data_6BO0 # _entry.id 6BO0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6BO0 pdb_00006bo0 10.2210/pdb6bo0/pdb WWPDB D_1000231191 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-13 2 'Structure model' 1 1 2018-01-17 3 'Structure model' 1 2 2018-03-28 4 'Structure model' 1 3 2018-04-18 5 'Structure model' 1 4 2019-12-11 6 'Structure model' 1 5 2023-10-04 7 'Structure model' 1 6 2023-11-15 8 'Structure model' 1 7 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Author supporting evidence' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' 9 6 'Structure model' 'Refinement description' 10 7 'Structure model' 'Data collection' 11 8 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 4 'Structure model' citation_author 6 5 'Structure model' pdbx_audit_support 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond 9 6 'Structure model' database_2 10 6 'Structure model' pdbx_initial_refinement_model 11 7 'Structure model' chem_comp_atom 12 7 'Structure model' chem_comp_bond 13 8 'Structure model' pdbx_entry_details 14 8 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.pdbx_database_id_DOI' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_citation.year' 11 3 'Structure model' '_citation_author.name' 12 4 'Structure model' '_citation.journal_volume' 13 4 'Structure model' '_citation.title' 14 4 'Structure model' '_citation_author.name' 15 5 'Structure model' '_pdbx_audit_support.funding_organization' 16 6 'Structure model' '_database_2.pdbx_DOI' 17 6 'Structure model' '_database_2.pdbx_database_accession' 18 7 'Structure model' '_chem_comp_atom.atom_id' 19 7 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6BO0 _pdbx_database_status.recvd_initial_deposition_date 2017-11-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id CSGID-IDP95889 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Osipiuk, J.' 1 ? 'Luong, T.Y.' 2 ? 'Trigar, R.' 3 ? 'Ton-That, H.' 4 ? 'Anderson, W.F.' 5 ? 'Joachimiak, A.' 6 ? 'Center for Structural Genomics of Infectious Diseases (CSGID)' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Bacteriol.' _citation.journal_id_ASTM JOBAAY _citation.journal_id_CSD 0767 _citation.journal_id_ISSN 1098-5530 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 200 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural Basis of a Thiol-Disulfide Oxidoreductase in the Hedgehog-Forming Actinobacterium Corynebacterium matruchotii.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/JB.00783-17 _citation.pdbx_database_id_PubMed 29440253 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Luong, T.T.' 1 ? primary 'Tirgar, R.' 2 ? primary 'Reardon-Robinson, M.E.' 3 ? primary 'Joachimiak, A.' 4 ? primary 'Osipiuk, J.' 5 ? primary 'Ton-That, H.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MdbA protein' 22433.076 1 ? ? ? ? 2 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 3 water nat water 18.015 306 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNASQEEKFAETYNETTAFNNKVDGSAVQLVSDKADKAKTVDIYEDFS(CSO)HYCSQLAKETDADMKKLIEDGKVKVNI RTMNFLDKGEIGHSNKAGTAAYTIAKDDSAQVYWNFRTMLMTEQQNIWGKKELKDLADMAKILGAKDETVKKIADGTYSD EFKKIADDNAKKLEKDGDGQVSSPRVFIDGKEIKENATWPSQIK ; _entity_poly.pdbx_seq_one_letter_code_can ;SNASQEEKFAETYNETTAFNNKVDGSAVQLVSDKADKAKTVDIYEDFSCHYCSQLAKETDADMKKLIEDGKVKVNIRTMN FLDKGEIGHSNKAGTAAYTIAKDDSAQVYWNFRTMLMTEQQNIWGKKELKDLADMAKILGAKDETVKKIADGTYSDEFKK IADDNAKKLEKDGDGQVSSPRVFIDGKEIKENATWPSQIK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CSGID-IDP95889 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'TETRAETHYLENE GLYCOL' PG4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 SER n 1 5 GLN n 1 6 GLU n 1 7 GLU n 1 8 LYS n 1 9 PHE n 1 10 ALA n 1 11 GLU n 1 12 THR n 1 13 TYR n 1 14 ASN n 1 15 GLU n 1 16 THR n 1 17 THR n 1 18 ALA n 1 19 PHE n 1 20 ASN n 1 21 ASN n 1 22 LYS n 1 23 VAL n 1 24 ASP n 1 25 GLY n 1 26 SER n 1 27 ALA n 1 28 VAL n 1 29 GLN n 1 30 LEU n 1 31 VAL n 1 32 SER n 1 33 ASP n 1 34 LYS n 1 35 ALA n 1 36 ASP n 1 37 LYS n 1 38 ALA n 1 39 LYS n 1 40 THR n 1 41 VAL n 1 42 ASP n 1 43 ILE n 1 44 TYR n 1 45 GLU n 1 46 ASP n 1 47 PHE n 1 48 SER n 1 49 CSO n 1 50 HIS n 1 51 TYR n 1 52 CYS n 1 53 SER n 1 54 GLN n 1 55 LEU n 1 56 ALA n 1 57 LYS n 1 58 GLU n 1 59 THR n 1 60 ASP n 1 61 ALA n 1 62 ASP n 1 63 MET n 1 64 LYS n 1 65 LYS n 1 66 LEU n 1 67 ILE n 1 68 GLU n 1 69 ASP n 1 70 GLY n 1 71 LYS n 1 72 VAL n 1 73 LYS n 1 74 VAL n 1 75 ASN n 1 76 ILE n 1 77 ARG n 1 78 THR n 1 79 MET n 1 80 ASN n 1 81 PHE n 1 82 LEU n 1 83 ASP n 1 84 LYS n 1 85 GLY n 1 86 GLU n 1 87 ILE n 1 88 GLY n 1 89 HIS n 1 90 SER n 1 91 ASN n 1 92 LYS n 1 93 ALA n 1 94 GLY n 1 95 THR n 1 96 ALA n 1 97 ALA n 1 98 TYR n 1 99 THR n 1 100 ILE n 1 101 ALA n 1 102 LYS n 1 103 ASP n 1 104 ASP n 1 105 SER n 1 106 ALA n 1 107 GLN n 1 108 VAL n 1 109 TYR n 1 110 TRP n 1 111 ASN n 1 112 PHE n 1 113 ARG n 1 114 THR n 1 115 MET n 1 116 LEU n 1 117 MET n 1 118 THR n 1 119 GLU n 1 120 GLN n 1 121 GLN n 1 122 ASN n 1 123 ILE n 1 124 TRP n 1 125 GLY n 1 126 LYS n 1 127 LYS n 1 128 GLU n 1 129 LEU n 1 130 LYS n 1 131 ASP n 1 132 LEU n 1 133 ALA n 1 134 ASP n 1 135 MET n 1 136 ALA n 1 137 LYS n 1 138 ILE n 1 139 LEU n 1 140 GLY n 1 141 ALA n 1 142 LYS n 1 143 ASP n 1 144 GLU n 1 145 THR n 1 146 VAL n 1 147 LYS n 1 148 LYS n 1 149 ILE n 1 150 ALA n 1 151 ASP n 1 152 GLY n 1 153 THR n 1 154 TYR n 1 155 SER n 1 156 ASP n 1 157 GLU n 1 158 PHE n 1 159 LYS n 1 160 LYS n 1 161 ILE n 1 162 ALA n 1 163 ASP n 1 164 ASP n 1 165 ASN n 1 166 ALA n 1 167 LYS n 1 168 LYS n 1 169 LEU n 1 170 GLU n 1 171 LYS