data_6CD3 # _entry.id 6CD3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6CD3 pdb_00006cd3 10.2210/pdb6cd3/pdb WWPDB D_1000232562 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CD3 _pdbx_database_status.recvd_initial_deposition_date 2018-02-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yang, Y.' 1 ? 'Liu, F.' 2 ? 'Liu, A.' 3 0000-0002-4182-8176 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 293 _citation.language ? _citation.page_first 10415 _citation.page_last 10424 _citation.title ;Adapting to oxygen: 3-Hydroxyanthrinilate 3,4-dioxygenase employs loop dynamics to accommodate two substrates with disparate polarities. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.002698 _citation.pdbx_database_id_PubMed 29784877 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, Y.' 1 ? primary 'Liu, F.' 2 ? primary 'Liu, A.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6CD3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.410 _cell.length_a_esd ? _cell.length_b 58.410 _cell.length_b_esd ? _cell.length_c 230.814 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CD3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-hydroxyanthranilate 3,4-dioxygenase' 22548.297 1 1.13.11.6 I142A ? ? 2 non-polymer syn 'FE (II) ION' 55.845 2 ? ? ? ? 3 non-polymer syn '3-HYDROXYANTHRANILIC ACID' 153.135 1 ? ? ? ? 4 water nat water 18.015 63 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '3-hydroxyanthranilate oxygenase,3-HAO,3-hydroxyanthranilic acid dioxygenase,HAD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHHHHHSSGHIEGRHMLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFF YQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQL KSAVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHHHHHSSGHIEGRHMLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFF YQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQL KSAVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 HIS n 1 17 ILE n 1 18 GLU n 1 19 GLY n 1 20 ARG n 1 21 HIS n 1 22 MET n 1 23 LEU n 1 24 THR n 1 25 TYR n 1 26 GLY n 1 27 ALA n 1 28 PRO n 1 29 PHE n 1 30 ASN n 1 31 PHE n 1 32 PRO n 1 33 ARG n 1 34 TRP n 1 35 ILE n 1 36 ASP n 1 37 GLU n 1 38 HIS n 1 39 ALA n 1 40 HIS n 1 41 LEU n 1 42 LEU n 1 43 LYS n 1 44 PRO n 1 45 PRO n 1 46 VAL n 1 47 GLY n 1 48 ASN n 1 49 ARG n 1 50 GLN n 1 51 VAL n 1 52 TRP n 1 53 GLN n 1 54 ASP n 1 55 SER n 1 56 ASP n 1 57 PHE n 1 58 ILE n 1 59 VAL n 1 60 THR n 1 61 VAL n 1 62 VAL n 1 63 GLY n 1 64 GLY n 1 65 PRO n 1 66 ASN n 1 67 HIS n 1 68 ARG n 1 69 THR n 1 70 ASP n 1 71 TYR n 1 72 HIS n 1 73 ASP n 1 74 ASP n 1 75 PRO n 1 76 LEU n 1 77 GLU n 1 78 GLU n 1 79 PHE n 1 80 PHE n 1 81 TYR n 1 82 GLN n 1 83 LEU n 1 84 ARG n 1 85 GLY n 1 86 ASN n 1 87 ALA n 1 88 TYR n 1 89 LEU n 1 90 ASN n 1 91 LEU n 1 92 TRP n 1 93 VAL n 1 94 ASP n 1 95 GLY n 1 96 ARG n 1 97 ARG n 1 98 GLU n 1 99 ARG n 1 100 ALA n 1 101 ASP n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 GLY n 1 106 ASP n 1 107 ILE n 1 108 PHE n 1 109 LEU n 1 110 LEU n 1 111 PRO n 1 112 PRO n 1 113 HIS n 1 114 VAL n 1 115 ARG n 1 116 HIS n 1 117 SER n 1 118 PRO n 1 119 GLN n 1 120 ARG n 1 121 PRO n 1 122 GLU n 1 123 ALA n 1 124 GLY n 1 125 SER n 1 126 ALA n 1 127 CYS n 1 128 LEU n 1 129 VAL n 1 130 ILE n 1 131 GLU n 1 132 ARG n 1 133 GLN n 1 134 ARG n 1 135 PRO n 1 136 ALA n 1 137 GLY n 1 138 MET n 1 139 LEU n 1 140 ASP n 1 141 GLY n 1 142 PHE n 1 143 GLU n 1 144 TRP n 1 145 TYR n 1 146 CYS n 1 147 ASP n 1 148 ALA n 1 149 CYS n 1 150 GLY n 1 151 HIS n 1 152 LEU n 1 153 VAL n 1 154 HIS n 1 155 ARG n 1 156 VAL n 1 157 GLU n 1 158 VAL n 1 159 GLN n 1 160 LEU n 1 161 LYS n 1 162 SER n 1 163 ALA n 1 164 VAL n 1 165 THR n 1 166 ASP n 1 167 LEU n 1 168 PRO n 1 169 PRO n 1 170 LEU n 1 171 PHE n 1 172 GLU n 1 173 SER n 1 174 PHE n 1 175 TYR n 1 176 ALA n 1 177 SER n 1 178 GLU n 1 179 ASP n 1 180 LYS n 1 181 ARG n 1 182 ARG n 1 183 CYS n 1 184 PRO n 1 185 HIS n 1 186 CYS n 1 187 GLY n 1 188 GLN n 1 189 VAL n 1 190 HIS n 1 191 PRO n 1 192 GLY n 1 193 ARG n 1 194 ALA n 1 195 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 195 _entity_src_gen.gene_src_common_name 'Ralstonia metallidurans' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nbaC, Rmet_5193' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cupriavidus metallidurans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 119219 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code 3HAO_CUPMC _struct_ref.pdbx_db_accession Q1LCS4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERAD LKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKR RCPHCGQVHPGRAA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CD3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 195 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1LCS4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6CD3 MET A 1 ? UNP Q1LCS4 ? ? 'expression tag' -20 1 1 6CD3 GLY A 2 ? UNP Q1LCS4 ? ? 'expression tag' -19 2 1 6CD3 HIS A 3 ? UNP Q1LCS4 ? ? 'expression tag' -18 3 1 6CD3 HIS A 4 ? UNP Q1LCS4 ? ? 'expression tag' -17 4 1 6CD3 HIS A 5 ? UNP Q1LCS4 ? ? 'expression tag' -16 5 1 6CD3 HIS A 6 ? UNP Q1LCS4 ? ? 'expression tag' -15 6 1 6CD3 HIS A 7 ? UNP Q1LCS4 ? ? 'expression tag' -14 7 1 6CD3 HIS A 8 ? UNP Q1LCS4 ? ? 'expression tag' -13 8 1 6CD3 HIS A 9 ? UNP Q1LCS4 ? ? 'expression tag' -12 9 1 6CD3 HIS A 10 ? UNP Q1LCS4 ? ? 'expression tag' -11 10 1 6CD3 HIS A 11 ? UNP Q1LCS4 ? ? 'expression tag' -10 11 1 6CD3 HIS A 12 ? UNP Q1LCS4 ? ? 'expression tag' -9 12 1 6CD3 SER A 13 ? UNP Q1LCS4 ? ? 'expression tag' -8 13 1 6CD3 SER A 14 ? UNP Q1LCS4 ? ? 'expression tag' -7 14 1 6CD3 GLY A 15 ? UNP Q1LCS4 ? ? 'expression tag' -6 15 1 6CD3 HIS A 16 ? UNP Q1LCS4 ? ? 'expression tag' -5 16 1 6CD3 ILE A 17 ? UNP Q1LCS4 ? ? 'expression tag' -4 17 1 6CD3 GLU A 18 ? UNP Q1LCS4 ? ? 'expression tag' -3 18 1 6CD3 GLY A 19 ? UNP Q1LCS4 ? ? 'expression tag' -2 19 1 6CD3 ARG A 20 ? UNP Q1LCS4 ? ? 'expression tag' -1 20 1 6CD3 HIS A 21 ? UNP Q1LCS4 ? ? 'expression tag' 0 21 1 6CD3 ALA A 163 ? UNP Q1LCS4 ILE 142 'engineered mutation' 142 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 3HA non-polymer . '3-HYDROXYANTHRANILIC ACID' '2-AMINO-3-HYDROXYBENZOIC ACID' 'C7 H7 N O3' 153.135 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CD3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 8000 13%, 0.1 M Tris-HCl, 0.2 M MgCl2, pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-12-03 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 32.520 _reflns.entry_id 6CD3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7693 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.200 _reflns.pdbx_Rmerge_I_obs 0.178 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.031 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.600 2.640 ? ? ? ? ? ? 350 87.100 ? ? ? ? 0.439 ? ? ? ? ? ? ? ? 7.500 ? 0.863 ? ? ? ? ? 1 1 ? ? 2.640 2.690 ? ? ? ? ? ? 308 89.500 ? ? ? ? 0.384 ? ? ? ? ? ? ? ? 9.000 ? 0.840 ? ? ? ? ? 2 1 ? ? 2.690 2.740 ? ? ? ? ? ? 366 96.300 ? ? ? ? 0.418 ? ? ? ? ? ? ? ? 9.200 ? 0.824 ? ? ? ? ? 3 1 ? ? 2.740 2.800 ? ? ? ? ? ? 368 98.900 ? ? ? ? 0.391 ? ? ? ? ? ? ? ? 10.500 ? 0.818 ? ? ? ? ? 4 1 ? ? 2.800 2.860 ? ? ? ? ? ? 367 100.000 ? ? ? ? 0.412 ? ? ? ? ? ? ? ? 11.900 ? 0.855 ? ? ? ? ? 5 1 ? ? 2.860 2.930 ? ? ? ? ? ? 379 99.700 ? ? ? ? 0.428 ? ? ? ? ? ? ? ? 13.200 ? 0.850 ? ? ? ? ? 6 1 ? ? 2.930 3.000 ? ? ? ? ? ? 373 100.000 ? ? ? ? 0.370 ? ? ? ? ? ? ? ? 14.800 ? 0.882 ? ? ? ? ? 7 1 ? ? 3.000 3.080 ? ? ? ? ? ? 382 100.000 ? ? ? ? 0.350 ? ? ? ? ? ? ? ? 15.700 ? 0.899 ? ? ? ? ? 8 1 ? ? 3.080 3.170 ? ? ? ? ? ? 379 100.000 ? ? ? ? 0.271 ? ? ? ? ? ? ? ? 16.400 ? 0.924 ? ? ? ? ? 9 1 ? ? 3.170 3.280 ? ? ? ? ? ? 381 100.000 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? 16.800 ? 0.949 ? ? ? ? ? 10 1 ? ? 3.280 3.390 ? ? ? ? ? ? 384 100.000 ? ? ? ? 0.212 ? ? ? ? ? ? ? ? 17.200 ? 0.948 ? ? ? ? ? 11 1 ? ? 3.390 3.530 ? ? ? ? ? ? 369 100.000 ? ? ? ? 0.188 ? ? ? ? ? ? ? ? 17.500 ? 1.013 ? ? ? ? ? 12 1 ? ? 3.530 3.690 ? ? ? ? ? ? 397 100.000 ? ? ? ? 0.186 ? ? ? ? ? ? ? ? 17.500 ? 1.046 ? ? ? ? ? 13 1 ? ? 3.690 3.880 ? ? ? ? ? ? 393 100.000 ? ? ? ? 0.177 ? ? ? ? ? ? ? ? 18.000 ? 1.164 ? ? ? ? ? 14 1 ? ? 3.880 4.130 ? ? ? ? ? ? 392 100.000 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 18.000 ? 1.255 ? ? ? ? ? 15 1 ? ? 4.130 4.450 ? ? ? ? ? ? 