data_6CKU # _entry.id 6CKU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6CKU pdb_00006cku 10.2210/pdb6cku/pdb WWPDB D_1000232731 ? ? BMRB 30422 ? 10.13018/BMR30422 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-13 2 'Structure model' 1 1 2018-10-03 3 'Structure model' 1 2 2020-01-08 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 11 5 'Structure model' pdbx_entry_details 12 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_pdbx_audit_support.funding_organization' 7 3 'Structure model' '_pdbx_nmr_software.name' 8 3 'Structure model' '_pdbx_nmr_spectrometer.model' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' 11 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 12 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6CKU _pdbx_database_status.recvd_initial_deposition_date 2018-02-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the zebrafish granulin AaE' _pdbx_database_related.db_id 30422 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, P.' 1 ? 'Ni, F.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1476 _citation.page_last 1490 _citation.title ;Structure dissection of zebrafish progranulins identifies a well-folded granulin/epithelin module protein with pro-cell survival activities. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3441 _citation.pdbx_database_id_PubMed 29732682 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, P.' 1 ? primary 'Chitramuthu, B.' 2 ? primary 'Bateman, A.' 3 ? primary 'Bennett, H.P.J.' 4 ? primary 'Xu, P.' 5 ? primary 'Ni, F.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Granulin-AaE _entity.formula_weight 5698.431 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 793-848' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DVQCGGGFSCHDGETCCPTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPGGTCIS _entity_poly.pdbx_seq_one_letter_code_can DVQCGGGFSCHDGETCCPTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPGGTCIS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 VAL n 1 3 GLN n 1 4 CYS n 1 5 GLY n 1 6 GLY n 1 7 GLY n 1 8 PHE n 1 9 SER n 1 10 CYS n 1 11 HIS n 1 12 ASP n 1 13 GLY n 1 14 GLU n 1 15 THR n 1 16 CYS n 1 17 CYS n 1 18 PRO n 1 19 THR n 1 20 SER n 1 21 GLN n 1 22 THR n 1 23 THR n 1 24 TRP n 1 25 GLY n 1 26 CYS n 1 27 CYS n 1 28 PRO n 1 29 SER n 1 30 PRO n 1 31 LYS n 1 32 ALA n 1 33 VAL n 1 34 CYS n 1 35 CYS n 1 36 ASP n 1 37 ASP n 1 38 MET n 1 39 GLN n 1 40 HIS n 1 41 CYS n 1 42 CYS n 1 43 PRO n 1 44 ALA n 1 45 GLY n 1 46 TYR n 1 47 LYS n 1 48 CYS n 1 49 GLY n 1 50 PRO n 1 51 GLY n 1 52 GLY n 1 53 THR n 1 54 CYS n 1 55 ILE n 1 56 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 56 _entity_src_gen.gene_src_common_name Zebrafish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene grna _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Danio rerio' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7955 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 SER 56 56 56 SER SER A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6CKU _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CKU _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CKU _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 6CKU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 6CKU _struct.title 'Solution structure of the zebrafish granulin AaE' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CKU _struct_keywords.text 'granulin/epithelin module, beta-hairpin stack, progranulins, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8QGN9_DANRE _struct_ref.pdbx_db_accession Q8QGN9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DVQCGGGFSCHDGETCCPTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPGGTCIS _struct_ref.pdbx_align_begin 793 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CKU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8QGN9 _struct_ref_seq.db_align_beg 793 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 848 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 56 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4260 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 4 A CYS 16 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 10 A CYS 26 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 17 A CYS 34 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 27 A CYS 41 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf5 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 35 A CYS 48 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf6 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 42 A CYS 54 1_555 ? ? ? ? ? ? ? 2.024 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 16 ? CYS A 4 ? 1_555 CYS A 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 10 ? CYS A 26 ? CYS A 10 ? 1_555 CYS A 26 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 17 ? CYS A 34 ? CYS A 17 ? 1_555 CYS A 34 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 27 ? CYS A 41 ? CYS A 27 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 35 ? CYS A 48 ? CYS A 35 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 42 ? CYS A 54 ? CYS A 42 ? 1_555 CYS A 54 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 2 ? GLN A 3 ? VAL A 2 GLN A 3 AA1 2 SER A 9 ? CYS A 10 ? SER A 9 CYS A 10 AA2 1 THR A 15 ? CYS A 17 ? THR A 15 CYS A 17 AA2 2 GLY A 25 ? CYS A 27 ? GLY A 25 CYS A 27 AA3 1 LYS A 47 ? CYS A 48 ? LYS A 47 CYS A 48 AA3 2 CYS A 54 ? ILE A 55 ? CYS A 54 ILE A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 2 ? N VAL A 2 O CYS A 10 ? O CYS A 10 AA2 1 2 N THR A 15 ? N THR A 15 O CYS A 27 ? O CYS A 27 AA3 1 2 N LYS A 47 ? N LYS A 47 O ILE A 55 ? O ILE A 55 # _pdbx_entry_details.entry_id 6CKU _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 15 _pdbx_validate_close_contact.auth_atom_id_1 HB2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 17 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HB2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 34 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 29 ? ? 64.12 123.15 2 1 MET A 38 ? ? -132.99 -93.90 3 1 GLN A 39 ? ? -154.51 82.60 4 2 CYS A 4 ? ? -54.24 -82.43 5 2 GLN A 21 ? ? -68.14 -75.25 6 2 PRO A 30 ? ? -68.79 -72.36 7 2 LYS A 31 ? ? -75.19 26.82 8 2 CYS A 35 ? ? -53.00 107.75 9 2 MET A 38 ? ? -122.81 -102.85 10 2 GLN A 39 ? ? -156.93 80.26 11 2 HIS A 40 ? ? -171.85 -172.63 12 2 PRO A 43 ? ? -44.43 150.94 13 3 GLN A 3 ? ? -58.09 94.82 14 3 SER A 20 ? ? -148.26 -119.63 15 3 GLN A 21 ? ? -153.32 -26.46 16 3 PRO A 30 ? ? -67.93 -122.42 17 3 MET A 38 ? ? -128.90 -98.33 18 3 GLN A 39 ? ? -155.04 82.31 19 3 ALA A 44 ? ? -44.72 105.59 20 4 CYS A 4 ? ? -61.98 -76.34 21 4 SER A 20 ? ? -150.40 -106.21 22 4 GLN A 21 ? ? -141.75 -22.36 23 4 PRO A 28 ? ? -77.75 35.18 24 4 LYS A 31 ? ? -86.75 36.46 25 4 CYS A 34 ? ? -67.87 99.32 26 4 CYS A 35 ? ? -51.19 107.28 27 4 MET A 38 ? ? -130.62 -98.30 28 4 GLN A 39 ? ? -155.51 83.06 29 5 GLN A 3 ? ? -24.21 105.15 30 5 SER A 20 ? ? -151.03 -4.50 31 5 GLN A 21 ? ? 74.55 -34.24 32 5 PRO A 28 ? ? -65.09 80.94 33 5 SER A 29 ? ? -178.96 127.56 34 5 PRO A 30 ? ? -45.51 -96.63 35 5 LYS A 31 ? ? -85.66 48.56 36 5 MET A 38 ? ? -135.37 -90.48 37 5 GLN A 39 ? ? -155.64 82.77 38 6 GLN A 3 ? ? -30.53 113.30 39 6 CYS A 4 ? ? -63.81 -76.00 40 6 SER A 20 ? ? -150.09 -97.98 41 6 GLN A 21 ? ? -168.07 -28.25 42 6 PRO A 28 ? ? -86.06 43.78 43 6 PRO A 30 ? ? -57.35 -101.21 44 6 LYS A 31 ? ? -49.82 -77.75 45 6 ALA A 32 ? ? 66.11 140.75 46 6 CYS A 34 ? ? -67.84 98.55 47 6 CYS A 35 ? ? -50.77 107.22 48 6 MET A 38 ? ? -132.26 -93.96 49 6 GLN A 39 ? ? -155.74 81.88 50 7 THR A 19 ? ? -69.49 2.89 51 7 SER A 20 ? ? -149.91 -156.46 52 7 ALA A 32 ? ? 66.53 130.82 53 7 MET A 38 ? ? -134.25 -92.65 54 7 GLN A 39 ? ? -155.82 81.74 55 8 VAL A 2 ? ? -112.88 76.41 56 8 GLN A 3 ? ? -39.77 145.21 57 8 SER A 20 ? ? -151.09 -93.07 58 8 GLN A 21 ? ? -164.52 -17.70 59 8 PRO A 28 ? ? -73.81 34.68 60 8 PRO A 30 ? ? -50.75 -76.88 61 8 ALA A 32 ? ? 64.61 126.19 62 8 CYS A 34 ? ? -69.82 92.40 63 8 CYS A 35 ? ? -51.73 106.08 64 8 MET A 38 ? ? -123.31 -102.25 65 8 GLN A 39 ? ? -154.31 81.57 66 9 SER A 20 ? ? -123.99 -169.58 67 9 PRO A 30 ? ? -50.12 -77.57 68 9 ALA A 32 ? ? 60.45 118.54 69 9 CYS A 35 ? ? -50.38 104.89 70 9 MET A 38 ? ? -124.09 -101.20 71 9 GLN A 39 ? ? -156.94 80.71 72 9 HIS A 40 ? ? -171.84 -172.68 73 9 ALA A 44 ? ? -51.24 97.51 74 10 GLN A 3 ? ? -38.03 105.93 75 10 PRO A 28 ? ? -79.66 38.07 76 10 PRO A 30 ? ? -64.33 -89.08 77 10 LYS A 31 ? ? -82.90 49.12 78 10 MET A 38 ? ? -132.95 -94.10 79 10 GLN A 39 ? ? -155.51 82.90 80 10 ALA A 44 ? ? -46.30 106.88 81 11 GLN A 3 ? ? -67.30 99.54 82 11 ASP A 12 ? ? -66.54 26.11 83 11 SER A 20 ? ? -152.04 -92.27 84 11 GLN A 21 ? ? -168.82 -17.49 85 11 PRO A 30 ? ? -62.40 -85.32 86 11 CYS A 34 ? ? -66.95 96.19 87 11 MET A 38 ? ? -127.77 -100.65 88 11 GLN A 39 ? ? -155.30 83.11 89 11 ALA A 44 ? ? -45.70 107.80 90 12 SER A 20 ? ? -150.56 -101.62 91 12 GLN A 21 ? ? -143.11 -70.93 92 12 PRO A 30 ? ? -60.46 -72.67 93 12 LYS A 31 ? ? -95.07 -80.03 94 12 ALA A 32 ? ? 58.82 143.72 95 12 MET A 38 ? ? -133.25 -91.92 96 12 GLN A 39 ? ? -157.03 81.20 97 13 CYS A 4 ? ? -58.92 -75.21 98 13 ASP A 12 ? ? -71.53 42.19 99 13 SER A 20 ? ? -151.24 -95.46 100 13 GLN A 21 ? ? -157.89 -20.54 101 13 PRO A 28 ? ? -79.33 36.05 102 13 PRO A 30 ? ? -61.57 -98.70 103 13 LYS A 31 ? ? -60.35 -84.94 104 13 ALA A 32 ? ? 63.73 145.35 105 13 CYS A 34 ? ? -63.24 82.25 106 13 MET A 38 ? ? -123.45 -108.84 107 13 GLN A 39 ? ? -154.32 82.95 108 13 HIS A 40 ? ? 178.10 161.52 109 13 ALA A 44 ? ? -37.34 120.47 110 14 VAL A 2 ? ? -104.85 -97.02 111 14 GLN A 3 ? ? 164.69 65.53 112 14 PRO A 30 ? ? -62.45 -93.73 113 14 LYS A 31 ? ? -79.01 36.33 114 14 CYS A 35 ? ? -54.79 109.55 115 14 MET A 38 ? ? -133.59 -93.84 116 14 GLN A 39 ? ? -156.23 82.29 117 15 GLN A 3 ? ? -63.34 95.14 118 15 SER A 20 ? ? -150.61 -159.38 119 15 THR A 22 ? ? -138.73 -44.73 120 15 THR A 23 ? ? -32.91 122.76 121 15 SER A 29 ? ? 65.02 153.61 122 15 LYS A 31 ? ? -92.38 -67.95 123 15 ALA A 32 ? ? 63.03 129.06 124 15 MET A 38 ? ? -131.41 -96.98 125 15 GLN A 39 ? ? -155.77 82.39 126 15 PRO A 43 ? ? -45.37 155.72 127 15 ALA A 44 ? ? -64.06 94.68 128 15 THR A 53 ? ? 171.57 -172.08 129 16 GLN A 3 ? ? -160.43 70.77 130 16 SER A 20 ? ? -143.68 -132.05 131 16 GLN A 21 ? ? -152.19 -23.99 132 16 PRO A 30 ? ? -66.88 -125.95 133 16 LYS A 31 ? ? -78.47 47.36 134 16 MET A 38 ? ? -130.00 -96.24 135 16 GLN A 39 ? ? -156.05 81.52 136 16 ALA A 44 ? ? -51.75 96.85 # _pdbx_nmr_ensemble.entry_id 6CKU _pdbx_nmr_ensemble.conformers_calculated_total_number 16 _pdbx_nmr_ensemble.conformers_submitted_total_number 16 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 6CKU _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM zebrafish granulin AaE, 150 mM sodium chloride and 0.2mM EDTA pH 6.8 90%, H2O/10% D2O' '90% H2O/10% D2O' unlabel_AaE solution ;The sample was dissolved in 450uL of 10% D2O and 90% NMR Buffer that contains 10mM sodium phosphate, 150 mM sodium chloride and 0.2mM EDTA pH 6.8 ; 2 '0.5 mM [U-15N] zebrafish granulin AaE, 10mM sodium phosphate, 150 mM sodium chloride and 0.2mM EDTA pH 6.8, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ;The sample was dissolved in 450uL of 10% D2O and 90% NMR Buffer that contains 10mM sodium phosphate, 150 mM sodium chloride and 0.2mM EDTA pH 6.8 ; # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'zebrafish granulin AaE' 0.5 ? mM 'natural abundance' 2 'zebrafish granulin AaE' 0.5 ? mM '[U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units mmHg _pdbx_nmr_exptl_sample_conditions.pressure 760 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H COSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 2 isotropic 4 1 2 '2D 1H-15N HSQC' 2 anisotropic # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 6CKU _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS 1.0 'Brunger et al.' 2 refinement ARIA ? 'Nilges et al.' 3 'chemical shift assignment' NMRView ? 'Johnson et al.' 4 'peak picking' NMRView ? 'Johnson et al.' 5 'structure calculation' CNS 1.0 'Brunger et al.' 6 'structure calculation' ARIA ? 'Nilges et al.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLN N N N N 44 GLN CA C N S 45 GLN C C N N 46 GLN O O N N 47 GLN CB C N N 48 GLN CG C N N 49 GLN CD C N N 50 GLN OE1 O N N 51 GLN NE2 N N N 52 GLN OXT O N N 53 GLN H H N N 54 GLN H2 H N N 55 GLN HA H N N 56 GLN HB2 H N N 57 GLN HB3 H N N 58 GLN HG2 H N N 59 GLN HG3 H N N 60 GLN HE21 H N N 61 GLN HE22 H N N 62 GLN HXT H N N 63 GLU N N N N 64 GLU CA C N S 65 GLU C C N N 66 GLU O O N N 67 GLU CB C N N 68 GLU CG C N N 69 GLU CD C N N 70 GLU OE1 O N N 71 GLU OE2 O N N 72 GLU OXT O N N 73 GLU H H N N 74 GLU H2 H N N 75 GLU HA H N N 76 GLU HB2 H N N 77 GLU HB3 H N N 78 GLU HG2 H N N 79 GLU HG3 H N N 80 GLU HE2 H N N 81 GLU HXT H N N 82 GLY N N N N 83 GLY CA C N N 84 GLY C C N N 85 GLY O O N N 86 GLY OXT O N N 87 GLY H H N N 88 GLY H2 H N N 89 GLY HA2 H N N 90 GLY HA3 H N N 91 GLY HXT H N N 92 HIS N N N N 93 HIS CA C N S 94 HIS C C N N 95 HIS O O N N 96 HIS CB C N N 97 HIS CG C Y N 98 HIS ND1 N Y N 99 HIS CD2 C Y N 100 HIS CE1 C Y N 101 HIS NE2 N Y N 102 HIS OXT O N N 103 HIS H H N N 104 HIS H2 H N N 105 HIS HA H N N 106 HIS HB2 H N N 107 HIS HB3 H N N 108 HIS HD1 H N N 109 HIS HD2 H N N 110 HIS HE1 H N N 111 HIS HE2 H N N 112 HIS HXT H N N 113 ILE N N N N 114 ILE CA C N S 115 ILE C C N N 116 ILE O O N N 117 ILE CB C N S 118 ILE CG1 C N N 119 ILE CG2 C N N 120 ILE CD1 C N N 121 ILE OXT O N N 122 ILE H H N N 123 ILE H2 H N N 124 ILE HA H N N 125 ILE HB H N N 126 ILE HG12 H N N 127 ILE HG13 H N N 128 ILE HG21 H N N 129 ILE HG22 H N N 130 ILE HG23 H N N 131 ILE HD11 H N N 132 ILE HD12 H N N 133 ILE HD13 H N N 134 ILE HXT H N N 135 LYS N N N N 136 LYS CA C N S 137 LYS C C N N 138 LYS O O N N 139 LYS CB C N N 140 LYS CG C N N 141 LYS CD C N N 142 LYS CE C N N 143 LYS NZ N N N 144 LYS OXT O N N 145 LYS H H N N 146 LYS H2 H N N 147 LYS HA H N N 148 LYS HB2 H N N 149 LYS HB3 H N N 150 LYS HG2 H N N 151 LYS HG3 H N N 152 LYS HD2 H N N 153 LYS HD3 H N N 154 LYS HE2 H N N 155 LYS HE3 H N N 156 LYS HZ1 H N N 157 LYS HZ2 H N N 158 LYS HZ3 H N N 159 LYS HXT H N N 160 MET N N N N 161 MET CA C N S 162 MET C C N N 163 MET O O N N 164 MET CB C N N 165 MET CG C N N 166 MET SD S N N 167 MET CE C N N 168 MET OXT O N N 169 MET H H N N 170 MET H2 H N N 171 MET HA H N N 172 MET HB2 H N N 173 MET HB3 H N N 174 MET HG2 H N N 175 MET HG3 H N N 176 MET HE1 H N N 177 MET HE2 H N N 178 MET HE3 H N N 179 MET HXT H N N 180 PHE N N N N 181 PHE CA C N S 182 PHE C C N N 183 PHE O O N N 184 PHE CB C N N 185 PHE CG C Y N 186 PHE CD1 C Y N 187 PHE CD2 C Y N 188 PHE CE1 C Y N 189 PHE CE2 C Y N 190 PHE CZ C Y N 191 PHE OXT O N N 192 PHE H H N N 193 PHE H2 H N N 194 PHE HA H N N 195 PHE HB2 H N N 196 PHE HB3 H N N 197 PHE HD1 H N N 198 PHE HD2 H N N 199 PHE HE1 H N N 200 PHE HE2 H N N 201 PHE HZ H N N 202 PHE HXT H N N 203 PRO N N N N 204 PRO CA C N S 205 PRO C C N N 206 PRO O O N N 207 PRO CB C N N 208 PRO CG C N N 209 PRO CD C N N 210 PRO OXT O N N 211 PRO H H N N 212 PRO HA H N N 213 PRO HB2 H N N 214 PRO HB3 H N N 215 PRO HG2 H N N 216 PRO HG3 H N N 217 PRO HD2 H N N 218 PRO HD3 H N N 219 PRO HXT H N N 220 SER N N N N 221 SER CA C N S 222 SER C C N N 223 SER O O N N 224 SER CB C N N 225 SER OG O N N 226 SER OXT O N N 227 SER H H N N 228 SER H2 H N N 229 SER HA H N N 230 SER HB2 H N N 231 SER HB3 H N N 232 SER HG H N N 233 SER HXT H N N 234 THR N N N N 235 THR CA C N S 236 THR C C N N 237 THR O O N N 238 THR CB C N R 239 THR OG1 O N N 240 THR CG2 C N N 241 THR OXT O N N 242 THR H H N N 243 THR H2 H N N 244 THR HA H N N 245 THR HB H N N 246 THR HG1 H N N 247 THR HG21 H N N 248 THR HG22 H N N 249 THR HG23 H N N 250 THR HXT H N N 251 TRP N N N N 252 TRP CA C N S 253 TRP C C N N 254 TRP O O N N 255 TRP CB C N N 256 TRP CG C Y N 257 TRP CD1 C Y N 258 TRP CD2 C Y N 259 TRP NE1 N Y N 260 TRP CE2 C Y N 261 TRP CE3 C Y N 262 TRP CZ2 C Y N 263 TRP CZ3 C Y N 264 TRP CH2 C Y N 265 TRP OXT O N N 266 TRP H H N N 267 TRP H2 H N N 268 TRP HA H N N 269 TRP HB2 H N N 270 TRP HB3 H N N 271 TRP HD1 H N N 272 TRP HE1 H N N 273 TRP HE3 H N N 274 TRP HZ2 H N N 275 TRP HZ3 H N N 276 TRP HH2 H N N 277 TRP HXT H N N 278 TYR N N N N 279 TYR CA C N S 280 TYR C C N N 281 TYR O O N N 282 TYR CB C N N 283 TYR CG C Y N 284 TYR CD1 C Y N 285 TYR CD2 C Y N 286 TYR CE1 C Y N 287 TYR CE2 C Y N 288 TYR CZ C Y N 289 TYR OH O N N 290 TYR OXT O N N 291 TYR H H N N 292 TYR H2 H N N 293 TYR HA H N N 294 TYR HB2 H N N 295 TYR HB3 H N N 296 TYR HD1 H N N 297 TYR HD2 H N N 298 TYR HE1 H N N 299 TYR HE2 H N N 300 TYR HH H N N 301 TYR HXT H N N 302 VAL N N N N 303 VAL CA C N S 304 VAL C C N N 305 VAL O O N N 306 VAL CB C N N 307 VAL CG1 C N N 308 VAL CG2 C N N 309 VAL OXT O N N 310 VAL H H N N 311 VAL H2 H N N 312 VAL HA H N N 313 VAL HB H N N 314 VAL HG11 H N N 315 VAL HG12 H N N 316 VAL HG13 H N N 317 VAL HG21 H N N 318 VAL HG22 H N N 319 VAL HG23 H N N 320 VAL HXT H N N 321 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLN N CA sing N N 41 GLN N H sing N N 42 GLN N H2 sing N N 43 GLN CA C sing N N 44 GLN CA CB sing N N 45 GLN CA HA sing N N 46 GLN C O doub N N 47 GLN C OXT sing N N 48 GLN CB CG sing N N 49 GLN CB HB2 sing N N 50 GLN CB HB3 sing N N 51 GLN CG CD sing N N 52 GLN CG HG2 sing N N 53 GLN CG HG3 sing N N 54 GLN CD OE1 doub N N 55 GLN CD NE2 sing N N 56 GLN NE2 HE21 sing N N 57 GLN NE2 HE22 sing N N 58 GLN OXT HXT sing N N 59 GLU N CA sing N N 60 GLU N H sing N N 61 GLU N H2 sing N N 62 GLU CA C sing N N 63 GLU CA CB sing N N 64 GLU CA HA sing N N 65 GLU C O doub N N 66 GLU C OXT sing N N 67 GLU CB CG sing N N 68 GLU CB HB2 sing N N 69 GLU CB HB3 sing N N 70 GLU CG CD sing N N 71 GLU CG HG2 sing N N 72 GLU CG HG3 sing N N 73 GLU CD OE1 doub N N 74 GLU CD OE2 sing N N 75 GLU OE2 HE2 sing N N 76 GLU OXT HXT sing N N 77 GLY N CA sing N N 78 GLY N H sing N N 79 GLY N H2 sing N N 80 GLY CA C sing N N 81 GLY CA HA2 sing N N 82 GLY CA HA3 sing N N 83 GLY C O doub N N 84 GLY C OXT sing N N 85 GLY OXT HXT sing N N 86 HIS N CA sing N N 87 HIS N H sing N N 88 HIS N H2 sing N N 89 HIS CA C sing N N 90 HIS CA CB sing N N 91 HIS CA HA sing N N 92 HIS C O doub N N 93 HIS C OXT sing N N 94 HIS CB CG sing N N 95 HIS CB HB2 sing N N 96 HIS CB HB3 sing N N 97 HIS CG ND1 sing Y N 98 HIS CG CD2 doub Y N 99 HIS ND1 CE1 doub Y N 100 HIS ND1 HD1 sing N N 101 HIS CD2 NE2 sing Y N 102 HIS CD2 HD2 sing N N 103 HIS CE1 NE2 sing Y N 104 HIS CE1 HE1 sing N N 105 HIS NE2 HE2 sing N N 106 HIS OXT HXT sing N N 107 ILE N CA sing N N 108 ILE N H sing N N 109 ILE N H2 sing N N 110 ILE CA C sing N N 111 ILE CA CB sing N N 112 ILE CA HA sing N N 113 ILE C O doub N N 114 ILE C OXT sing N N 115 ILE CB CG1 sing N N 116 ILE CB CG2 sing N N 117 ILE CB HB sing N N 118 ILE CG1 CD1 sing N N 119 ILE CG1 HG12 sing N N 120 ILE CG1 HG13 sing N N 121 ILE CG2 HG21 sing N N 122 ILE CG2 HG22 sing N N 123 ILE CG2 HG23 sing N N 124 ILE CD1 HD11 sing N N 125 ILE CD1 HD12 sing N N 126 ILE CD1 HD13 sing N N 127 ILE OXT HXT sing N N 128 LYS N CA sing N N 129 LYS N H sing N N 130 LYS N H2 sing N N 131 LYS CA C sing N N 132 LYS CA CB sing N N 133 LYS CA HA sing N N 134 LYS C O doub N N 135 LYS C OXT sing N N 136 LYS CB CG sing N N 137 LYS CB HB2 sing N N 138 LYS CB HB3 sing N N 139 LYS CG CD sing N N 140 LYS CG HG2 sing N N 141 LYS CG HG3 sing N N 142 LYS CD CE sing N N 143 LYS CD HD2 sing N N 144 LYS CD HD3 sing N N 145 LYS CE NZ sing N N 146 LYS CE HE2 sing N N 147 LYS CE HE3 sing N N 148 LYS NZ HZ1 sing N N 149 LYS NZ HZ2 sing N N 150 LYS NZ HZ3 sing N N 151 LYS OXT HXT sing N N 152 MET N CA sing N N 153 MET N H sing N N 154 MET N H2 sing N N 155 MET CA C sing N N 156 MET CA CB sing N N 157 MET CA HA sing N N 158 MET C O doub N N 159 MET C OXT sing N N 160 MET CB CG sing N N 161 MET CB HB2 sing N N 162 MET CB HB3 sing N N 163 MET CG SD sing N N 164 MET CG HG2 sing N N 165 MET CG HG3 sing N N 166 MET SD CE sing N N 167 MET CE HE1 sing N N 168 MET CE HE2 sing N N 169 MET CE HE3 sing N N 170 MET OXT HXT sing N N 171 PHE N CA sing N N 172 PHE N H sing N N 173 PHE N H2 sing N N 174 PHE CA C sing N N 175 PHE CA CB sing N N 176 PHE CA HA sing N N 177 PHE C O doub N N 178 PHE C OXT sing N N 179 PHE CB CG sing N N 180 PHE CB HB2 sing N N 181 PHE CB HB3 sing N N 182 PHE CG CD1 doub Y N 183 PHE CG CD2 sing Y N 184 PHE CD1 CE1 sing Y N 185 PHE CD1 HD1 sing N N 186 PHE CD2 CE2 doub Y N 187 PHE CD2 HD2 sing N N 188 PHE CE1 CZ doub Y N 189 PHE CE1 HE1 sing N N 190 PHE CE2 CZ sing Y N 191 PHE CE2 HE2 sing N N 192 PHE CZ HZ sing N N 193 PHE OXT HXT sing N N 194 PRO N CA sing N N 195 PRO N CD sing N N 196 PRO N H sing N N 197 PRO CA C sing N N 198 PRO CA CB sing N N 199 PRO CA HA sing N N 200 PRO C O doub N N 201 PRO C OXT sing N N 202 PRO CB CG sing N N 203 PRO CB HB2 sing N N 204 PRO CB HB3 sing N N 205 PRO CG CD sing N N 206 PRO CG HG2 sing N N 207 PRO CG HG3 sing N N 208 PRO CD HD2 sing N N 209 PRO CD HD3 sing N N 210 PRO OXT HXT sing N N 211 SER N CA sing N N 212 SER N H sing N N 213 SER N H2 sing N N 214 SER CA C sing N N 215 SER CA CB sing N N 216 SER CA HA sing N N 217 SER C O doub N N 218 SER C OXT sing N N 219 SER CB OG sing N N 220 SER CB HB2 sing N N 221 SER CB HB3 sing N N 222 SER OG HG sing N N 223 SER OXT HXT sing N N 224 THR N CA sing N N 225 THR N H sing N N 226 THR N H2 sing N N 227 THR CA C sing N N 228 THR CA CB sing N N 229 THR CA HA sing N N 230 THR C O doub N N 231 THR C OXT sing N N 232 THR CB OG1 sing N N 233 THR CB CG2 sing N N 234 THR CB HB sing N N 235 THR OG1 HG1 sing N N 236 THR CG2 HG21 sing N N 237 THR CG2 HG22 sing N N 238 THR CG2 HG23 sing N N 239 THR OXT HXT sing N N 240 TRP N CA sing N N 241 TRP N H sing N N 242 TRP N H2 sing N N 243 TRP CA C sing N N 244 TRP CA CB sing N N 245 TRP CA HA sing N N 246 TRP C O doub N N 247 TRP C OXT sing N N 248 TRP CB CG sing N N 249 TRP CB HB2 sing N N 250 TRP CB HB3 sing N N 251 TRP CG CD1 doub Y N 252 TRP CG CD2 sing Y N 253 TRP CD1 NE1 sing Y N 254 TRP CD1 HD1 sing N N 255 TRP CD2 CE2 doub Y N 256 TRP CD2 CE3 sing Y N 257 TRP NE1 CE2 sing Y N 258 TRP NE1 HE1 sing N N 259 TRP CE2 CZ2 sing Y N 260 TRP CE3 CZ3 doub Y N 261 TRP CE3 HE3 sing N N 262 TRP CZ2 CH2 doub Y N 263 TRP CZ2 HZ2 sing N N 264 TRP CZ3 CH2 sing Y N 265 TRP CZ3 HZ3 sing N N 266 TRP CH2 HH2 sing N N 267 TRP OXT HXT sing N N 268 TYR N CA sing N N 269 TYR N H sing N N 270 TYR N H2 sing N N 271 TYR CA C sing N N 272 TYR CA CB sing N N 273 TYR CA HA sing N N 274 TYR C O doub N N 275 TYR C OXT sing N N 276 TYR CB CG sing N N 277 TYR CB HB2 sing N N 278 TYR CB HB3 sing N N 279 TYR CG CD1 doub Y N 280 TYR CG CD2 sing Y N 281 TYR CD1 CE1 sing Y N 282 TYR CD1 HD1 sing N N 283 TYR CD2 CE2 doub Y N 284 TYR CD2 HD2 sing N N 285 TYR CE1 CZ doub Y N 286 TYR CE1 HE1 sing N N 287 TYR CE2 CZ sing Y N 288 TYR CE2 HE2 sing N N 289 TYR CZ OH sing N N 290 TYR OH HH sing N N 291 TYR OXT HXT sing N N 292 VAL N CA sing N N 293 VAL N H sing N N 294 VAL N H2 sing N N 295 VAL CA C sing N N 296 VAL CA CB sing N N 297 VAL CA HA sing N N 298 VAL C O doub N N 299 VAL C OXT sing N N 300 VAL CB CG1 sing N N 301 VAL CB CG2 sing N N 302 VAL CB HB sing N N 303 VAL CG1 HG11 sing N N 304 VAL CG1 HG12 sing N N 305 VAL CG1 HG13 sing N N 306 VAL CG2 HG21 sing N N 307 VAL CG2 HG22 sing N N 308 VAL CG2 HG23 sing N N 309 VAL OXT HXT sing N N 310 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number 'RGPIN 141019-97' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 500 ? 2 AVANCE ? Bruker 800 ? # _atom_sites.entry_id 6CKU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_