n 1 172 ASP n 1 173 GLY n 1 174 ASP n 1 175 GLY n 1 176 GLN n 1 177 VAL n 1 178 SER n 1 179 SER n 1 180 PRO n 1 181 ARG n 1 182 VAL n 1 183 PHE n 1 184 ILE n 1 185 ASP n 1 186 GLY n 1 187 LYS n 1 188 GLU n 1 189 ILE n 1 190 LYS n 1 191 GLU n 1 192 ASN n 1 193 ALA n 1 194 THR n 1 195 TRP n 1 196 PRO n 1 197 SER n 1 198 GLN n 1 199 ILE n 1 200 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 200 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HMPREF0299_7193 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Corynebacterium matruchotii ATCC 14266' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 553207 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 43 ? ? ? A . n A 1 2 ASN 2 44 44 ASN ASN A . n A 1 3 ALA 3 45 45 ALA ALA A . n A 1 4 SER 4 46 46 SER SER A . n A 1 5 GLN 5 47 47 GLN GLN A . n A 1 6 GLU 6 48 48 GLU GLU A . n A 1 7 GLU 7 49 49 GLU GLU A . n A 1 8 LYS 8 50 50 LYS LYS A . n A 1 9 PHE 9 51 51 PHE PHE A . n A 1 10 ALA 10 52 52 ALA ALA A . n A 1 11 GLU 11 53 53 GLU GLU A . n A 1 12 THR 12 54 54 THR THR A . n A 1 13 TYR 13 55 55 TYR TYR A . n A 1 14 ASN 14 56 56 ASN ASN A . n A 1 15 GLU 15 57 57 GLU GLU A . n A 1 16 THR 16 58 58 THR THR A . n A 1 17 THR 17 59 59 THR THR A . n A 1 18 ALA 18 60 60 ALA ALA A . n A 1 19 PHE 19 61 61 PHE PHE A . n A 1 20 ASN 20 62 62 ASN ASN A . n A 1 21 ASN 21 63 63 ASN ASN A . n A 1 22 LYS 22 64 64 LYS LYS A . n A 1 23 VAL 23 65 65 VAL VAL A . n A 1 24 ASP 24 66 66 ASP ASP A . n A 1 25 GLY 25 67 67 GLY GLY A . n A 1 26 SER 26 68 68 SER SER A . n A 1 27 ALA 27 69 69 ALA ALA A . n A 1 28 VAL 28 70 70 VAL VAL A . n A 1 29 GLN 29 71 71 GLN GLN A . n A 1 30 LEU 30 72 72 LEU LEU A . n A 1 31 VAL 31 73 73 VAL VAL A . n A 1 32 SER 32 74 74 SER SER A . n A 1 33 ASP 33 75 75 ASP ASP A . n A 1 34 LYS 34 76 76 LYS LYS A . n A 1 35 ALA 35 77 77 ALA ALA A . n A 1 36 ASP 36 78 78 ASP ASP A . n A 1 37 LYS 37 79 79 LYS LYS A . n A 1 38 ALA 38 80 80 ALA ALA A . n A 1 39 LYS 39 81 81 LYS LYS A . n A 1 40 THR 40 82 82 THR THR A . n A 1 41 VAL 41 83 83 VAL VAL A . n A 1 42 ASP 42 84 84 ASP ASP A . n A 1 43 ILE 43 85 85 ILE ILE A . n A 1 44 TYR 44 86 86 TYR TYR A . n A 1 45 GLU 45 87 87 GLU GLU A . n A 1 46 ASP 46 88 88 ASP ASP A . n A 1 47 PHE 47 89 89 PHE PHE A . n A 1 48 SER 48 90 90 SER SER A . n A 1 49 CSO 49 91 91 CSO CSO A . n A 1 50 HIS 50 92 92 HIS HIS A . n A 1 51 TYR 51 93 93 TYR TYR A . n A 1 52 CYS 52 94 94 CYS CYS A . n A 1 53 SER 53 95 95 SER SER A . n A 1 54 GLN 54 96 96 GLN GLN A . n A 1 55 LEU 55 97 97 LEU LEU A . n A 1 56 ALA 56 98 98 ALA ALA A . n A 1 57 LYS 57 99 99 LYS LYS A . n A 1 58 GLU 58 100 100 GLU GLU A . n A 1 59 THR 59 101 101 THR THR A . n A 1 60 ASP 60 102 102 ASP ASP A . n A 1 61 ALA 61 103 103 ALA ALA A . n A 1 62 ASP 62 104 104 ASP ASP A . n A 1 63 MET 63 105 105 MET MET A . n A 1 64 LYS 64 106 106 LYS LYS A . n A 1 65 LYS 65 107 107 LYS LYS A . n A 1 66 LEU 66 108 108 LEU LEU A . n A 1 67 ILE 67 109 109 ILE ILE A . n A 1 68 GLU 68 110 110 GLU GLU A . n A 1 69 ASP 69 111 111 ASP ASP A . n A 1 70 GLY 70 112 112 GLY GLY A . n A 1 71 LYS 71 113 113 LYS LYS A . n A 1 72 VAL 72 114 114 VAL VAL A . n A 1 73 LYS 73 115 115 LYS LYS A . n A 1 74 VAL 74 116 116 VAL VAL A . n A 1 75 ASN 75 117 117 ASN ASN A . n A 1 76 ILE 76 118 118 ILE ILE A . n A 1 77 ARG 77 119 119 ARG ARG A . n A 1 78 THR 78 120 120 THR THR A . n A 1 79 MET 79 121 121 MET MET A . n A 1 80 ASN 80 122 122 ASN ASN A . n A 1 81 PHE 81 123 123 PHE PHE A . n A 1 82 LEU 82 124 124 LEU LEU A . n A 1 83 ASP 83 125 125 ASP ASP A . n A 1 84 LYS 84 126 126 LYS LYS A . n A 1 85 GLY 85 127 127 GLY GLY A . n A 1 86 GLU 86 128 128 GLU GLU A . n A 1 87 ILE 87 129 129 ILE ILE A . n A 1 88 GLY 88 130 130 GLY GLY A . n A 1 89 HIS 89 131 131 HIS HIS A . n A 1 90 SER 90 132 132 SER SER A . n A 1 91 ASN 91 133 133 ASN ASN A . n A 1 92 LYS 92 134 134 LYS LYS A . n A 1 93 ALA 93 135 135 ALA ALA A . n A 1 94 GLY 94 136 136 GLY GLY A . n A 1 95 THR 95 137 137 THR THR A . n A 1 96 ALA 96 138 138 ALA ALA A . n A 1 97 ALA 97 139 139 ALA ALA A . n A 1 98 TYR 98 140 140 TYR TYR A . n A 1 99 THR 99 141 141 THR THR A . n A 1 100 ILE 100 142 142 ILE ILE A . n A 1 101 ALA 101 143 143 ALA ALA A . n A 1 102 LYS 102 144 144 LYS LYS A . n A 1 103 ASP 103 145 145 ASP ASP A . n A 1 104 ASP 104 146 146 ASP ASP A . n A 1 105 SER 105 147 147 SER SER A . n A 1 106 ALA 106 148 148 ALA ALA A . n A 1 107 GLN 107 149 149 GLN GLN A . n A 1 108 VAL 108 150 150 VAL VAL A . n A 1 109 TYR 109 151 151 TYR TYR A . n A 1 110 TRP 110 152 152 TRP TRP A . n A 1 111 ASN 111 153 153 ASN ASN A . n A 1 112 PHE 112 154 154 PHE PHE A . n A 1 113 ARG 113 155 155 ARG ARG A . n A 1 114 THR 114 156 156 THR THR A . n A 1 115 MET 115 157 157 MET MET A . n A 1 116 LEU 116 158 158 LEU LEU A . n A 1 117 MET 117 159 159 MET MET A . n A 1 118 THR 118 160 160 THR THR A . n A 1 119 GLU 119 161 161 GLU GLU A . n A 1 120 GLN 120 162 162 GLN GLN A . n A 1 121 GLN 121 163 163 GLN GLN A . n A 1 122 ASN 122 164 164 ASN ASN A . n A 1 123 ILE 123 165 165 ILE ILE A . n A 1 124 TRP 124 166 166 TRP TRP A . n A 1 125 GLY 125 167 167 GLY GLY A . n A 1 126 LYS 126 168 168 LYS LYS A . n A 1 127 LYS 127 169 169 LYS LYS A . n A 1 128 GLU 128 170 170 GLU GLU A . n A 1 129 LEU 129 171 171 LEU LEU A . n A 1 130 LYS 130 172 172 LYS LYS A . n A 1 131 ASP 131 173 173 ASP ASP A . n A 1 132 LEU 132 174 174 LEU LEU A . n A 1 133 ALA 133 175 175 ALA ALA A . n A 1 134 ASP 134 176 176 ASP ASP A . n A 1 135 MET 135 177 177 MET MET A . n A 1 136 ALA 136 178 178 ALA ALA A . n A 1 137 LYS 137 179 179 LYS LYS A . n A 1 138 ILE 138 180 180 ILE ILE A . n A 1 139 LEU 139 181 181 LEU LEU A . n A 1 140 GLY 140 182 182 GLY GLY A . n A 1 141 ALA 141 183 183 ALA ALA A . n A 1 142 LYS 142 184 184 LYS LYS A . n A 1 143 ASP 143 185 185 ASP ASP A . n A 1 144 GLU 144 186 186 GLU GLU A . n A 1 145 THR 145 187 187 THR THR A . n A 1 146 VAL 146 188 188 VAL VAL A . n A 1 147 LYS 147 189 189 LYS LYS A . n A 1 148 LYS 148 190 190 LYS LYS A . n A 1 149 ILE 149 191 191 ILE ILE A . n A 1 150 ALA 150 192 192 ALA ALA A . n A 1 151 ASP 151 193 193 ASP ASP A . n A 1 152 GLY 152 194 194 GLY GLY A . n A 1 153 THR 153 195 195 THR THR A . n A 1 154 TYR 154 196 196 TYR TYR A . n A 1 155 SER 155 197 197 SER SER A . n A 1 156 ASP 156 198 198 ASP ASP A . n A 1 157 GLU 157 199 199 GLU GLU A . n A 1 158 PHE 158 200 200 PHE PHE A . n A 1 159 LYS 159 201 201 LYS LYS A . n A 1 160 LYS 160 202 202 LYS LYS A . n A 1 161 ILE 161 203 203 ILE ILE A . n A 1 162 ALA 162 204 204 ALA ALA A . n A 1 163 ASP 163 205 205 ASP ASP A . n A 1 164 ASP 164 206 206 ASP ASP A . n A 1 165 ASN 165 207 207 ASN ASN A . n A 1 166 ALA 166 208 208 ALA ALA A . n A 1 167 LYS 167 209 209 LYS LYS A . n A 1 168 LYS 168 210 210 LYS LYS A . n A 1 169 LEU 169 211 211 LEU LEU A . n A 1 170 GLU 170 212 212 GLU GLU A . n A 1 171 LYS 171 213 213 LYS LYS A . n A 1 172 ASP 172 214 214 ASP ASP A . n A 1 173 GLY 173 215 215 GLY GLY A . n A 1 174 ASP 174 216 216 ASP ASP A . n A 1 175 GLY 175 217 217 GLY GLY A . n A 1 176 GLN 176 218 218 GLN GLN A . n A 1 177 VAL 177 219 219 VAL VAL A . n A 1 178 SER 178 220 220 SER SER A . n A 1 179 SER 179 221 221 SER SER A . n A 1 180 PRO 180 222 222 PRO PRO A . n A 1 181 ARG 181 223 223 ARG ARG A . n A 1 182 VAL 182 224 224 VAL VAL A . n A 1 183 PHE 183 225 225 PHE PHE A . n A 1 184 ILE 184 226 226 ILE ILE A . n A 1 185 ASP 185 227 227 ASP ASP A . n A 1 186 GLY 186 228 228 GLY GLY A . n A 1 187 LYS 187 229 229 LYS LYS A . n A 1 188 GLU 188 230 230 GLU GLU A . n A 1 189 ILE 189 231 231 ILE ILE A . n A 1 190 LYS 190 232 232 LYS LYS A . n A 1 191 GLU 191 233 233 GLU GLU A . n A 1 192 ASN 192 234 234 ASN ASN A . n A 1 193 ALA 193 235 235 ALA ALA A . n A 1 194 THR 194 236 236 THR THR A . n A 1 195 TRP 195 237 237 TRP TRP A . n A 1 196 PRO 196 238 238 PRO PRO A . n A 1 197 SER 197 239 239 SER SER A . n A 1 198 GLN 198 240 240 GLN GLN A . n A 1 199 ILE 199 241 241 ILE ILE A . n A 1 200 LYS 200 242 242 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PG4 1 301 301 PG4 PG4 A . C 3 HOH 1 401 273 HOH HOH A . C 3 HOH 2 402 258 HOH HOH A . C 3 HOH 3 403 259 HOH HOH A . C 3 HOH 4 404 232 HOH HOH A . C 3 HOH 5 405 197 HOH HOH A . C 3 HOH 6 406 250 HOH HOH A . C 3 HOH 7 407 132 HOH HOH A . C 3 HOH 8 408 234 HOH HOH A . C 3 HOH 9 409 59 HOH HOH A . C 3 HOH 10 410 43 HOH HOH A . C 3 HOH 11 411 281 HOH HOH A . C 3 HOH 12 412 143 HOH HOH A . C 3 HOH 13 413 210 HOH HOH A . C 3 HOH 14 414 131 HOH HOH A . C 3 HOH 15 415 158 HOH HOH A . C 3 HOH 16 416 2 HOH HOH A . C 3 HOH 17 417 130 HOH HOH A . C 3 HOH 18 418 208 HOH HOH A . C 3 HOH 19 419 270 HOH HOH A . C 3 HOH 20 420 97 HOH HOH A . C 3 HOH 21 421 212 HOH HOH A . C 3 HOH 22 422 157 HOH HOH A . C 3 HOH 23 423 165 HOH HOH A . C 3 HOH 24 424 298 HOH HOH A . C 3 HOH 25 425 139 HOH HOH A . C 3 HOH 26 426 5 HOH HOH A . C 3 HOH 27 427 236 HOH HOH A . C 3 HOH 28 428 71 HOH HOH A . C 3 HOH 29 429 249 HOH HOH A . C 3 HOH 30 430 187 HOH HOH A . C 3 HOH 31 431 106 HOH HOH A . C 3 HOH 32 432 184 HOH HOH A . C 3 HOH 33 433 6 HOH HOH A . C 3 HOH 34 434 303 HOH HOH A . C 3 HOH 35 435 8 HOH HOH A . C 3 HOH 36 436 194 HOH HOH A . C 3 HOH 37 437 161 HOH HOH A . C 3 HOH 38 438 264 HOH HOH A . C 3 HOH 39 439 237 HOH HOH A . C 3 HOH 40 440 108 HOH HOH A . C 3 HOH 41 441 198 HOH HOH A . C 3 HOH 42 442 89 HOH HOH A . C 3 HOH 43 443 231 HOH HOH A . C 3 HOH 44 444 174 HOH HOH A . C 3 HOH 45 445 167 HOH HOH A . C 3 HOH 46 446 90 HOH HOH A . C 3 HOH 47 447 271 HOH HOH A . C 3 HOH 48 448 62 HOH HOH A . C 3 HOH 49 449 56 HOH HOH A . C 3 HOH 50 450 186 HOH HOH A . C 3 HOH 51 451 279 HOH HOH A . C 3 HOH 52 452 84 HOH HOH A . C 3 HOH 53 453 147 HOH HOH A . C 3 HOH 54 454 133 HOH HOH A . C 3 HOH 55 455 60 HOH HOH A . C 3 HOH 56 456 120 HOH HOH A . C 3 HOH 57 457 29 HOH HOH A . C 3 HOH 58 458 110 HOH HOH A . C 3 HOH 59 459 164 HOH HOH A . C 3 HOH 60 460 91 HOH HOH A . C 3 HOH 61 461 64 HOH HOH A . C 3 HOH 62 462 11 HOH HOH A . C 3 HOH 63 463 150 HOH HOH A . C 3 HOH 64 464 129 HOH HOH A . C 3 HOH 65 465 10 HOH HOH A . C 3 HOH 66 466 233 HOH HOH A . C 3 HOH 67 467 151 HOH HOH A . C 3 HOH 68 468 238 HOH HOH A . C 3 HOH 69 469 137 HOH HOH A . C 3 HOH 70 470 47 HOH HOH A . C 3 HOH 71 471 80 HOH HOH A . C 3 HOH 72 472 70 HOH HOH A . C 3 HOH 73 473 35 HOH HOH A . C 3 HOH 74 474 282 HOH HOH A . C 3 HOH 75 475 30 HOH HOH A . C 3 HOH 76 476 95 HOH HOH A . C 3 HOH 77 477 200 HOH HOH A . C 3 HOH 78 478 253 HOH HOH A . C 3 HOH 79 479 46 HOH HOH A . C 3 HOH 80 480 54 HOH HOH A . C 3 HOH 81 481 34 HOH HOH A . C 3 HOH 82 482 44 HOH HOH A . C 3 HOH 83 483 295 HOH HOH A . C 3 HOH 84 484 122 HOH HOH A . C 3 HOH 85 485 179 HOH HOH A . C 3 HOH 86 486 18 HOH HOH A . C 3 HOH 87 487 162 HOH HOH A . C 3 HOH 88 488 290 HOH HOH A . C 3 HOH 89 489 125 HOH HOH A . C 3 HOH 90 490 16 HOH HOH A . C 3 HOH 91 491 138 HOH HOH A . C 3 HOH 92 492 42 HOH HOH A . C 3 HOH 93 493 88 HOH HOH A . C 3 HOH 94 494 23 HOH HOH A . C 3 HOH 95 495 87 HOH HOH A . C 3 HOH 96 496 55 HOH HOH A . C 3 HOH 97 497 103 HOH HOH A . C 3 HOH 98 498 222 HOH HOH A . C 3 HOH 99 499 17 HOH HOH A . C 3 HOH 100 500 82 HOH HOH A . C 3 HOH 101 501 41 HOH HOH A . C 3 HOH 102 502 153 HOH HOH A . C 3 HOH 103 503 24 HOH HOH A . C 3 HOH 104 504 224 HOH HOH A . C 3 HOH 105 505 73 HOH HOH A . C 3 HOH 106 506 31 HOH HOH A . C 3 HOH 107 507 228 HOH HOH A . C 3 HOH 108 508 39 HOH HOH A . C 3 HOH 109 509 58 HOH HOH A . C 3 HOH 110 510 14 HOH HOH A . C 3 HOH 111 511 118 HOH HOH A . C 3 HOH 112 512 36 HOH HOH A . C 3 HOH 113 513 159 HOH HOH A . C 3 HOH 114 514 72 HOH HOH A . C 3 HOH 115 515 142 HOH HOH A . C 3 HOH 116 516 22 HOH HOH A . C 3 HOH 117 517 170 HOH HOH A . C 3 HOH 118 518 28 HOH HOH A . C 3 HOH 119 519 204 HOH HOH A . C 3 HOH 120 520 145 HOH HOH A . C 3 HOH 121 521 121 HOH HOH A . C 3 HOH 122 522 74 HOH HOH A . C 3 HOH 123 523 101 HOH HOH A . C 3 HOH 124 524 4 HOH HOH A . C 3 HOH 125 525 21 HOH HOH A . C 3 HOH 126 526 50 HOH HOH A . C 3 HOH 127 527 214 HOH HOH A . C 3 HOH 128 528 20 HOH HOH A . C 3 HOH 129 529 102 HOH HOH A . C 3 HOH 130 530 226 HOH HOH A . C 3 HOH 131 531 94 HOH HOH A . C 3 HOH 132 532 195 HOH HOH A . C 3 HOH 133 533 86 HOH HOH A . C 3 HOH 134 534 199 HOH HOH A . C 3 HOH 135 535 7 HOH HOH A . C 3 HOH 136 536 37 HOH HOH A . C 3 HOH 137 537 267 HOH HOH A . C 3 HOH 138 538 114 HOH HOH A . C 3 HOH 139 539 45 HOH HOH A . C 3 HOH 140 540 293 HOH HOH A . C 3 HOH 141 541 49 HOH HOH A . C 3 HOH 142 542 117 HOH HOH A . C 3 HOH 143 543 247 HOH HOH A . C 3 HOH 144 544 3 HOH HOH A . C 3 HOH 145 545 146 HOH HOH A . C 3 HOH 146 546 48 HOH HOH A . C 3 HOH 147 547 111 HOH HOH A . C 3 HOH 148 548 275 HOH HOH A . C 3 HOH 149 549 227 HOH HOH A . C 3 HOH 150 550 191 HOH HOH A . C 3 HOH 151 551 128 HOH HOH A . C 3 HOH 152 552 15 HOH HOH A . C 3 HOH 153 553 19 HOH HOH A . C 3 HOH 154 554 78 HOH HOH A . C 3 HOH 155 555 1 HOH HOH A . C 3 HOH 156 556 304 HOH HOH A . C 3 HOH 157 557 77 HOH HOH A . C 3 HOH 158 558 27 HOH HOH A . C 3 HOH 159 559 81 HOH HOH A . C 3 HOH 160 560 109 HOH HOH A . C 3 HOH 161 561 75 HOH HOH A . C 3 HOH 162 562 156 HOH HOH A . C 3 HOH 163 563 51 HOH HOH A . C 3 HOH 164 564 291 HOH HOH A . C 3 HOH 165 565 68 HOH HOH A . C 3 HOH 166 566 202 HOH HOH A . C 3 HOH 167 567 127 HOH HOH A . C 3 HOH 168 568 223 HOH HOH A . C 3 HOH 169 569 104 HOH HOH A . C 3 HOH 170 570 67 HOH HOH A . C 3 HOH 171 571 135 HOH HOH A . C 3 HOH 172 572 229 HOH HOH A . C 3 HOH 173 573 57 HOH HOH A . C 3 HOH 174 574 40 HOH HOH A . C 3 HOH 175 575 230 HOH HOH A . C 3 HOH 176 576 288 HOH HOH A . C 3 HOH 177 577 25 HOH HOH A . C 3 HOH 178 578 235 HOH HOH A . C 3 HOH 179 579 52 HOH HOH A . C 3 HOH 180 580 100 HOH HOH A . C 3 HOH 181 581 192 HOH HOH A . C 3 HOH 182 582 152 HOH HOH A . C 3 HOH 183 583 9 HOH HOH A . C 3 HOH 184 584 38 HOH HOH A . C 3 HOH 185 585 207 HOH HOH A . C 3 HOH 186 586 113 HOH HOH A . C 3 HOH 187 587 306 HOH HOH A . C 3 HOH 188 588 276 HOH HOH A . C 3 HOH 189 589 116 HOH HOH A . C 3 HOH 190 590 242 HOH HOH A . C 3 HOH 191 591 292 HOH HOH A . C 3 HOH 192 592 119 HOH HOH A . C 3 HOH 193 593 105 HOH HOH A . C 3 HOH 194 594 13 HOH HOH A . C 3 HOH 195 595 177 HOH HOH A . C 3 HOH 196 596 215 HOH HOH A . C 3 HOH 197 597 189 HOH HOH A . C 3 HOH 198 598 209 HOH HOH A . C 3 HOH 199 599 254 HOH HOH A . C 3 HOH 200 600 266 HOH HOH A . C 3 HOH 201 601 99 HOH HOH A . C 3 HOH 202 602 12 HOH HOH A . C 3 HOH 203 603 294 HOH HOH A . C 3 HOH 204 604 248 HOH HOH A . C 3 HOH 205 605 53 HOH HOH A . C 3 HOH 206 606 61 HOH HOH A . C 3 HOH 207 607 33 HOH HOH A . C 3 HOH 208 608 185 HOH HOH A . C 3 HOH 209 609 221 HOH HOH A . C 3 HOH 210 610 262 HOH HOH A . C 3 HOH 211 611 26 HOH HOH A . C 3 HOH 212 612 220 HOH HOH A . C 3 HOH 213 613 126 HOH HOH A . C 3 HOH 214 614 218 HOH HOH A . C 3 HOH 215 615 241 HOH HOH A . C 3 HOH 216 616 181 HOH HOH A . C 3 HOH 217 617 107 HOH HOH A . C 3 HOH 218 618 63 HOH HOH A . C 3 HOH 219 619 225 HOH HOH A . C 3 HOH 220 620 115 HOH HOH A . C 3 HOH 221 621 299 HOH HOH A . C 3 HOH 222 622 219 HOH HOH A . C 3 HOH 223 623 149 HOH HOH A . C 3 HOH 224 624 76 HOH HOH A . C 3 HOH 225 625 123 HOH HOH A . C 3 HOH 226 626 140 HOH HOH A . C 3 HOH 227 627 175 HOH HOH A . C 3 HOH 228 628 141 HOH HOH A . C 3 HOH 229 629 188 HOH HOH A . C 3 HOH 230 630 182 HOH HOH A . C 3 HOH 231 631 85 HOH HOH A . C 3 HOH 232 632 136 HOH HOH A . C 3 HOH 233 633 252 HOH HOH A . C 3 HOH 234 634 155 HOH HOH A . C 3 HOH 235 635 32 HOH HOH A . C 3 HOH 236 636 263 HOH HOH A . C 3 HOH 237 637 92 HOH HOH A . C 3 HOH 238 638 257 HOH HOH A . C 3 HOH 239 639 178 HOH HOH A . C 3 HOH 240 640 66 HOH HOH A . C 3 HOH 241 641 277 HOH HOH A . C 3 HOH 242 642 300 HOH HOH A . C 3 HOH 243 643 172 HOH HOH A . C 3 HOH 244 644 196 HOH HOH A . C 3 HOH 245 645 93 HOH HOH A . C 3 HOH 246 646 203 HOH HOH A . C 3 HOH 247 647 211 HOH HOH A . C 3 HOH 248 648 65 HOH HOH A . C 3 HOH 249 649 285 HOH HOH A . C 3 HOH 250 650 216 HOH HOH A . C 3 HOH 251 651 296 HOH HOH A . C 3 HOH 252 652 260 HOH HOH A . C 3 HOH 253 653 180 HOH HOH A . C 3 HOH 254 654 297 HOH HOH A . C 3 HOH 255 655 176 HOH HOH A . C 3 HOH 256 656 256 HOH HOH A . C 3 HOH 257 657 166 HOH HOH A . C 3 HOH 258 658 193 HOH HOH A . C 3 HOH 259 659 261 HOH HOH A . C 3 HOH 260 660 160 HOH HOH A . C 3 HOH 261 661 268 HOH HOH A . C 3 HOH 262 662 269 HOH HOH A . C 3 HOH 263 663 246 HOH HOH A . C 3 HOH 264 664 163 HOH HOH A . C 3 HOH 265 665 190 HOH HOH A . C 3 HOH 266 666 148 HOH HOH A . C 3 HOH 267 667 96 HOH HOH A . C 3 HOH 268 668 243 HOH HOH A . C 3 HOH 269 669 278 HOH HOH A . C 3 HOH 270 670 284 HOH HOH A . C 3 HOH 271 671 302 HOH HOH A . C 3 HOH 272 672 206 HOH HOH A . C 3 HOH 273 673 144 HOH HOH A . C 3 HOH 274 674 255 HOH HOH A . C 3 HOH 275 675 79 HOH HOH A . C 3 HOH 276 676 283 HOH HOH A . C 3 HOH 277 677 98 HOH HOH A . C 3 HOH 278 678 274 HOH HOH A . C 3 HOH 279 679 124 HOH HOH A . C 3 HOH 280 680 205 HOH HOH A . C 3 HOH 281 681 251 HOH HOH A . C 3 HOH 282 682 83 HOH HOH A . C 3 HOH 283 683 173 HOH HOH A . C 3 HOH 284 684 169 HOH HOH A . C 3 HOH 285 685 201 HOH HOH A . C 3 HOH 286 686 301 HOH HOH A . C 3 HOH 287 687 240 HOH HOH A . C 3 HOH 288 688 168 HOH HOH A . C 3 HOH 289 689 183 HOH HOH A . C 3 HOH 290 690 69 HOH HOH A . C 3 HOH 291 691 280 HOH HOH A . C 3 HOH 292 692 265 HOH HOH A . C 3 HOH 293 693 244 HOH HOH A . C 3 HOH 294 694 289 HOH HOH A . C 3 HOH 295 695 154 HOH HOH A . C 3 HOH 296 696 134 HOH HOH A . C 3 HOH 297 697 112 HOH HOH A . C 3 HOH 298 698 213 HOH HOH A . C 3 HOH 299 699 286 HOH HOH A . C 3 HOH 300 700 272 HOH HOH A . C 3 HOH 301 701 171 HOH HOH A . C 3 HOH 302 702 245 HOH HOH A . C 3 HOH 303 703 239 HOH HOH A . C 3 HOH 304 704 305 HOH HOH A . C 3 HOH 305 705 217 HOH HOH A . C 3 HOH 306 706 287 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0069 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6BO0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.593 _cell.length_a_esd ? _cell.length_b 82.578 _cell.length_b_esd ? _cell.length_c 123.484 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6BO0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6BO0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.15 M citrate buffer, 31.4% PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6BO0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.200 _reflns.d_resolution_low 39.2 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 55421 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.000 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.018 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all 0.025 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.200 1.220 ? ? ? ? ? ? 1871 65.600 ? ? ? ? 0.343 ? ? ? ? ? ? ? ? 2.200 ? 0.831 ? ? 0.415 0.227 ? 1 1 0.826 ? 1.220 1.240 ? ? ? ? ? ? ? 78.500 ? ? ? ? 0.368 ? ? ? ? ? ? ? ? 2.400 ? 0.793 ? ? 0.447 0.246 ? 2 1 0.820 ? 1.240 1.270 ? ? ? ? ? ? ? 89.000 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 2.900 ? 0.818 ? ? 0.450 0.237 ? 3 1 0.832 ? 1.270 1.290 ? ? ? ? ? ? ? 95.200 ? ? ? ? 0.363 ? ? ? ? ? ? ? ? 3.800 ? 0.814 ? ? 0.418 0.203 ? 4 1 0.887 ? 1.290 1.320 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.358 ? ? ? ? ? ? ? ? 4.500 ? 0.830 ? ? 0.403 0.183 ? 5 1 0.923 ? 1.320 1.350 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.360 ? ? ? ? ? ? ? ? 4.900 ? 0.830 ? ? 0.402 0.176 ? 6 1 0.928 ? 1.350 1.390 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.344 ? ? ? ? ? ? ? ? 5.200 ? 0.837 ? ? 0.381 0.162 ? 7 1 0.949 ? 1.390 1.420 ? ? ? ? ? ? ? 99.600 ? ? ? ? 0.300 ? ? ? ? ? ? ? ? 5.200 ? 0.834 ? ? 0.333 0.142 ? 8 1 0.949 ? 1.420 1.460 ? ? ? ? ? ? ? 99.100 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 5.300 ? 0.867 ? ? 0.276 0.117 ? 9 1 0.967 ? 1.460 1.510 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.204 ? ? ? ? ? ? ? ? 5.600 ? 0.881 ? ? 0.224 0.091 ? 10 1 0.977 ? 1.510 1.570 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 5.700 ? 0.927 ? ? 0.182 0.074 ? 11 1 0.987 ? 1.570 1.630 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 5.500 ? 0.956 ? ? 0.155 0.064 ? 12 1 0.989 ? 1.630 1.700 ? ? ? ? ? ? ? 99.300 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 5.200 ? 0.971 ? ? 0.135 0.058 ? 13 1 0.989 ? 1.700 1.790 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 5.700 ? 1.018 ? ? 0.110 0.045 ? 14 1 0.993 ? 1.790 1.900 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 5.700 ? 1.098 ? ? 0.092 0.038 ? 15 1 0.994 ? 1.900 2.050 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 5.600 ? 1.201 ? ? 0.076 0.031 ? 16 1 0.996 ? 2.050 2.260 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 5.400 ? 1.298 ? ? 0.065 0.027 ? 17 1 0.996 ? 2.260 2.590 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 5.800 ? 1.267 ? ? 0.057 0.023 ? 18 1 0.997 ? 2.590 3.260 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 5.400 ? 1.333 ? ? 0.049 0.021 ? 19 1 0.998 ? 3.260 39.2 ? ? ? ? ? ? ? 99.300 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 5.500 ? 1.261 ? ? 0.041 0.017 ? 20 1 0.998 ? # _refine.aniso_B[1][1] 0.1500 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -0.1900 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 0.0400 _refine.B_iso_max 67.330 _refine.B_iso_mean 19.7050 _refine.B_iso_min 8.950 _refine.correlation_coeff_Fo_to_Fc 0.9830 _refine.correlation_coeff_Fo_to_Fc_free 0.9740 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6BO0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2000 _refine.ls_d_res_low 39.2000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 52711 _refine.ls_number_reflns_R_free 2670 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.2500 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1236 _refine.ls_R_factor_R_free 0.1545 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1221 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5c00 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0360 _refine.pdbx_overall_ESU_R_Free 0.0370 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.1850 _refine.overall_SU_ML 0.0240 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.2000 _refine_hist.d_res_low 39.2000 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 306 _refine_hist.number_atoms_total 1885 _refine_hist.pdbx_number_residues_total 199 _refine_hist.pdbx_B_iso_mean_ligand 32.10 _refine_hist.pdbx_B_iso_mean_solvent 32.74 _refine_hist.pdbx_number_atoms_protein 1566 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.020 1746 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1690 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.464 1.967 2365 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.739 3.000 3964 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.000 5.000 239 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.984 27.024 84 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.370 15.000 359 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.787 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.082 0.200 257 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2000 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 363 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 2.317 3.000 3436 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 32.531 5.000 51 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 10.922 5.000 3648 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.1990 _refine_ls_shell.d_res_low 1.2300 _refine_ls_shell.number_reflns_all 2891 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 125 _refine_ls_shell.number_reflns_R_work 2766 _refine_ls_shell.percent_reflns_obs 68.6400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2780 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2540 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6BO0 _struct.title 'MdbA protein, a thiol-disulfide oxidoreductase from Corynebacterium matruchotii' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6BO0 _struct_keywords.text 'MdbA, disulfide, oxidoreductase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E0DH37_9CORY _struct_ref.pdbx_db_accession E0DH37 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SQEEKFAETYNETTAFNNKVDGSAVQLVSDKADKAKTVDIYEDFSCHYCSQLAKETDADMKKLIEDGKVKVNIRTMNFLD KGEIGHSNKAGTAAYTIAKDDSAQVYWNFRTMLMTEQQNIWGKKELKDLADMAKILGAKDETVKKIADGTYSDEFKKIAD DNAKKLEKDGDGQVSSPRVFIDGKEIKENATWPSQIK ; _struct_ref.pdbx_align_begin 46 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6BO0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E0DH37 _struct_ref_seq.db_align_beg 46 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 242 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 46 _struct_ref_seq.pdbx_auth_seq_align_end 242 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6BO0 SER A 1 ? UNP E0DH37 ? ? 'expression tag' 43 1 1 6BO0 ASN A 2 ? UNP E0DH37 ? ? 'expression tag' 44 2 1 6BO0 ALA A 3 ? UNP E0DH37 ? ? 'expression tag' 45 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 220 ? 1 MORE 3 ? 1 'SSA (A^2)' 9950 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 2 ? LYS A 8 ? ASN A 44 LYS A 50 1 ? 7 HELX_P HELX_P2 AA2 LYS A 8 ? TYR A 13 ? LYS A 50 TYR A 55 1 ? 6 HELX_P HELX_P3 AA3 CSO A 49 ? ASP A 69 ? CSO A 91 ASP A 111 1 ? 21 HELX_P HELX_P4 AA4 ASN A 80 ? LYS A 84 ? ASN A 122 LYS A 126 5 ? 5 HELX_P HELX_P5 AA5 GLY A 88 ? ASP A 104 ? GLY A 130 ASP A 146 1 ? 17 HELX_P HELX_P6 AA6 SER A 105 ? GLU A 119 ? SER A 147 GLU A 161 1 ? 15 HELX_P HELX_P7 AA7 GLU A 119 ? TRP A 124 ? GLU A 161 TRP A 166 1 ? 6 HELX_P HELX_P8 AA8 GLU A 128 ? LEU A 139 ? GLU A 170 LEU A 181 1 ? 12 HELX_P HELX_P9 AA9 LYS A 142 ? GLY A 152 ? LYS A 184 GLY A 194 1 ? 11 HELX_P HELX_P10 AB1 TYR A 154 ? GLY A 173 ? TYR A 196 GLY A 215 1 ? 20 HELX_P HELX_P11 AB2 GLU A 191 ? ILE A 199 ? GLU A 233 ILE A 241 5 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 48 C ? ? ? 1_555 A CSO 49 N ? ? A SER 90 A CSO 91 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale2 covale both ? A CSO 49 C ? ? ? 1_555 A HIS 50 N ? ? A CSO 91 A HIS 92 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CSO _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 49 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id CSO _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 91 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CSO _pdbx_modification_feature.type Hydroxylation _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 179 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 221 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 180 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 222 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.70 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 20 ? ASP A 24 ? ASN A 62 ASP A 66 AA1 2 ALA A 27 ? VAL A 31 ? ALA A 69 VAL A 73 AA1 3 VAL A 72 ? THR A 78 ? VAL A 114 THR A 120 AA1 4 LYS A 39 ? GLU A 45 ? LYS A 81 GLU A 87 AA1 5 ARG A 181 ? ILE A 184 ? ARG A 223 ILE A 226 AA1 6 LYS A 187 ? GLU A 188 ? LYS A 229 GLU A 230 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 22 ? N LYS A 64 O GLN A 29 ? O GLN A 71 AA1 2 3 N LEU A 30 ? N LEU A 72 O VAL A 74 ? O VAL A 116 AA1 3 4 O ARG A 77 ? O ARG A 119 N ILE A 43 ? N ILE A 85 AA1 4 5 N TYR A 44 ? N TYR A 86 O ARG A 181 ? O ARG A 223 AA1 5 6 N ILE A 184 ? N ILE A 226 O LYS A 187 ? O LYS A 229 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PG4 _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue PG4 A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 TRP A 124 ? TRP A 166 . ? 3_555 ? 2 AC1 6 TRP A 124 ? TRP A 166 . ? 1_555 ? 3 AC1 6 GLY A 125 ? GLY A 167 . ? 3_555 ? 4 AC1 6 GLY A 125 ? GLY A 167 . ? 1_555 ? 5 AC1 6 LYS A 126 ? LYS A 168 . ? 3_555 ? 6 AC1 6 LYS A 126 ? LYS A 168 . ? 1_555 ? # _pdbx_entry_details.entry_id 6BO0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 55 ? ? -114.51 76.51 2 1 ASN A 56 ? ? -141.61 39.12 3 1 ASP A 146 ? ? -129.09 -167.82 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSO _pdbx_struct_mod_residue.label_seq_id 49 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSO _pdbx_struct_mod_residue.auth_seq_id 91 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A PG4 301 ? B PG4 . 2 1 A HOH 488 ? C HOH . 3 1 A HOH 669 ? C HOH . 4 1 A HOH 703 ? C HOH . 5 1 A HOH 704 ? C HOH . # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 706 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 7.25 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id SER _pdbx_unobs_or_zero_occ_residues.auth_seq_id 43 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id SER _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSO N N N N 74 CSO CA C N R 75 CSO CB C N N 76 CSO SG S N N 77 CSO C C N N 78 CSO O O N N 79 CSO OXT O N N 80 CSO OD O N N 81 CSO H H N N 82 CSO H2 H N N 83 CSO HA H N N 84 CSO HB2 H N N 85 CSO HB3 H N N 86 CSO HXT H N N 87 CSO HD H N N 88 CYS N N N N 89 CYS CA C N R 90 CYS C C N N 91 CYS O O N N 92 CYS CB C N N 93 CYS SG S N N 94 CYS OXT O N N 95 CYS H H N N 96 CYS H2 H N N 97 CYS HA H N N 98 CYS HB2 H N N 99 CYS HB3 H N N 100 CYS HG H N N 101 CYS HXT H N N 102 GLN N N N N 103 GLN CA C N S 104 GLN C C N N 105 GLN O O N N 106 GLN CB C N N 107 GLN CG C N N 108 GLN CD C N N 109 GLN OE1 O N N 110 GLN NE2 N N N 111 GLN OXT O N N 112 GLN H H N N 113 GLN H2 H N N 114 GLN HA H N N 115 GLN HB2 H N N 116 GLN HB3 H N N 117 GLN HG2 H N N 118 GLN HG3 H N N 119 GLN HE21 H N N 120 GLN HE22 H N N 121 GLN HXT H N N 122 GLU N N N N 123 GLU CA C N S 124 GLU C C N N 125 GLU O O N N 126 GLU CB C N N 127 GLU CG C N N 128 GLU CD C N N 129 GLU OE1 O N N 130 GLU OE2 O N N 131 GLU OXT O N N 132 GLU H H N N 133 GLU H2 H N N 134 GLU HA H N N 135 GLU HB2 H N N 136 GLU HB3 H N N 137 GLU HG2 H N N 138 GLU HG3 H N N 139 GLU HE2 H N N 140 GLU HXT H N N 141 GLY N N N N 142 GLY CA C N N 143 GLY C C N N 144 GLY O O N N 145 GLY OXT O N N 146 GLY H H N N 147 GLY H2 H N N 148 GLY HA2 H N N 149 GLY HA3 H N N 150 GLY HXT H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 PG4 O1 O N N 265 PG4 C1 C N N 266 PG4 C2 C N N 267 PG4 O2 O N N 268 PG4 C3 C N N 269 PG4 C4 C N N 270 PG4 O3 O N N 271 PG4 C5 C N N 272 PG4 C6 C N N 273 PG4 O4 O N N 274 PG4 C7 C N N 275 PG4 C8 C N N 276 PG4 O5 O N N 277 PG4 HO1 H N N 278 PG4 H11 H N N 279 PG4 H12 H N N 280 PG4 H21 H N N 281 PG4 H22 H N N 282 PG4 H31 H N N 283 PG4 H32 H N N 284 PG4 H41 H N N 285 PG4 H42 H N N 286 PG4 H51 H N N 287 PG4 H52 H N N 288 PG4 H61 H N N 289 PG4 H62 H N N 290 PG4 H71 H N N 291 PG4 H72 H N N 292 PG4 H81 H N N 293 PG4 H82 H N N 294 PG4 HO5 H N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 CYS N CA sing N N 84 CYS N H sing N N 85 CYS N H2 sing N N 86 CYS CA C sing N N 87 CYS CA CB sing N N 88 CYS CA HA sing N N 89 CYS C O doub N N 90 CYS C OXT sing N N 91 CYS CB SG sing N N 92 CYS CB HB2 sing N N 93 CYS CB HB3 sing N N 94 CYS SG HG sing N N 95 CYS OXT HXT sing N N 96 GLN N CA sing N N 97 GLN N H sing N N 98 GLN N H2 sing N N 99 GLN CA C sing N N 100 GLN CA CB sing N N 101 GLN CA HA sing N N 102 GLN C O doub N N 103 GLN C OXT sing N N 104 GLN CB CG sing N N 105 GLN CB HB2 sing N N 106 GLN CB HB3 sing N N 107 GLN CG CD sing N N 108 GLN CG HG2 sing N N 109 GLN CG HG3 sing N N 110 GLN CD OE1 doub N N 111 GLN CD NE2 sing N N 112 GLN NE2 HE21 sing N N 113 GLN NE2 HE22 sing N N 114 GLN OXT HXT sing N N 115 GLU N CA sing N N 116 GLU N H sing N N 117 GLU N H2 sing N N 118 GLU CA C sing N N 119 GLU CA CB sing N N 120 GLU CA HA sing N N 121 GLU C O doub N N 122 GLU C OXT sing N N 123 GLU CB CG sing N N 124 GLU CB HB2 sing N N 125 GLU CB HB3 sing N N 126 GLU CG CD sing N N 127 GLU CG HG2 sing N N 128 GLU CG HG3 sing N N 129 GLU CD OE1 doub N N 130 GLU CD OE2 sing N N 131 GLU OE2 HE2 sing N N 132 GLU OXT HXT sing N N 133 GLY N CA sing N N 134 GLY N H sing N N 135 GLY N H2 sing N N 136 GLY CA C sing N N 137 GLY CA HA2 sing N N 138 GLY CA HA3 sing N N 139 GLY C O doub N N 140 GLY C OXT sing N N 141 GLY OXT HXT sing N N 142 HIS N CA sing N N 143 HIS N H sing N N 144 HIS N H2 sing N N 145 HIS CA C sing N N 146 HIS CA CB sing N N 147 HIS CA HA sing N N 148 HIS C O doub N N 149 HIS C OXT sing N N 150 HIS CB CG sing N N 151 HIS CB HB2 sing N N 152 HIS CB HB3 sing N N 153 HIS CG ND1 sing Y N 154 HIS CG CD2 doub Y N 155 HIS ND1 CE1 doub Y N 156 HIS ND1 HD1 sing N N 157 HIS CD2 NE2 sing Y N 158 HIS CD2 HD2 sing N N 159 HIS CE1 NE2 sing Y N 160 HIS CE1 HE1 sing N N 161 HIS NE2 HE2 sing N N 162 HIS OXT HXT sing N N 163 HOH O H1 sing N N 164 HOH O H2 sing N N 165 ILE N CA sing N N 166 ILE N H sing N N 167 ILE N H2 sing N N 168 ILE CA C sing N N 169 ILE CA CB sing N N 170 ILE CA HA sing N N 171 ILE C O doub N N 172 ILE C OXT sing N N 173 ILE CB CG1 sing N N 174 ILE CB CG2 sing N N 175 ILE CB HB sing N N 176 ILE CG1 CD1 sing N N 177 ILE CG1 HG12 sing N N 178 ILE CG1 HG13 sing N N 179 ILE CG2 HG21 sing N N 180 ILE CG2 HG22 sing N N 181 ILE CG2 HG23 sing N N 182 ILE CD1 HD11 sing N N 183 ILE CD1 HD12 sing N N 184 ILE CD1 HD13 sing N N 185 ILE OXT HXT sing N N 186 LEU N CA sing N N 187 LEU N H sing N N 188 LEU N H2 sing N N 189 LEU CA C sing N N 190 LEU CA CB sing N N 191 LEU CA HA sing N N 192 LEU C O doub N N 193 LEU C OXT sing N N 194 LEU CB CG sing N N 195 LEU CB HB2 sing N N 196 LEU CB HB3 sing N N 197 LEU CG CD1 sing N N 198 LEU CG CD2 sing N N 199 LEU CG HG sing N N 200 LEU CD1 HD11 sing N N 201 LEU CD1 HD12 sing N N 202 LEU CD1 HD13 sing N N 203 LEU CD2 HD21 sing N N 204 LEU CD2 HD22 sing N N 205 LEU CD2 HD23 sing N N 206 LEU OXT HXT sing N N 207 LYS N CA sing N N 208 LYS N H sing N N 209 LYS N H2 sing N N 210 LYS CA C sing N N 211 LYS CA CB sing N N 212 LYS CA HA sing N N 213 LYS C O doub N N 214 LYS C OXT sing N N 215 LYS CB CG sing N N 216 LYS CB HB2 sing N N 217 LYS CB HB3 sing N N 218 LYS CG CD sing N N 219 LYS CG HG2 sing N N 220 LYS CG HG3 sing N N 221 LYS CD CE sing N N 222 LYS CD HD2 sing N N 223 LYS CD HD3 sing N N 224 LYS CE NZ sing N N 225 LYS CE HE2 sing N N 226 LYS CE HE3 sing N N 227 LYS NZ HZ1 sing N N 228 LYS NZ HZ2 sing N N 229 LYS NZ HZ3 sing N N 230 LYS OXT HXT sing N N 231 MET N CA sing N N 232 MET N H sing N N 233 MET N H2 sing N N 234 MET CA C sing N N 235 MET CA CB sing N N 236 MET CA HA sing N N 237 MET C O doub N N 238 MET C OXT sing N N 239 MET CB CG sing N N 240 MET CB HB2 sing N N 241 MET CB HB3 sing N N 242 MET CG SD sing N N 243 MET CG HG2 sing N N 244 MET CG HG3 sing N N 245 MET SD CE sing N N 246 MET CE HE1 sing N N 247 MET CE HE2 sing N N 248 MET CE HE3 sing N N 249 MET OXT HXT sing N N 250 PG4 O1 C1 sing N N 251 PG4 O1 HO1 sing N N 252 PG4 C1 C2 sing N N 253 PG4 C1 H11 sing N N 254 PG4 C1 H12 sing N N 255 PG4 C2 O2 sing N N 256 PG4 C2 H21 sing N N 257 PG4 C2 H22 sing N N 258 PG4 O2 C3 sing N N 259 PG4 C3 C4 sing N N 260 PG4 C3 H31 sing N N 261 PG4 C3 H32 sing N N 262 PG4 C4 O3 sing N N 263 PG4 C4 H41 sing N N 264 PG4 C4 H42 sing N N 265 PG4 O3 C5 sing N N 266 PG4 C5 C6 sing N N 267 PG4 C5 H51 sing N N 268 PG4 C5 H52 sing N N 269 PG4 C6 O4 sing N N 270 PG4 C6 H61 sing N N 271 PG4 C6 H62 sing N N 272 PG4 O4 C7 sing N N 273 PG4 C7 C8 sing N N 274 PG4 C7 H71 sing N N 275 PG4 C7 H72 sing N N 276 PG4 C8 O5 sing N N 277 PG4 C8 H81 sing N N 278 PG4 C8 H82 sing N N 279 PG4 O5 HO5 sing N N 280 PHE N CA sing N N 281 PHE N H sing N N 282 PHE N H2 sing N N 283 PHE CA C sing N N 284 PHE CA CB sing N N 285 PHE CA HA sing N N 286 PHE C O doub N N 287 PHE C OXT sing N N 288 PHE CB CG sing N N 289 PHE CB HB2 sing N N 290 PHE CB HB3 sing N N 291 PHE CG CD1 doub Y N 292 PHE CG CD2 sing Y N 293 PHE CD1 CE1 sing Y N 294 PHE CD1 HD1 sing N N 295 PHE CD2 CE2 doub Y N 296 PHE CD2 HD2 sing N N 297 PHE CE1 CZ doub Y N 298 PHE CE1 HE1 sing N N 299 PHE CE2 CZ sing Y N 300 PHE CE2 HE2 sing N N 301 PHE CZ HZ sing N N 302 PHE OXT HXT sing N N 303 PRO N CA sing N N 304 PRO N CD sing N N 305 PRO N H sing N N 306 PRO CA C sing N N 307 PRO CA CB sing N N 308 PRO CA HA sing N N 309 PRO C O doub N N 310 PRO C OXT sing N N 311 PRO CB CG sing N N 312 PRO CB HB2 sing N N 313 PRO CB HB3 sing N N 314 PRO CG CD sing N N 315 PRO CG HG2 sing N N 316 PRO CG HG3 sing N N 317 PRO CD HD2 sing N N 318 PRO CD HD3 sing N N 319 PRO OXT HXT sing N N 320 SER N CA sing N N 321 SER N H sing N N 322 SER N H2 sing N N 323 SER CA C sing N N 324 SER CA CB sing N N 325 SER CA HA sing N N 326 SER C O doub N N 327 SER C OXT sing N N 328 SER CB OG sing N N 329 SER CB HB2 sing N N 330 SER CB HB3 sing N N 331 SER OG HG sing N N 332 SER OXT HXT sing N N 333 THR N CA sing N N 334 THR N H sing N N 335 THR N H2 sing N N 336 THR CA C sing N N 337 THR CA CB sing N N 338 THR CA HA sing N N 339 THR C O doub N N 340 THR C OXT sing N N 341 THR CB OG1 sing N N 342 THR CB CG2 sing N N 343 THR CB HB sing N N 344 THR OG1 HG1 sing N N 345 THR CG2 HG21 sing N N 346 THR CG2 HG22 sing N N 347 THR CG2 HG23 sing N N 348 THR OXT HXT sing N N 349 TRP N CA sing N N 350 TRP N H sing N N 351 TRP N H2 sing N N 352 TRP CA C sing N N 353 TRP CA CB sing N N 354 TRP CA HA sing N N 355 TRP C O doub N N 356 TRP C OXT sing N N 357 TRP CB CG sing N N 358 TRP CB HB2 sing N N 359 TRP CB HB3 sing N N 360 TRP CG CD1 doub Y N 361 TRP CG CD2 sing Y N 362 TRP CD1 NE1 sing Y N 363 TRP CD1 HD1 sing N N 364 TRP CD2 CE2 doub Y N 365 TRP CD2 CE3 sing Y N 366 TRP NE1 CE2 sing Y N 367 TRP NE1 HE1 sing N N 368 TRP CE2 CZ2 sing Y N 369 TRP CE3 CZ3 doub Y N 370 TRP CE3 HE3 sing N N 371 TRP CZ2 CH2 doub Y N 372 TRP CZ2 HZ2 sing N N 373 TRP CZ3 CH2 sing Y N 374 TRP CZ3 HZ3 sing N N 375 TRP CH2 HH2 sing N N 376 TRP OXT HXT sing N N 377 TYR N CA sing N N 378 TYR N H sing N N 379 TYR N H2 sing N N 380 TYR CA C sing N N 381 TYR CA CB sing N N 382 TYR CA HA sing N N 383 TYR C O doub N N 384 TYR C OXT sing N N 385 TYR CB CG sing N N 386 TYR CB HB2 sing N N 387 TYR CB HB3 sing N N 388 TYR CG CD1 doub Y N 389 TYR CG CD2 sing Y N 390 TYR CD1 CE1 sing Y N 391 TYR CD1 HD1 sing N N 392 TYR CD2 CE2 doub Y N 393 TYR CD2 HD2 sing N N 394 TYR CE1 CZ doub Y N 395 TYR CE1 HE1 sing N N 396 TYR CE2 CZ sing Y N 397 TYR CE2 HE2 sing N N 398 TYR CZ OH sing N N 399 TYR OH HH sing N N 400 TYR OXT HXT sing N N 401 VAL N CA sing N N 402 VAL N H sing N N 403 VAL N H2 sing N N 404 VAL CA C sing N N 405 VAL CA CB sing N N 406 VAL CA HA sing N N 407 VAL C O doub N N 408 VAL C OXT sing N N 409 VAL CB CG1 sing N N 410 VAL CB CG2 sing N N 411 VAL CB HB sing N N 412 VAL CG1 HG11 sing N N 413 VAL CG1 HG12 sing N N 414 VAL CG1 HG13 sing N N 415 VAL CG2 HG21 sing N N 416 VAL CG2 HG22 sing N N 417 VAL CG2 HG23 sing N N 418 VAL OXT HXT sing N N 419 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272200700058C 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272201200026C 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5C00 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6BO0 _atom_sites.fract_transf_matrix[1][1] 0.028095 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012110 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008098 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_