394 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 18.200 ? 1.502 ? ? ? ? ? 16 1 ? ? 4.450 4.890 ? ? ? ? ? ? 399 100.000 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 17.800 ? 1.394 ? ? ? ? ? 17 1 ? ? 4.890 5.600 ? ? ? ? ? ? 409 100.000 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 17.400 ? 1.034 ? ? ? ? ? 18 1 ? ? 5.600 7.050 ? ? ? ? ? ? 427 100.000 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 16.900 ? 0.961 ? ? ? ? ? 19 1 ? ? 7.050 50.000 ? ? ? ? ? ? 476 95.800 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 16.100 ? 0.940 ? ? ? ? ? 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 75.700 _refine.B_iso_mean 31.1942 _refine.B_iso_min 15.150 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CD3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6120 _refine.ls_d_res_low 25.0620 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7614 _refine.ls_number_reflns_R_free 762 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.0800 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1975 _refine.ls_R_factor_R_free 0.2488 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1918 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4L2N _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.0000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6120 _refine_hist.d_res_low 25.0620 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 63 _refine_hist.number_atoms_total 1453 _refine_hist.pdbx_number_residues_total 170 _refine_hist.pdbx_B_iso_mean_ligand 36.19 _refine_hist.pdbx_B_iso_mean_solvent 28.94 _refine_hist.pdbx_number_atoms_protein 1377 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1435 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.974 ? 1956 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.050 ? 194 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 264 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.731 ? 835 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6121 2.8136 1361 . 137 1224 90.0000 . . . 0.3148 0.0000 0.2382 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.8136 3.0962 1492 . 148 1344 100.0000 . . . 0.3180 0.0000 0.2411 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.0962 3.5432 1511 . 151 1360 100.0000 . . . 0.2491 0.0000 0.1948 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.5432 4.4599 1563 . 157 1406 100.0000 . . . 0.2183 0.0000 0.1651 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.4599 25.0629 1687 . 169 1518 100.0000 . . . 0.2283 0.0000 0.1801 . . . . . . 5 . . . # _struct.entry_id 6CD3 _struct.title 'Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase I142A from Cupriavidus metallidurans in complex with 3-HAA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CD3 _struct_keywords.text 'Holo structure, Dioxygenase, Mutant I142A, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 30 ? HIS A 38 ? ASN A 9 HIS A 17 1 ? 9 HELX_P HELX_P2 AA2 SER A 162 ? LEU A 167 ? SER A 141 LEU A 146 1 ? 6 HELX_P HELX_P3 AA3 LEU A 167 ? SER A 177 ? LEU A 146 SER A 156 1 ? 11 HELX_P HELX_P4 AA4 SER A 177 ? ARG A 182 ? SER A 156 ARG A 161 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 72 ND1 ? ? ? 1_555 B FE2 . FE ? ? A HIS 51 A FE2 201 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc2 metalc ? ? A GLU 78 OE1 ? ? ? 1_555 B FE2 . FE ? ? A GLU 57 A FE2 201 1_555 ? ? ? ? ? ? ? 2.677 ? ? metalc3 metalc ? ? A GLU 78 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 57 A FE2 201 1_555 ? ? ? ? ? ? ? 2.262 ? ? metalc4 metalc ? ? A HIS 116 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 95 A FE2 201 1_555 ? ? ? ? ? ? ? 2.237 ? ? metalc5 metalc ? ? A CYS 146 SG ? ? ? 1_555 C FE2 . FE ? ? A CYS 125 A FE2 202 1_555 ? ? ? ? ? ? ? 2.633 ? ? metalc6 metalc ? ? A CYS 149 SG ? ? ? 1_555 C FE2 . FE ? ? A CYS 128 A FE2 202 1_555 ? ? ? ? ? ? ? 2.526 ? ? metalc7 metalc ? ? A CYS 183 SG ? ? ? 1_555 C FE2 . FE ? ? A CYS 162 A FE2 202 1_555 ? ? ? ? ? ? ? 2.526 ? ? metalc8 metalc ? ? A CYS 186 SG ? ? ? 1_555 C FE2 . FE ? ? A CYS 165 A FE2 202 1_555 ? ? ? ? ? ? ? 2.654 ? ? metalc9 metalc ? ? B FE2 . FE ? ? ? 1_555 D 3HA . N10 ? ? A FE2 201 A 3HA 203 1_555 ? ? ? ? ? ? ? 2.774 ? ? metalc10 metalc ? ? B FE2 . FE ? ? ? 1_555 D 3HA . O11 ? ? A FE2 201 A 3HA 203 1_555 ? ? ? ? ? ? ? 2.444 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 44 A . ? PRO 23 A PRO 45 A ? PRO 24 A 1 8.66 2 GLY 64 A . ? GLY 43 A PRO 65 A ? PRO 44 A 1 1.84 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 48 ? GLN A 50 ? ASN A 27 GLN A 29 AA1 2 PHE A 57 ? VAL A 62 ? PHE A 36 VAL A 41 AA1 3 ALA A 126 ? ARG A 132 ? ALA A 105 ARG A 111 AA1 4 GLU A 78 ? ARG A 84 ? GLU A 57 ARG A 63 AA1 5 ILE A 107 ? LEU A 110 ? ILE A 86 LEU A 89 AA2 1 TYR A 71 ? ASP A 73 ? TYR A 50 ASP A 52 AA2 2 ASP A 140 ? TYR A 145 ? ASP A 119 TYR A 124 AA2 3 LEU A 152 ? VAL A 158 ? LEU A 131 VAL A 137 AA3 1 ARG A 96 ? LEU A 102 ? ARG A 75 LEU A 81 AA3 2 ALA A 87 ? VAL A 93 ? ALA A 66 VAL A 72 AA3 3 HIS A 116 ? GLN A 119 ? HIS A 95 GLN A 98 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 49 ? N ARG A 28 O VAL A 61 ? O VAL A 40 AA1 2 3 N THR A 60 ? N THR A 39 O VAL A 129 ? O VAL A 108 AA1 3 4 O LEU A 128 ? O LEU A 107 N TYR A 81 ? N TYR A 60 AA1 4 5 N GLU A 78 ? N GLU A 57 O LEU A 110 ? O LEU A 89 AA2 1 2 N ASP A 73 ? N ASP A 52 O GLY A 141 ? O GLY A 120 AA2 2 3 N TRP A 144 ? N TRP A 123 O VAL A 153 ? O VAL A 132 AA3 1 2 O ARG A 96 ? O ARG A 75 N VAL A 93 ? N VAL A 72 AA3 2 3 N TYR A 88 ? N TYR A 67 O GLN A 119 ? O GLN A 98 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FE2 201 ? 4 'binding site for residue FE2 A 201' AC2 Software A FE2 202 ? 4 'binding site for residue FE2 A 202' AC3 Software A 3HA 203 ? 10 'binding site for residue 3HA A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 72 ? HIS A 51 . ? 1_555 ? 2 AC1 4 GLU A 78 ? GLU A 57 . ? 1_555 ? 3 AC1 4 HIS A 116 ? HIS A 95 . ? 1_555 ? 4 AC1 4 3HA D . ? 3HA A 203 . ? 1_555 ? 5 AC2 4 CYS A 146 ? CYS A 125 . ? 1_555 ? 6 AC2 4 CYS A 149 ? CYS A 128 . ? 1_555 ? 7 AC2 4 CYS A 183 ? CYS A 162 . ? 1_555 ? 8 AC2 4 CYS A 186 ? CYS A 165 . ? 1_555 ? 9 AC3 10 VAL A 62 ? VAL A 41 . ? 1_555 ? 10 AC3 10 HIS A 72 ? HIS A 51 . ? 1_555 ? 11 AC3 10 GLU A 78 ? GLU A 57 . ? 1_555 ? 12 AC3 10 PHE A 80 ? PHE A 59 . ? 1_555 ? 13 AC3 10 PRO A 118 ? PRO A 97 . ? 1_555 ? 14 AC3 10 ARG A 120 ? ARG A 99 . ? 1_555 ? 15 AC3 10 VAL A 129 ? VAL A 108 . ? 1_555 ? 16 AC3 10 GLU A 131 ? GLU A 110 . ? 1_555 ? 17 AC3 10 FE2 B . ? FE2 A 201 . ? 1_555 ? 18 AC3 10 HOH E . ? HOH A 301 . ? 1_555 ? # _atom_sites.entry_id 6CD3 _atom_sites.fract_transf_matrix[1][1] 0.017120 _atom_sites.fract_transf_matrix[1][2] 0.009884 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019769 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004332 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -20 ? ? ? A . n A 1 2 GLY 2 -19 ? ? ? A . n A 1 3 HIS 3 -18 ? ? ? A . n A 1 4 HIS 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 HIS 9 -12 ? ? ? A . n A 1 10 HIS 10 -11 ? ? ? A . n A 1 11 HIS 11 -10 ? ? ? A . n A 1 12 HIS 12 -9 ? ? ? A . n A 1 13 SER 13 -8 ? ? ? A . n A 1 14 SER 14 -7 ? ? ? A . n A 1 15 GLY 15 -6 ? ? ? A . n A 1 16 HIS 16 -5 ? ? ? A . n A 1 17 ILE 17 -4 ? ? ? A . n A 1 18 GLU 18 -3 ? ? ? A . n A 1 19 GLY 19 -2 ? ? ? A . n A 1 20 ARG 20 -1 ? ? ? A . n A 1 21 HIS 21 0 ? ? ? A . n A 1 22 MET 22 1 ? ? ? A . n A 1 23 LEU 23 2 2 LEU LEU A . n A 1 24 THR 24 3 3 THR THR A . n A 1 25 TYR 25 4 4 TYR TYR A . n A 1 26 GLY 26 5 5 GLY GLY A . n A 1 27 ALA 27 6 6 ALA ALA A . n A 1 28 PRO 28 7 7 PRO PRO A . n A 1 29 PHE 29 8 8 PHE PHE A . n A 1 30 ASN 30 9 9 ASN ASN A . n A 1 31 PHE 31 10 10 PHE PHE A . n A 1 32 PRO 32 11 11 PRO PRO A . n A 1 33 ARG 33 12 12 ARG ARG A . n A 1 34 TRP 34 13 13 TRP TRP A . n A 1 35 ILE 35 14 14 ILE ILE A . n A 1 36 ASP 36 15 15 ASP ASP A . n A 1 37 GLU 37 16 16 GLU GLU A . n A 1 38 HIS 38 17 17 HIS HIS A . n A 1 39 ALA 39 18 18 ALA ALA A . n A 1 40 HIS 40 19 19 HIS HIS A . n A 1 41 LEU 41 20 20 LEU LEU A . n A 1 42 LEU 42 21 21 LEU LEU A . n A 1 43 LYS 43 22 22 LYS LYS A . n A 1 44 PRO 44 23 23 PRO PRO A . n A 1 45 PRO 45 24 24 PRO PRO A . n A 1 46 VAL 46 25 25 VAL VAL A . n A 1 47 GLY 47 26 26 GLY GLY A . n A 1 48 ASN 48 27 27 ASN ASN A . n A 1 49 ARG 49 28 28 ARG ARG A . n A 1 50 GLN 50 29 29 GLN GLN A . n A 1 51 VAL 51 30 30 VAL VAL A . n A 1 52 TRP 52 31 31 TRP TRP A . n A 1 53 GLN 53 32 32 GLN GLN A . n A 1 54 ASP 54 33 33 ASP ASP A . n A 1 55 SER 55 34 34 SER SER A . n A 1 56 ASP 56 35 35 ASP ASP A . n A 1 57 PHE 57 36 36 PHE PHE A . n A 1 58 ILE 58 37 37 ILE ILE A . n A 1 59 VAL 59 38 38 VAL VAL A . n A 1 60 THR 60 39 39 THR THR A . n A 1 61 VAL 61 40 40 VAL VAL A . n A 1 62 VAL 62 41 41 VAL VAL A . n A 1 63 GLY 63 42 42 GLY GLY A . n A 1 64 GLY 64 43 43 GLY GLY A . n A 1 65 PRO 65 44 44 PRO PRO A . n A 1 66 ASN 66 45 45 ASN ASN A . n A 1 67 HIS 67 46 46 HIS HIS A . n A 1 68 ARG 68 47 47 ARG ARG A . n A 1 69 THR 69 48 48 THR THR A . n A 1 70 ASP 70 49 49 ASP ASP A . n A 1 71 TYR 71 50 50 TYR TYR A . n A 1 72 HIS 72 51 51 HIS HIS A . n A 1 73 ASP 73 52 52 ASP ASP A . n A 1 74 ASP 74 53 53 ASP ASP A . n A 1 75 PRO 75 54 54 PRO PRO A . n A 1 76 LEU 76 55 55 LEU LEU A . n A 1 77 GLU 77 56 56 GLU GLU A . n A 1 78 GLU 78 57 57 GLU GLU A . n A 1 79 PHE 79 58 58 PHE PHE A . n A 1 80 PHE 80 59 59 PHE PHE A . n A 1 81 TYR 81 60 60 TYR TYR A . n A 1 82 GLN 82 61 61 GLN GLN A . n A 1 83 LEU 83 62 62 LEU LEU A . n A 1 84 ARG 84 63 63 ARG ARG A . n A 1 85 GLY 85 64 64 GLY GLY A . n A 1 86 ASN 86 65 65 ASN ASN A . n A 1 87 ALA 87 66 66 ALA ALA A . n A 1 88 TYR 88 67 67 TYR TYR A . n A 1 89 LEU 89 68 68 LEU LEU A . n A 1 90 ASN 90 69 69 ASN ASN A . n A 1 91 LEU 91 70 70 LEU LEU A . n A 1 92 TRP 92 71 71 TRP TRP A . n A 1 93 VAL 93 72 72 VAL VAL A . n A 1 94 ASP 94 73 73 ASP ASP A . n A 1 95 GLY 95 74 74 GLY GLY A . n A 1 96 ARG 96 75 75 ARG ARG A . n A 1 97 ARG 97 76 76 ARG ARG A . n A 1 98 GLU 98 77 77 GLU GLU A . n A 1 99 ARG 99 78 78 ARG ARG A . n A 1 100 ALA 100 79 79 ALA ALA A . n A 1 101 ASP 101 80 80 ASP ASP A . n A 1 102 LEU 102 81 81 LEU LEU A . n A 1 103 LYS 103 82 82 LYS LYS A . n A 1 104 GLU 104 83 83 GLU GLU A . n A 1 105 GLY 105 84 84 GLY GLY A . n A 1 106 ASP 106 85 85 ASP ASP A . n A 1 107 ILE 107 86 86 ILE ILE A . n A 1 108 PHE 108 87 87 PHE PHE A . n A 1 109 LEU 109 88 88 LEU LEU A . n A 1 110 LEU 110 89 89 LEU LEU A . n A 1 111 PRO 111 90 90 PRO PRO A . n A 1 112 PRO 112 91 91 PRO PRO A . n A 1 113 HIS 113 92 92 HIS HIS A . n A 1 114 VAL 114 93 93 VAL VAL A . n A 1 115 ARG 115 94 94 ARG ARG A . n A 1 116 HIS 116 95 95 HIS HIS A . n A 1 117 SER 117 96 96 SER SER A . n A 1 118 PRO 118 97 97 PRO PRO A . n A 1 119 GLN 119 98 98 GLN GLN A . n A 1 120 ARG 120 99 99 ARG ARG A . n A 1 121 PRO 121 100 100 PRO PRO A . n A 1 122 GLU 122 101 101 GLU GLU A . n A 1 123 ALA 123 102 102 ALA ALA A . n A 1 124 GLY 124 103 103 GLY GLY A . n A 1 125 SER 125 104 104 SER SER A . n A 1 126 ALA 126 105 105 ALA ALA A . n A 1 127 CYS 127 106 106 CYS CYS A . n A 1 128 LEU 128 107 107 LEU LEU A . n A 1 129 VAL 129 108 108 VAL VAL A . n A 1 130 ILE 130 109 109 ILE ILE A . n A 1 131 GLU 131 110 110 GLU GLU A . n A 1 132 ARG 132 111 111 ARG ARG A . n A 1 133 GLN 133 112 112 GLN GLN A . n A 1 134 ARG 134 113 113 ARG ARG A . n A 1 135 PRO 135 114 114 PRO PRO A . n A 1 136 ALA 136 115 115 ALA ALA A . n A 1 137 GLY 137 116 116 GLY GLY A . n A 1 138 MET 138 117 117 MET MET A . n A 1 139 LEU 139 118 118 LEU LEU A . n A 1 140 ASP 140 119 119 ASP ASP A . n A 1 141 GLY 141 120 120 GLY GLY A . n A 1 142 PHE 142 121 121 PHE PHE A . n A 1 143 GLU 143 122 122 GLU GLU A . n A 1 144 TRP 144 123 123 TRP TRP A . n A 1 145 TYR 145 124 124 TYR TYR A . n A 1 146 CYS 146 125 125 CYS CYS A . n A 1 147 ASP 147 126 126 ASP ASP A . n A 1 148 ALA 148 127 127 ALA ALA A . n A 1 149 CYS 149 128 128 CYS CYS A . n A 1 150 GLY 150 129 129 GLY GLY A . n A 1 151 HIS 151 130 130 HIS HIS A . n A 1 152 LEU 152 131 131 LEU LEU A . n A 1 153 VAL 153 132 132 VAL VAL A . n A 1 154 HIS 154 133 133 HIS HIS A . n A 1 155 ARG 155 134 134 ARG ARG A . n A 1 156 VAL 156 135 135 VAL VAL A . n A 1 157 GLU 157 136 136 GLU GLU A . n A 1 158 VAL 158 137 137 VAL VAL A . n A 1 159 GLN 159 138 138 GLN GLN A . n A 1 160 LEU 160 139 139 LEU LEU A . n A 1 161 LYS 161 140 140 LYS LYS A . n A 1 162 SER 162 141 141 SER SER A . n A 1 163 ALA 163 142 142 ALA ALA A . n A 1 164 VAL 164 143 143 VAL VAL A . n A 1 165 THR 165 144 144 THR THR A . n A 1 166 ASP 166 145 145 ASP ASP A . n A 1 167 LEU 167 146 146 LEU LEU A . n A 1 168 PRO 168 147 147 PRO PRO A . n A 1 169 PRO 169 148 148 PRO PRO A . n A 1 170 LEU 170 149 149 LEU LEU A . n A 1 171 PHE 171 150 150 PHE PHE A . n A 1 172 GLU 172 151 151 GLU GLU A . n A 1 173 SER 173 152 152 SER SER A . n A 1 174 PHE 174 153 153 PHE PHE A . n A 1 175 TYR 175 154 154 TYR TYR A . n A 1 176 ALA 176 155 155 ALA ALA A . n A 1 177 SER 177 156 156 SER SER A . n A 1 178 GLU 178 157 157 GLU GLU A . n A 1 179 ASP 179 158 158 ASP ASP A . n A 1 180 LYS 180 159 159 LYS LYS A . n A 1 181 ARG 181 160 160 ARG ARG A . n A 1 182 ARG 182 161 161 ARG ARG A . n A 1 183 CYS 183 162 162 CYS CYS A . n A 1 184 PRO 184 163 163 PRO PRO A . n A 1 185 HIS 185 164 164 HIS HIS A . n A 1 186 CYS 186 165 165 CYS CYS A . n A 1 187 GLY 187 166 166 GLY GLY A . n A 1 188 GLN 188 167 167 GLN GLN A . n A 1 189 VAL 189 168 168 VAL VAL A . n A 1 190 HIS 190 169 169 HIS HIS A . n A 1 191 PRO 191 170 170 PRO PRO A . n A 1 192 GLY 192 171 171 GLY GLY A . n A 1 193 ARG 193 172 ? ? ? A . n A 1 194 ALA 194 173 ? ? ? A . n A 1 195 ALA 195 174 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 201 300 FE2 FE2 A . C 2 FE2 1 202 301 FE2 FE2 A . D 3 3HA 1 203 1 3HA 3HA A . E 4 HOH 1 301 61 HOH HOH A . E 4 HOH 2 302 66 HOH HOH A . E 4 HOH 3 303 35 HOH HOH A . E 4 HOH 4 304 17 HOH HOH A . E 4 HOH 5 305 45 HOH HOH A . E 4 HOH 6 306 12 HOH HOH A . E 4 HOH 7 307 20 HOH HOH A . E 4 HOH 8 308 6 HOH HOH A . E 4 HOH 9 309 9 HOH HOH A . E 4 HOH 10 310 1 HOH HOH A . E 4 HOH 11 311 7 HOH HOH A . E 4 HOH 12 312 13 HOH HOH A . E 4 HOH 13 313 14 HOH HOH A . E 4 HOH 14 314 3 HOH HOH A . E 4 HOH 15 315 54 HOH HOH A . E 4 HOH 16 316 31 HOH HOH A . E 4 HOH 17 317 21 HOH HOH A . E 4 HOH 18 318 11 HOH HOH A . E 4 HOH 19 319 18 HOH HOH A . E 4 HOH 20 320 4 HOH HOH A . E 4 HOH 21 321 8 HOH HOH A . E 4 HOH 22 322 33 HOH HOH A . E 4 HOH 23 323 38 HOH HOH A . E 4 HOH 24 324 26 HOH HOH A . E 4 HOH 25 325 34 HOH HOH A . E 4 HOH 26 326 10 HOH HOH A . E 4 HOH 27 327 24 HOH HOH A . E 4 HOH 28 328 41 HOH HOH A . E 4 HOH 29 329 52 HOH HOH A . E 4 HOH 30 330 5 HOH HOH A . E 4 HOH 31 331 19 HOH HOH A . E 4 HOH 32 332 23 HOH HOH A . E 4 HOH 33 333 29 HOH HOH A . E 4 HOH 34 334 42 HOH HOH A . E 4 HOH 35 335 70 HOH HOH A . E 4 HOH 36 336 15 HOH HOH A . E 4 HOH 37 337 68 HOH HOH A . E 4 HOH 38 338 50 HOH HOH A . E 4 HOH 39 339 27 HOH HOH A . E 4 HOH 40 340 30 HOH HOH A . E 4 HOH 41 341 56 HOH HOH A . E 4 HOH 42 342 43 HOH HOH A . E 4 HOH 43 343 49 HOH HOH A . E 4 HOH 44 344 32 HOH HOH A . E 4 HOH 45 345 16 HOH HOH A . E 4 HOH 46 346 64 HOH HOH A . E 4 HOH 47 347 53 HOH HOH A . E 4 HOH 48 348 22 HOH HOH A . E 4 HOH 49 349 65 HOH HOH A . E 4 HOH 50 350 37 HOH HOH A . E 4 HOH 51 351 58 HOH HOH A . E 4 HOH 52 352 67 HOH HOH A . E 4 HOH 53 353 44 HOH HOH A . E 4 HOH 54 354 25 HOH HOH A . E 4 HOH 55 355 59 HOH HOH A . E 4 HOH 56 356 2 HOH HOH A . E 4 HOH 57 357 63 HOH HOH A . E 4 HOH 58 358 60 HOH HOH A . E 4 HOH 59 359 62 HOH HOH A . E 4 HOH 60 360 47 HOH HOH A . E 4 HOH 61 361 39 HOH HOH A . E 4 HOH 62 362 55 HOH HOH A . E 4 HOH 63 363 69 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4360 ? 1 MORE -45 ? 1 'SSA (A^2)' 15490 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_445 -y-1,-x-1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 -29.2050000000 -0.8660254038 -0.5000000000 0.0000000000 -50.5845438350 0.0000000000 0.0000000000 -1.0000000000 38.4690000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 140.5 ? 2 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 90.1 ? 3 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 52.0 ? 4 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 101.0 ? 5 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 86.0 ? 6 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 81.9 ? 7 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 N10 ? D 3HA . ? A 3HA 203 ? 1_555 122.2 ? 8 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 N10 ? D 3HA . ? A 3HA 203 ? 1_555 91.5 ? 9 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 N10 ? D 3HA . ? A 3HA 203 ? 1_555 142.3 ? 10 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 N10 ? D 3HA . ? A 3HA 203 ? 1_555 107.3 ? 11 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O11 ? D 3HA . ? A 3HA 203 ? 1_555 89.0 ? 12 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O11 ? D 3HA . ? A 3HA 203 ? 1_555 90.3 ? 13 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O11 ? D 3HA . ? A 3HA 203 ? 1_555 104.7 ? 14 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O11 ? D 3HA . ? A 3HA 203 ? 1_555 168.1 ? 15 N10 ? D 3HA . ? A 3HA 203 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O11 ? D 3HA . ? A 3HA 203 ? 1_555 61.4 ? 16 SG ? A CYS 146 ? A CYS 125 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 149 ? A CYS 128 ? 1_555 127.3 ? 17 SG ? A CYS 146 ? A CYS 125 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 183 ? A CYS 162 ? 1_555 114.9 ? 18 SG ? A CYS 149 ? A CYS 128 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 183 ? A CYS 162 ? 1_555 93.0 ? 19 SG ? A CYS 146 ? A CYS 125 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 186 ? A CYS 165 ? 1_555 103.1 ? 20 SG ? A CYS 149 ? A CYS 128 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 186 ? A CYS 165 ? 1_555 111.1 ? 21 SG ? A CYS 183 ? A CYS 162 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 186 ? A CYS 165 ? 1_555 105.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-06 2 'Structure model' 1 1 2018-07-18 3 'Structure model' 1 2 2019-02-20 4 'Structure model' 1 3 2019-11-27 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' pdbx_audit_support 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' 5 4 'Structure model' '_pdbx_audit_support.funding_organization' 6 5 'Structure model' '_database_2.pdbx_DOI' 7 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 21 ? ? -87.31 35.37 2 1 ASP A 73 ? ? 49.76 -16.02 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 75 ? CG ? A ARG 96 CG 2 1 Y 1 A ARG 75 ? CD ? A ARG 96 CD 3 1 Y 1 A ARG 75 ? NE ? A ARG 96 NE 4 1 Y 1 A ARG 75 ? CZ ? A ARG 96 CZ 5 1 Y 1 A ARG 75 ? NH1 ? A ARG 96 NH1 6 1 Y 1 A ARG 75 ? NH2 ? A ARG 96 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -20 ? A MET 1 2 1 Y 1 A GLY -19 ? A GLY 2 3 1 Y 1 A HIS -18 ? A HIS 3 4 1 Y 1 A HIS -17 ? A HIS 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A HIS -12 ? A HIS 9 10 1 Y 1 A HIS -11 ? A HIS 10 11 1 Y 1 A HIS -10 ? A HIS 11 12 1 Y 1 A HIS -9 ? A HIS 12 13 1 Y 1 A SER -8 ? A SER 13 14 1 Y 1 A SER -7 ? A SER 14 15 1 Y 1 A GLY -6 ? A GLY 15 16 1 Y 1 A HIS -5 ? A HIS 16 17 1 Y 1 A ILE -4 ? A ILE 17 18 1 Y 1 A GLU -3 ? A GLU 18 19 1 Y 1 A GLY -2 ? A GLY 19 20 1 Y 1 A ARG -1 ? A ARG 20 21 1 Y 1 A HIS 0 ? A HIS 21 22 1 Y 1 A MET 1 ? A MET 22 23 1 Y 1 A ARG 172 ? A ARG 193 24 1 Y 1 A ALA 173 ? A ALA 194 25 1 Y 1 A ALA 174 ? A ALA 195 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 3HA O8 O N N 1 3HA C7 C N N 2 3HA O9 O N N 3 3HA C2 C Y N 4 3HA C1 C Y N 5 3HA C6 C Y N 6 3HA C5 C Y N 7 3HA C4 C Y N 8 3HA O11 O N N 9 3HA C3 C Y N 10 3HA N10 N N N 11 3HA HO8 H N N 12 3HA H1 H N N 13 3HA H6 H N N 14 3HA H5 H N N 15 3HA H11 H N N 16 3HA H101 H N N 17 3HA H102 H N N 18 ALA N N N N 19 ALA CA C N S 20 ALA C C N N 21 ALA O O N N 22 ALA CB C N N 23 ALA OXT O N N 24 ALA H H N N 25 ALA H2 H N N 26 ALA HA H N N 27 ALA HB1 H N N 28 ALA HB2 H N N 29 ALA HB3 H N N 30 ALA HXT H N N 31 ARG N N N N 32 ARG CA C N S 33 ARG C C N N 34 ARG O O N N 35 ARG CB C N N 36 ARG CG C N N 37 ARG CD C N N 38 ARG NE N N N 39 ARG CZ C N N 40 ARG NH1 N N N 41 ARG NH2 N N N 42 ARG OXT O N N 43 ARG H H N N 44 ARG H2 H N N 45 ARG HA H N N 46 ARG HB2 H N N 47 ARG HB3 H N N 48 ARG HG2 H N N 49 ARG HG3 H N N 50 ARG HD2 H N N 51 ARG HD3 H N N 52 ARG HE H N N 53 ARG HH11 H N N 54 ARG HH12 H N N 55 ARG HH21 H N N 56 ARG HH22 H N N 57 ARG HXT H N N 58 ASN N N N N 59 ASN CA C N S 60 ASN C C N N 61 ASN O O N N 62 ASN CB C N N 63 ASN CG C N N 64 ASN OD1 O N N 65 ASN ND2 N N N 66 ASN OXT O N N 67 ASN H H N N 68 ASN H2 H N N 69 ASN HA H N N 70 ASN HB2 H N N 71 ASN HB3 H N N 72 ASN HD21 H N N 73 ASN HD22 H N N 74 ASN HXT H N N 75 ASP N N N N 76 ASP CA C N S 77 ASP C C N N 78 ASP O O N N 79 ASP CB C N N 80 ASP CG C N N 81 ASP OD1 O N N 82 ASP OD2 O N N 83 ASP OXT O N N 84 ASP H H N N 85 ASP H2 H N N 86 ASP HA H N N 87 ASP HB2 H N N 88 ASP HB3 H N N 89 ASP HD2 H N N 90 ASP HXT H N N 91 CYS N N N N 92 CYS CA C N R 93 CYS C C N N 94 CYS O O N N 95 CYS CB C N N 96 CYS SG S N N 97 CYS OXT O N N 98 CYS H H N N 99 CYS H2 H N N 100 CYS HA H N N 101 CYS HB2 H N N 102 CYS HB3 H N N 103 CYS HG H N N 104 CYS HXT H N N 105 FE2 FE FE N N 106 GLN N N N N 107 GLN CA C N S 108 GLN C C N N 109 GLN O O N N 110 GLN CB C N N 111 GLN CG C N N 112 GLN CD C N N 113 GLN OE1 O N N 114 GLN NE2 N N N 115 GLN OXT O N N 116 GLN H H N N 117 GLN H2 H N N 118 GLN HA H N N 119 GLN HB2 H N N 120 GLN HB3 H N N 121 GLN HG2 H N N 122 GLN HG3 H N N 123 GLN HE21 H N N 124 GLN HE22 H N N 125 GLN HXT H N N 126 GLU N N N N 127 GLU CA C N S 128 GLU C C N N 129 GLU O O N N 130 GLU CB C N N 131 GLU CG C N N 132 GLU CD C N N 133 GLU OE1 O N N 134 GLU OE2 O N N 135 GLU OXT O N N 136 GLU H H N N 137 GLU H2 H N N 138 GLU HA H N N 139 GLU HB2 H N N 140 GLU HB3 H N N 141 GLU HG2 H N N 142 GLU HG3 H N N 143 GLU HE2 H N N 144 GLU HXT H N N 145 GLY N N N N 146 GLY CA C N N 147 GLY C C N N 148 GLY O O N N 149 GLY OXT O N N 150 GLY H H N N 151 GLY H2 H N N 152 GLY HA2 H N N 153 GLY HA3 H N N 154 GLY HXT H N N 155 HIS N N N N 156 HIS CA C N S 157 HIS C C N N 158 HIS O O N N 159 HIS CB C N N 160 HIS CG C Y N 161 HIS ND1 N Y N 162 HIS CD2 C Y N 163 HIS CE1 C Y N 164 HIS NE2 N Y N 165 HIS OXT O N N 166 HIS H H N N 167 HIS H2 H N N 168 HIS HA H N N 169 HIS HB2 H N N 170 HIS HB3 H N N 171 HIS HD1 H N N 172 HIS HD2 H N N 173 HIS HE1 H N N 174 HIS HE2 H N N 175 HIS HXT H N N 176 HOH O O N N 177 HOH H1 H N N 178 HOH H2 H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 3HA O8 C7 sing N N 1 3HA O8 HO8 sing N N 2 3HA C7 O9 doub N N 3 3HA C7 C2 sing N N 4 3HA C2 C1 sing Y N 5 3HA C2 C3 doub Y N 6 3HA C1 C6 doub Y N 7 3HA C1 H1 sing N N 8 3HA C6 C5 sing Y N 9 3HA C6 H6 sing N N 10 3HA C5 C4 doub Y N 11 3HA C5 H5 sing N N 12 3HA C4 O11 sing N N 13 3HA C4 C3 sing Y N 14 3HA O11 H11 sing N N 15 3HA C3 N10 sing N N 16 3HA N10 H101 sing N N 17 3HA N10 H102 sing N N 18 ALA N CA sing N N 19 ALA N H sing N N 20 ALA N H2 sing N N 21 ALA CA C sing N N 22 ALA CA CB sing N N 23 ALA CA HA sing N N 24 ALA C O doub N N 25 ALA C OXT sing N N 26 ALA CB HB1 sing N N 27 ALA CB HB2 sing N N 28 ALA CB HB3 sing N N 29 ALA OXT HXT sing N N 30 ARG N CA sing N N 31 ARG N H sing N N 32 ARG N H2 sing N N 33 ARG CA C sing N N 34 ARG CA CB sing N N 35 ARG CA HA sing N N 36 ARG C O doub N N 37 ARG C OXT sing N N 38 ARG CB CG sing N N 39 ARG CB HB2 sing N N 40 ARG CB HB3 sing N N 41 ARG CG CD sing N N 42 ARG CG HG2 sing N N 43 ARG CG HG3 sing N N 44 ARG CD NE sing N N 45 ARG CD HD2 sing N N 46 ARG CD HD3 sing N N 47 ARG NE CZ sing N N 48 ARG NE HE sing N N 49 ARG CZ NH1 sing N N 50 ARG CZ NH2 doub N N 51 ARG NH1 HH11 sing N N 52 ARG NH1 HH12 sing N N 53 ARG NH2 HH21 sing N N 54 ARG NH2 HH22 sing N N 55 ARG OXT HXT sing N N 56 ASN N CA sing N N 57 ASN N H sing N N 58 ASN N H2 sing N N 59 ASN CA C sing N N 60 ASN CA CB sing N N 61 ASN CA HA sing N N 62 ASN C O doub N N 63 ASN C OXT sing N N 64 ASN CB CG sing N N 65 ASN CB HB2 sing N N 66 ASN CB HB3 sing N N 67 ASN CG OD1 doub N N 68 ASN CG ND2 sing N N 69 ASN ND2 HD21 sing N N 70 ASN ND2 HD22 sing N N 71 ASN OXT HXT sing N N 72 ASP N CA sing N N 73 ASP N H sing N N 74 ASP N H2 sing N N 75 ASP CA C sing N N 76 ASP CA CB sing N N 77 ASP CA HA sing N N 78 ASP C O doub N N 79 ASP C OXT sing N N 80 ASP CB CG sing N N 81 ASP CB HB2 sing N N 82 ASP CB HB3 sing N N 83 ASP CG OD1 doub N N 84 ASP CG OD2 sing N N 85 ASP OD2 HD2 sing N N 86 ASP OXT HXT sing N N 87 CYS N CA sing N N 88 CYS N H sing N N 89 CYS N H2 sing N N 90 CYS CA C sing N N 91 CYS CA CB sing N N 92 CYS CA HA sing N N 93 CYS C O doub N N 94 CYS C OXT sing N N 95 CYS CB SG sing N N 96 CYS CB HB2 sing N N 97 CYS CB HB3 sing N N 98 CYS SG HG sing N N 99 CYS OXT HXT sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM108988 1 'National Institutes of Health/National Institute of Mental Health (NIH/NIMH)' 'United States' R21MH10798 2 'National Science Foundation (NSF, United States)' 'United States' CHE-1623856 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 '3-HYDROXYANTHRANILIC ACID' 3HA 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4L2N _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #