 126 926 8 HOH HOH A . G 5 HOH 127 927 10 HOH HOH A . G 5 HOH 128 928 62 HOH HOH A . G 5 HOH 129 929 46 HOH HOH A . G 5 HOH 130 930 140 HOH HOH A . G 5 HOH 131 931 36 HOH HOH A . G 5 HOH 132 932 176 HOH HOH A . G 5 HOH 133 933 133 HOH HOH A . G 5 HOH 134 934 111 HOH HOH A . G 5 HOH 135 935 13 HOH HOH A . G 5 HOH 136 936 52 HOH HOH A . G 5 HOH 137 937 77 HOH HOH A . G 5 HOH 138 938 139 HOH HOH A . G 5 HOH 139 939 109 HOH HOH A . G 5 HOH 140 940 80 HOH HOH A . G 5 HOH 141 941 96 HOH HOH A . G 5 HOH 142 942 170 HOH HOH A . G 5 HOH 143 943 120 HOH HOH A . G 5 HOH 144 944 129 HOH HOH A . G 5 HOH 145 945 14 HOH HOH A . G 5 HOH 146 946 183 HOH HOH A . G 5 HOH 147 947 154 HOH HOH A . G 5 HOH 148 948 135 HOH HOH A . G 5 HOH 149 949 149 HOH HOH A . G 5 HOH 150 950 90 HOH HOH A . G 5 HOH 151 951 94 HOH HOH A . G 5 HOH 152 952 160 HOH HOH A . G 5 HOH 153 953 2 HOH HOH A . G 5 HOH 154 954 127 HOH HOH A . G 5 HOH 155 955 167 HOH HOH A . G 5 HOH 156 956 65 HOH HOH A . G 5 HOH 157 957 10 HOH HOH A . G 5 HOH 158 958 51 HOH HOH A . G 5 HOH 159 959 64 HOH HOH A . G 5 HOH 160 960 89 HOH HOH A . G 5 HOH 161 961 13 HOH HOH A . G 5 HOH 162 962 128 HOH HOH A . G 5 HOH 163 963 125 HOH HOH A . G 5 HOH 164 964 63 HOH HOH A . G 5 HOH 165 965 124 HOH HOH A . G 5 HOH 166 966 67 HOH HOH A . G 5 HOH 167 967 181 HOH HOH A . G 5 HOH 168 968 152 HOH HOH A . G 5 HOH 169 969 155 HOH HOH A . G 5 HOH 170 970 143 HOH HOH A . G 5 HOH 171 971 105 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id OCS _pdbx_struct_mod_residue.label_seq_id 90 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id OCS _pdbx_struct_mod_residue.auth_seq_id 481 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-11-07 2 'Structure model' 1 1 2019-02-27 3 'Structure model' 1 2 2019-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 93.6619 -51.8118 -7.0102 0.2177 0.1973 0.2429 -0.0528 -0.0059 0.0086 2.4660 1.1359 1.0843 -0.3953 0.1984 -0.0255 0.1139 -0.1453 -0.3678 0.2295 -0.1118 0.1082 0.0537 -0.0567 -0.0073 'X-RAY DIFFRACTION' 2 ? refined 94.5471 -39.0891 2.2770 0.2046 0.2708 0.2799 -0.0053 0.0562 -0.0409 2.0190 0.5497 2.3057 0.7400 0.2903 0.8265 -0.1459 0.0580 -0.0939 0.0192 -0.2267 0.6561 0.0936 -0.4691 0.2391 'X-RAY DIFFRACTION' 3 ? refined 94.8590 -48.3234 -5.8091 0.1802 0.2244 0.2155 -0.0221 -0.0207 -0.0335 1.7375 1.4867 1.3921 0.8578 -0.7542 -0.4067 -0.0624 0.1477 -0.1651 0.0152 0.0582 0.0151 0.1817 -0.2151 -0.0277 'X-RAY DIFFRACTION' 4 ? refined 108.4852 -30.9262 -5.7009 0.1584 0.1738 0.1428 0.0052 -0.0210 0.0100 1.5446 1.4783 1.9274 0.1578 -0.9351 -0.0505 0.0711 0.1193 0.0350 -0.1491 -0.0337 -0.0354 -0.1797 -0.0765 -0.0316 'X-RAY DIFFRACTION' 5 ? refined 110.6211 -42.7695 3.4405 0.1664 0.1490 0.1506 -0.0175 -0.0186 0.0062 1.3091 0.6030 0.9895 -0.0335 0.3939 -0.2398 0.0537 -0.1217 -0.1604 0.1322 -0.0090 -0.0320 0.0352 -0.0557 -0.0454 'X-RAY DIFFRACTION' 6 ? refined 125.6069 -42.6969 0.3316 0.1683 0.2182 0.1940 -0.0230 -0.0191 -0.0178 2.3856 3.1553 1.2574 -1.2007 0.4305 -0.6050 -0.0340 0.1432 -0.0934 0.1140 -0.0746 -0.1790 0.1657 0.3891 0.0969 'X-RAY DIFFRACTION' 7 ? refined 117.3288 -27.3256 5.1464 0.1952 0.1746 0.1639 -0.0423 -0.0485 -0.0116 1.4635 1.3493 1.8075 0.1733 -0.4580 0.1668 -0.0808 -0.0482 0.0949 0.1129 -0.0125 -0.1440 -0.1723 0.1129 0.1001 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 395 through 444 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 445 through 459 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 460 through 482 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 483 through 515 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 516 through 591 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 592 through 611 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 612 through 658 ) ; # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? ADSC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 907 ? ? O A HOH 954 ? ? 2.07 2 1 O A HOH 843 ? ? O A HOH 907 ? ? 2.13 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE1 A GLN 467 ? ? 1_555 HZ2 A LYS 573 ? ? 2_534 1.48 2 1 OE1 A GLN 467 ? ? 1_555 NZ A LYS 573 ? ? 2_534 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 520 ? ? 88.25 -17.53 2 1 ASP A 521 ? ? -145.87 51.62 3 1 ASP A 548 ? ? -168.67 108.51 4 1 ARG A 600 ? ? 74.69 -6.56 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TRP 395 ? CG ? A TRP 4 CG 2 1 Y 1 A TRP 395 ? CD1 ? A TRP 4 CD1 3 1 Y 1 A TRP 395 ? CD2 ? A TRP 4 CD2 4 1 Y 1 A TRP 395 ? NE1 ? A TRP 4 NE1 5 1 Y 1 A TRP 395 ? CE2 ? A TRP 4 CE2 6 1 Y 1 A TRP 395 ? CE3 ? A TRP 4 CE3 7 1 Y 1 A TRP 395 ? CZ2 ? A TRP 4 CZ2 8 1 Y 1 A TRP 395 ? CZ3 ? A TRP 4 CZ3 9 1 Y 1 A TRP 395 ? CH2 ? A TRP 4 CH2 10 1 Y 1 A GLU 445 ? CG ? A GLU 54 CG 11 1 Y 1 A GLU 445 ? CD ? A GLU 54 CD 12 1 Y 1 A GLU 445 ? OE1 ? A GLU 54 OE1 13 1 Y 1 A GLU 445 ? OE2 ? A GLU 54 OE2 14 1 Y 1 A LYS 447 ? CG ? A LYS 56 CG 15 1 Y 1 A LYS 447 ? CD ? A LYS 56 CD 16 1 Y 1 A LYS 447 ? CE ? A LYS 56 CE 17 1 Y 1 A LYS 447 ? NZ ? A LYS 56 NZ 18 1 Y 1 A MET 450 ? CG ? A MET 59 CG 19 1 Y 1 A MET 450 ? SD ? A MET 59 SD 20 1 Y 1 A MET 450 ? CE ? A MET 59 CE 21 1 Y 1 A GLN 496 ? CG ? A GLN 105 CG 22 1 Y 1 A GLN 496 ? CD ? A GLN 105 CD 23 1 Y 1 A GLN 496 ? OE1 ? A GLN 105 OE1 24 1 Y 1 A GLN 496 ? NE2 ? A GLN 105 NE2 25 1 Y 1 A ARG 544 ? CG ? A ARG 153 CG 26 1 Y 1 A ARG 544 ? CD ? A ARG 153 CD 27 1 Y 1 A ARG 544 ? NE ? A ARG 153 NE 28 1 Y 1 A ARG 544 ? CZ ? A ARG 153 CZ 29 1 Y 1 A ARG 544 ? NH1 ? A ARG 153 NH1 30 1 Y 1 A ARG 544 ? NH2 ? A ARG 153 NH2 31 1 Y 1 A LYS 645 ? CG ? A LYS 254 CG 32 1 Y 1 A LYS 645 ? CD ? A LYS 254 CD 33 1 Y 1 A LYS 645 ? CE ? A LYS 254 CE 34 1 Y 1 A LYS 645 ? NZ ? A LYS 254 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 392 ? A MET 1 2 1 Y 1 A GLY 393 ? A GLY 2 3 1 Y 1 A SER 394 ? A SER 3 4 1 Y 1 A LEU 659 ? A LEU 268 5 1 Y 1 A TYR 660 ? A TYR 269 6 1 Y 1 A PHE 661 ? A PHE 270 7 1 Y 1 A GLN 662 ? A GLN 271 8 1 Y 1 A GLY 663 ? A GLY 272 9 1 Y 1 A GLU 664 ? A GLU 273 10 1 Y 1 A GLU 665 ? A GLU 274 11 1 Y 1 A TYR 666 ? A TYR 275 12 1 Y 1 A MET 667 ? A MET 276 13 1 Y 1 A PRO 668 ? A PRO 277 14 1 Y 1 A THR 669 ? A THR 278 15 1 Y 1 A GLU 670 ? A GLU 279 16 1 Y 1 A HIS 671 ? A HIS 280 17 1 Y 1 A HIS 672 ? A HIS 281 18 1 Y 1 A HIS 673 ? A HIS 282 19 1 Y 1 A HIS 674 ? A HIS 283 20 1 Y 1 A HIS 675 ? A HIS 284 21 1 Y 1 A HIS 676 ? A HIS 285 22 1 Y 1 A HIS 677 ? A HIS 286 23 1 Y 1 A HIS 678 ? A HIS 287 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 ;4-tert-butyl-N-[2-(hydroxymethyl)-3-(1-methyl-5-{[5-(morpholine-4-carbonyl)pyridin-2-yl]amino}-6-oxo-1,6-dihydropyridazin-3-yl)phenyl]benzamide ; DTJ 4 GLYCEROL GOL 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #