data_6CT2 # _entry.id 6CT2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.298 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6CT2 WWPDB D_1000233344 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CT2 _pdbx_database_status.recvd_initial_deposition_date 2018-03-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ren, B.' 1 ? 'Peat, T.S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 560 _citation.language ? _citation.page_first 253 _citation.page_last 257 _citation.title 'Inhibitors of histone acetyltransferases KAT6A/B induce senescence and arrest tumour growth.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-018-0387-5 _citation.pdbx_database_id_PubMed 30069049 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Baell, J.B.' 1 ? primary 'Leaver, D.J.' 2 ? primary 'Hermans, S.J.' 3 ? primary 'Kelly, G.L.' 4 ? primary 'Brennan, M.S.' 5 ? primary 'Downer, N.L.' 6 ? primary 'Nguyen, N.' 7 ? primary 'Wichmann, J.' 8 ? primary 'McRae, H.M.' 9 ? primary 'Yang, Y.' 10 ? primary 'Cleary, B.' 11 ? primary 'Lagiakos, H.R.' 12 ? primary 'Mieruszynski, S.' 13 ? primary 'Pacini, G.' 14 ? primary 'Vanyai, H.K.' 15 ? primary 'Bergamasco, M.I.' 16 ? primary 'May, R.E.' 17 ? primary 'Davey, B.K.' 18 ? primary 'Morgan, K.J.' 19 ? primary 'Sealey, A.J.' 20 ? primary 'Wang, B.' 21 ? primary 'Zamudio, N.' 22 ? primary 'Wilcox, S.' 23 ? primary 'Garnham, A.L.' 24 ? primary 'Sheikh, B.N.' 25 ? primary 'Aubrey, B.J.' 26 ? primary 'Doggett, K.' 27 ? primary 'Chung, M.C.' 28 ? primary 'de Silva, M.' 29 ? primary 'Bentley, J.' 30 ? primary 'Pilling, P.' 31 ? primary 'Hattarki, M.' 32 ? primary 'Dolezal, O.' 33 ? primary 'Dennis, M.L.' 34 ? primary 'Falk, H.' 35 ? primary 'Ren, B.' 36 ? primary 'Charman, S.A.' 37 ? primary 'White, K.L.' 38 ? primary 'Rautela, J.' 39 ? primary 'Newbold, A.' 40 ? primary 'Hawkins, E.D.' 41 ? primary 'Johnstone, R.W.' 42 ? primary 'Huntington, N.D.' 43 ? primary 'Peat, T.S.' 44 ? primary 'Heath, J.K.' 45 ? primary 'Strasser, A.' 46 ? primary 'Parker, M.W.' 47 ? primary 'Smyth, G.K.' 48 ? primary 'Street, I.P.' 49 ? primary 'Monahan, B.J.' 50 ? primary 'Voss, A.K.' 51 ? primary 'Thomas, T.' 52 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6CT2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.892 _cell.length_a_esd ? _cell.length_b 56.080 _cell.length_b_esd ? _cell.length_c 120.919 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CT2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone acetyltransferase KAT8' 34532.727 1 2.3.1.48 ? ? ? 2 non-polymer syn "3-fluoro-N'-[(2-fluorophenyl)sulfonyl]-5-(pyridin-2-yl)benzohydrazide" 389.376 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 135 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lysine acetyltransferase 8,MOZ,YBF2/SAS3,SAS2 and TIP60 protein 1,hMOF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSTKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQ PPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDH(ALY)TLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPD GNNVSCIMILPPYQRRGYGRFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLENLRDFRGTLSIKDLSQMTS ITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSTKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQ PPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNV SCIMILPPYQRRGYGRFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLENLRDFRGTLSIKDLSQMTSITQN DIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 THR n 1 21 LYS n 1 22 VAL n 1 23 LYS n 1 24 TYR n 1 25 VAL n 1 26 ASP n 1 27 LYS n 1 28 ILE n 1 29 HIS n 1 30 ILE n 1 31 GLY n 1 32 ASN n 1 33 TYR n 1 34 GLU n 1 35 ILE n 1 36 ASP n 1 37 ALA n 1 38 TRP n 1 39 TYR n 1 40 PHE n 1 41 SER n 1 42 PRO n 1 43 PHE n 1 44 PRO n 1 45 GLU n 1 46 ASP n 1 47 TYR n 1 48 GLY n 1 49 LYS n 1 50 GLN n 1 51 PRO n 1 52 LYS n 1 53 LEU n 1 54 TRP n 1 55 LEU n 1 56 CYS n 1 57 GLU n 1 58 TYR n 1 59 CYS n 1 60 LEU n 1 61 LYS n 1 62 TYR n 1 63 MET n 1 64 LYS n 1 65 TYR n 1 66 GLU n 1 67 LYS n 1 68 SER n 1 69 TYR n 1 70 ARG n 1 71 PHE n 1 72 HIS n 1 73 LEU n 1 74 GLY n 1 75 GLN n 1 76 CYS n 1 77 GLN n 1 78 TRP n 1 79 ARG n 1 80 GLN n 1 81 PRO n 1 82 PRO n 1 83 GLY n 1 84 LYS n 1 85 GLU n 1 86 ILE n 1 87 TYR n 1 88 ARG n 1 89 LYS n 1 90 SER n 1 91 ASN n 1 92 ILE n 1 93 SER n 1 94 VAL n 1 95 HIS n 1 96 GLU n 1 97 VAL n 1 98 ASP n 1 99 GLY n 1 100 LYS n 1 101 ASP n 1 102 HIS n 1 103 LYS n 1 104 ILE n 1 105 TYR n 1 106 CYS n 1 107 GLN n 1 108 ASN n 1 109 LEU n 1 110 CYS n 1 111 LEU n 1 112 LEU n 1 113 ALA n 1 114 LYS n 1 115 LEU n 1 116 PHE n 1 117 LEU n 1 118 ASP n 1 119 HIS n 1 120 ALY n 1 121 THR n 1 122 LEU n 1 123 TYR n 1 124 PHE n 1 125 ASP n 1 126 VAL n 1 127 GLU n 1 128 PRO n 1 129 PHE n 1 130 VAL n 1 131 PHE n 1 132 TYR n 1 133 ILE n 1 134 LEU n 1 135 THR n 1 136 GLU n 1 137 VAL n 1 138 ASP n 1 139 ARG n 1 140 GLN n 1 141 GLY n 1 142 ALA n 1 143 HIS n 1 144 ILE n 1 145 VAL n 1 146 GLY n 1 147 TYR n 1 148 PHE n 1 149 SER n 1 150 LYS n 1 151 GLU n 1 152 LYS n 1 153 GLU n 1 154 SER n 1 155 PRO n 1 156 ASP n 1 157 GLY n 1 158 ASN n 1 159 ASN n 1 160 VAL n 1 161 SER n 1 162 CYS n 1 163 ILE n 1 164 MET n 1 165 ILE n 1 166 LEU n 1 167 PRO n 1 168 PRO n 1 169 TYR n 1 170 GLN n 1 171 ARG n 1 172 ARG n 1 173 GLY n 1 174 TYR n 1 175 GLY n 1 176 ARG n 1 177 PHE n 1 178 LEU n 1 179 ILE n 1 180 ALA n 1 181 PHE n 1 182 SER n 1 183 TYR n 1 184 GLU n 1 185 LEU n 1 186 SER n 1 187 LYS n 1 188 LEU n 1 189 GLU n 1 190 SER n 1 191 THR n 1 192 VAL n 1 193 GLY n 1 194 SER n 1 195 PRO n 1 196 GLU n 1 197 LYS n 1 198 PRO n 1 199 LEU n 1 200 SER n 1 201 ASP n 1 202 LEU n 1 203 GLY n 1 204 LYS n 1 205 LEU n 1 206 SER n 1 207 TYR n 1 208 ARG n 1 209 SER n 1 210 TYR n 1 211 TRP n 1 212 SER n 1 213 TRP n 1 214 VAL n 1 215 LEU n 1 216 LEU n 1 217 GLU n 1 218 ASN n 1 219 LEU n 1 220 ARG n 1 221 ASP n 1 222 PHE n 1 223 ARG n 1 224 GLY n 1 225 THR n 1 226 LEU n 1 227 SER n 1 228 ILE n 1 229 LYS n 1 230 ASP n 1 231 LEU n 1 232 SER n 1 233 GLN n 1 234 MET n 1 235 THR n 1 236 SER n 1 237 ILE n 1 238 THR n 1 239 GLN n 1 240 ASN n 1 241 ASP n 1 242 ILE n 1 243 ILE n 1 244 SER n 1 245 THR n 1 246 LEU n 1 247 GLN n 1 248 SER n 1 249 LEU n 1 250 ASN n 1 251 MET n 1 252 VAL n 1 253 LYS n 1 254 TYR n 1 255 TRP n 1 256 LYS n 1 257 GLY n 1 258 GLN n 1 259 HIS n 1 260 VAL n 1 261 ILE n 1 262 CYS n 1 263 VAL n 1 264 THR n 1 265 PRO n 1 266 LYS n 1 267 LEU n 1 268 VAL n 1 269 GLU n 1 270 GLU n 1 271 HIS n 1 272 LEU n 1 273 LYS n 1 274 SER n 1 275 ALA n 1 276 GLN n 1 277 TYR n 1 278 LYS n 1 279 LYS n 1 280 PRO n 1 281 PRO n 1 282 ILE n 1 283 THR n 1 284 VAL n 1 285 ASP n 1 286 SER n 1 287 VAL n 1 288 CYS n 1 289 LEU n 1 290 LYS n 1 291 TRP n 1 292 ALA n 1 293 PRO n 1 294 PRO n 1 295 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 295 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KAT8, MOF, MYST1, PP7073' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KAT8_HUMAN _struct_ref.pdbx_db_accession Q9H7Z6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDG KDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLI AFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQH VICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPK ; _struct_ref.pdbx_align_begin 174 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CT2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 295 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H7Z6 _struct_ref_seq.db_align_beg 174 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 449 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 504 _struct_ref_seq.pdbx_auth_seq_align_end 779 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6CT2 MET A 1 ? UNP Q9H7Z6 ? ? 'initiating methionine' 485 1 1 6CT2 GLY A 2 ? UNP Q9H7Z6 ? ? 'expression tag' 486 2 1 6CT2 SER A 3 ? UNP Q9H7Z6 ? ? 'expression tag' 487 3 1 6CT2 SER A 4 ? UNP Q9H7Z6 ? ? 'expression tag' 488 4 1 6CT2 HIS A 5 ? UNP Q9H7Z6 ? ? 'expression tag' 489 5 1 6CT2 HIS A 6 ? UNP Q9H7Z6 ? ? 'expression tag' 490 6 1 6CT2 HIS A 7 ? UNP Q9H7Z6 ? ? 'expression tag' 491 7 1 6CT2 HIS A 8 ? UNP Q9H7Z6 ? ? 'expression tag' 492 8 1 6CT2 HIS A 9 ? UNP Q9H7Z6 ? ? 'expression tag' 493 9 1 6CT2 HIS A 10 ? UNP Q9H7Z6 ? ? 'expression tag' 494 10 1 6CT2 SER A 11 ? UNP Q9H7Z6 ? ? 'expression tag' 495 11 1 6CT2 SER A 12 ? UNP Q9H7Z6 ? ? 'expression tag' 496 12 1 6CT2 GLY A 13 ? UNP Q9H7Z6 ? ? 'expression tag' 497 13 1 6CT2 LEU A 14 ? UNP Q9H7Z6 ? ? 'expression tag' 498 14 1 6CT2 VAL A 15 ? UNP Q9H7Z6 ? ? 'expression tag' 499 15 1 6CT2 PRO A 16 ? UNP Q9H7Z6 ? ? 'expression tag' 500 16 1 6CT2 ARG A 17 ? UNP Q9H7Z6 ? ? 'expression tag' 501 17 1 6CT2 GLY A 18 ? UNP Q9H7Z6 ? ? 'expression tag' 502 18 1 6CT2 SER A 19 ? UNP Q9H7Z6 ? ? 'expression tag' 503 19 1 6CT2 HIS A 95 ? UNP Q9H7Z6 TYR 249 conflict 579 20 1 6CT2 SER A 161 ? UNP Q9H7Z6 ALA 315 conflict 645 21 1 6CT2 MET A 164 ? UNP Q9H7Z6 LEU 318 conflict 648 22 1 6CT2 ILE A 165 ? UNP Q9H7Z6 THR 319 conflict 649 23 1 6CT2 ARG A 176 ? UNP Q9H7Z6 LYS 330 conflict 660 24 1 6CT2 ASN A 218 ? UNP Q9H7Z6 ILE 372 conflict 702 25 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FCV non-polymer . "3-fluoro-N'-[(2-fluorophenyl)sulfonyl]-5-(pyridin-2-yl)benzohydrazide" ? 'C18 H13 F2 N3 O3 S' 389.376 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CT2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 281 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.196 M MgCl2, 19.5 % PEG 3350, and 0.1 M bis-tris chloride at pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6CT2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.128 _reflns.d_resolution_low 45.89 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18176 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.13 _reflns_shell.d_res_low 2.19 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CT2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.128 _refine.ls_d_res_low 42.906 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18122 _refine.ls_number_reflns_R_free 1812 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.66 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2041 _refine.ls_R_factor_R_free 0.2355 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2005 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.80 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2261 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 135 _refine_hist.number_atoms_total 2425 _refine_hist.d_res_high 2.128 _refine_hist.d_res_low 42.906 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2387 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.650 ? 3245 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 3.602 ? 1972 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 338 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 405 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1276 2.1851 . . 133 1192 96.00 . . . 0.2875 . 0.2702 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1851 2.2494 . . 136 1219 100.00 . . . 0.2722 . 0.2394 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2494 2.3220 . . 136 1234 100.00 . . . 0.2621 . 0.2313 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3220 2.4050 . . 137 1227 100.00 . . . 0.2425 . 0.2278 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4050 2.5013 . . 138 1243 100.00 . . . 0.2612 . 0.2306 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5013 2.6151 . . 138 1252 100.00 . . . 0.2435 . 0.2257 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6151 2.7530 . . 138 1246 100.00 . . . 0.2830 . 0.2226 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7530 2.9254 . . 138 1237 100.00 . . . 0.2279 . 0.2175 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9254 3.1512 . . 140 1268 100.00 . . . 0.2878 . 0.2051 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1512 3.4682 . . 141 1261 100.00 . . . 0.2207 . 0.1886 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4682 3.9698 . . 140 1262 100.00 . . . 0.2390 . 0.1699 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9698 5.0003 . . 144 1299 100.00 . . . 0.1764 . 0.1637 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.0003 42.9145 . . 153 1370 100.00 . . . 0.2272 . 0.2031 . . . . . . . . . . # _struct.entry_id 6CT2 _struct.title 'MYST histone acetyltransferase KAT6A/B in complex with WM-1119' _struct.pdbx_descriptor 'Histone acetyltransferase KAT8 (E.C.2.3.1.48)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CT2 _struct_keywords.text 'complex, lysine acetyltransferases, TRANSFERASE, TRANSFERASE-INHIBITOR complex' _struct_keywords.pdbx_keywords TRANSFERASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 44 ? LYS A 49 ? PRO A 528 LYS A 533 1 ? 6 HELX_P HELX_P2 AA2 TYR A 65 ? CYS A 76 ? TYR A 549 CYS A 560 1 ? 12 HELX_P HELX_P3 AA3 HIS A 102 ? LEU A 115 ? HIS A 586 LEU A 599 1 ? 14 HELX_P HELX_P4 AA4 PRO A 167 ? GLN A 170 ? PRO A 651 GLN A 654 5 ? 4 HELX_P HELX_P5 AA5 GLY A 173 ? GLU A 189 ? GLY A 657 GLU A 673 1 ? 17 HELX_P HELX_P6 AA6 SER A 200 ? PHE A 222 ? SER A 684 PHE A 706 1 ? 23 HELX_P HELX_P7 AA7 SER A 227 ? SER A 236 ? SER A 711 SER A 720 1 ? 10 HELX_P HELX_P8 AA8 THR A 238 ? ASN A 250 ? THR A 722 ASN A 734 1 ? 13 HELX_P HELX_P9 AA9 THR A 264 ? LYS A 273 ? THR A 748 LYS A 757 1 ? 10 HELX_P HELX_P10 AB1 SER A 274 ? LYS A 279 ? SER A 758 LYS A 763 5 ? 6 HELX_P HELX_P11 AB2 ASP A 285 ? LEU A 289 ? ASP A 769 LEU A 773 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A CYS 56 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 540 A ZN 802 1_555 ? ? ? ? ? ? ? 2.257 ? metalc2 metalc ? ? A CYS 59 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 543 A ZN 802 1_555 ? ? ? ? ? ? ? 2.282 ? metalc3 metalc ? ? A HIS 72 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 556 A ZN 802 1_555 ? ? ? ? ? ? ? 2.130 ? metalc4 metalc ? ? A CYS 76 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 560 A ZN 802 1_555 ? ? ? ? ? ? ? 2.280 ? covale1 covale both ? A HIS 119 C ? ? ? 1_555 A ALY 120 N ? ? A HIS 603 A ALY 604 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale both ? A ALY 120 C ? ? ? 1_555 A THR 121 N ? ? A ALY 604 A THR 605 1_555 ? ? ? ? ? ? ? 1.332 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 197 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 681 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 198 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 682 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.16 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 33 ? ASP A 36 ? TYR A 517 ASP A 520 AA1 2 LYS A 27 ? ILE A 30 ? LYS A 511 ILE A 514 AA1 3 LEU A 53 ? LEU A 55 ? LEU A 537 LEU A 539 AA1 4 TYR A 62 ? MET A 63 ? TYR A 546 MET A 547 AA2 1 LYS A 84 ? LYS A 89 ? LYS A 568 LYS A 573 AA2 2 ILE A 92 ? ASP A 98 ? ILE A 576 ASP A 582 AA2 3 PHE A 129 ? VAL A 137 ? PHE A 613 VAL A 621 AA2 4 ALA A 142 ? GLU A 151 ? ALA A 626 GLU A 635 AA2 5 ILE A 163 ? ILE A 165 ? ILE A 647 ILE A 649 AA3 1 ASN A 158 ? VAL A 160 ? ASN A 642 VAL A 644 AA3 2 SER A 194 ? PRO A 195 ? SER A 678 PRO A 679 AA4 1 VAL A 252 ? TRP A 255 ? VAL A 736 TRP A 739 AA4 2 GLN A 258 ? ILE A 261 ? GLN A 742 ILE A 745 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 35 ? O ILE A 519 N ILE A 28 ? N ILE A 512 AA1 2 3 N HIS A 29 ? N HIS A 513 O LEU A 55 ? O LEU A 539 AA1 3 4 N TRP A 54 ? N TRP A 538 O MET A 63 ? O MET A 547 AA2 1 2 N LYS A 84 ? N LYS A 568 O GLU A 96 ? O GLU A 580 AA2 2 3 N VAL A 97 ? N VAL A 581 O PHE A 131 ? O PHE A 615 AA2 3 4 N LEU A 134 ? N LEU A 618 O VAL A 145 ? O VAL A 629 AA2 4 5 N TYR A 147 ? N TYR A 631 O MET A 164 ? O MET A 648 AA3 1 2 N VAL A 160 ? N VAL A 644 O SER A 194 ? O SER A 678 AA4 1 2 N LYS A 253 ? N LYS A 737 O VAL A 260 ? O VAL A 744 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FCV 801 ? 19 'binding site for residue FCV A 801' AC2 Software A ZN 802 ? 4 'binding site for residue ZN A 802' AC3 Software A MG 803 ? 2 'binding site for residue MG A 803' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 PHE A 116 ? PHE A 600 . ? 1_555 ? 2 AC1 19 LEU A 117 ? LEU A 601 . ? 1_555 ? 3 AC1 19 ILE A 163 ? ILE A 647 . ? 1_555 ? 4 AC1 19 MET A 164 ? MET A 648 . ? 1_555 ? 5 AC1 19 ILE A 165 ? ILE A 649 . ? 1_555 ? 6 AC1 19 GLN A 170 ? GLN A 654 . ? 1_555 ? 7 AC1 19 ARG A 171 ? ARG A 655 . ? 1_555 ? 8 AC1 19 ARG A 172 ? ARG A 656 . ? 1_555 ? 9 AC1 19 GLY A 173 ? GLY A 657 . ? 1_555 ? 10 AC1 19 TYR A 174 ? TYR A 658 . ? 1_555 ? 11 AC1 19 GLY A 175 ? GLY A 659 . ? 1_555 ? 12 AC1 19 ARG A 176 ? ARG A 660 . ? 1_555 ? 13 AC1 19 SER A 200 ? SER A 684 . ? 1_555 ? 14 AC1 19 LEU A 202 ? LEU A 686 . ? 1_555 ? 15 AC1 19 GLY A 203 ? GLY A 687 . ? 1_555 ? 16 AC1 19 SER A 206 ? SER A 690 . ? 1_555 ? 17 AC1 19 SER A 209 ? SER A 693 . ? 1_555 ? 18 AC1 19 HOH E . ? HOH A 951 . ? 1_555 ? 19 AC1 19 HOH E . ? HOH A 983 . ? 1_555 ? 20 AC2 4 CYS A 56 ? CYS A 540 . ? 1_555 ? 21 AC2 4 CYS A 59 ? CYS A 543 . ? 1_555 ? 22 AC2 4 HIS A 72 ? HIS A 556 . ? 1_555 ? 23 AC2 4 CYS A 76 ? CYS A 560 . ? 1_555 ? 24 AC3 2 ASP A 36 ? ASP A 520 . ? 1_555 ? 25 AC3 2 HOH E . ? HOH A 946 . ? 1_555 ? # _atom_sites.entry_id 6CT2 _atom_sites.fract_transf_matrix[1][1] 0.021790 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017832 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008270 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F MG N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 485 ? ? ? A . n A 1 2 GLY 2 486 ? ? ? A . n A 1 3 SER 3 487 ? ? ? A . n A 1 4 SER 4 488 ? ? ? A . n A 1 5 HIS 5 489 ? ? ? A . n A 1 6 HIS 6 490 ? ? ? A . n A 1 7 HIS 7 491 ? ? ? A . n A 1 8 HIS 8 492 ? ? ? A . n A 1 9 HIS 9 493 ? ? ? A . n A 1 10 HIS 10 494 ? ? ? A . n A 1 11 SER 11 495 ? ? ? A . n A 1 12 SER 12 496 ? ? ? A . n A 1 13 GLY 13 497 ? ? ? A . n A 1 14 LEU 14 498 ? ? ? A . n A 1 15 VAL 15 499 ? ? ? A . n A 1 16 PRO 16 500 ? ? ? A . n A 1 17 ARG 17 501 ? ? ? A . n A 1 18 GLY 18 502 ? ? ? A . n A 1 19 SER 19 503 ? ? ? A . n A 1 20 THR 20 504 ? ? ? A . n A 1 21 LYS 21 505 ? ? ? A . n A 1 22 VAL 22 506 506 VAL VAL A . n A 1 23 LYS 23 507 507 LYS LYS A . n A 1 24 TYR 24 508 508 TYR TYR A . n A 1 25 VAL 25 509 509 VAL VAL A . n A 1 26 ASP 26 510 510 ASP ASP A . n A 1 27 LYS 27 511 511 LYS LYS A . n A 1 28 ILE 28 512 512 ILE ILE A . n A 1 29 HIS 29 513 513 HIS HIS A . n A 1 30 ILE 30 514 514 ILE ILE A . n A 1 31 GLY 31 515 515 GLY GLY A . n A 1 32 ASN 32 516 516 ASN ASN A . n A 1 33 TYR 33 517 517 TYR TYR A . n A 1 34 GLU 34 518 518 GLU GLU A . n A 1 35 ILE 35 519 519 ILE ILE A . n A 1 36 ASP 36 520 520 ASP ASP A . n A 1 37 ALA 37 521 521 ALA ALA A . n A 1 38 TRP 38 522 522 TRP TRP A . n A 1 39 TYR 39 523 523 TYR TYR A . n A 1 40 PHE 40 524 524 PHE PHE A . n A 1 41 SER 41 525 525 SER SER A . n A 1 42 PRO 42 526 526 PRO PRO A . n A 1 43 PHE 43 527 527 PHE PHE A . n A 1 44 PRO 44 528 528 PRO PRO A . n A 1 45 GLU 45 529 529 GLU GLU A . n A 1 46 ASP 46 530 530 ASP ASP A . n A 1 47 TYR 47 531 531 TYR TYR A . n A 1 48 GLY 48 532 532 GLY GLY A . n A 1 49 LYS 49 533 533 LYS LYS A . n A 1 50 GLN 50 534 534 GLN GLN A . n A 1 51 PRO 51 535 535 PRO PRO A . n A 1 52 LYS 52 536 536 LYS LYS A . n A 1 53 LEU 53 537 537 LEU LEU A . n A 1 54 TRP 54 538 538 TRP TRP A . n A 1 55 LEU 55 539 539 LEU LEU A . n A 1 56 CYS 56 540 540 CYS CYS A . n A 1 57 GLU 57 541 541 GLU GLU A . n A 1 58 TYR 58 542 542 TYR TYR A . n A 1 59 CYS 59 543 543 CYS CYS A . n A 1 60 LEU 60 544 544 LEU LEU A . n A 1 61 LYS 61 545 545 LYS LYS A . n A 1 62 TYR 62 546 546 TYR TYR A . n A 1 63 MET 63 547 547 MET MET A . n A 1 64 LYS 64 548 548 LYS LYS A . n A 1 65 TYR 65 549 549 TYR TYR A . n A 1 66 GLU 66 550 550 GLU GLU A . n A 1 67 LYS 67 551 551 LYS LYS A . n A 1 68 SER 68 552 552 SER SER A . n A 1 69 TYR 69 553 553 TYR TYR A . n A 1 70 ARG 70 554 554 ARG ARG A . n A 1 71 PHE 71 555 555 PHE PHE A . n A 1 72 HIS 72 556 556 HIS HIS A . n A 1 73 LEU 73 557 557 LEU LEU A . n A 1 74 GLY 74 558 558 GLY GLY A . n A 1 75 GLN 75 559 559 GLN GLN A . n A 1 76 CYS 76 560 560 CYS CYS A . n A 1 77 GLN 77 561 561 GLN GLN A . n A 1 78 TRP 78 562 562 TRP TRP A . n A 1 79 ARG 79 563 563 ARG ARG A . n A 1 80 GLN 80 564 564 GLN GLN A . n A 1 81 PRO 81 565 565 PRO PRO A . n A 1 82 PRO 82 566 566 PRO PRO A . n A 1 83 GLY 83 567 567 GLY GLY A . n A 1 84 LYS 84 568 568 LYS LYS A . n A 1 85 GLU 85 569 569 GLU GLU A . n A 1 86 ILE 86 570 570 ILE ILE A . n A 1 87 TYR 87 571 571 TYR TYR A . n A 1 88 ARG 88 572 572 ARG ARG A . n A 1 89 LYS 89 573 573 LYS LYS A . n A 1 90 SER 90 574 574 SER SER A . n A 1 91 ASN 91 575 575 ASN ASN A . n A 1 92 ILE 92 576 576 ILE ILE A . n A 1 93 SER 93 577 577 SER SER A . n A 1 94 VAL 94 578 578 VAL VAL A . n A 1 95 HIS 95 579 579 HIS HIS A . n A 1 96 GLU 96 580 580 GLU GLU A . n A 1 97 VAL 97 581 581 VAL VAL A . n A 1 98 ASP 98 582 582 ASP ASP A . n A 1 99 GLY 99 583 583 GLY GLY A . n A 1 100 LYS 100 584 584 LYS LYS A . n A 1 101 ASP 101 585 585 ASP ASP A . n A 1 102 HIS 102 586 586 HIS HIS A . n A 1 103 LYS 103 587 587 LYS LYS A . n A 1 104 ILE 104 588 588 ILE ILE A . n A 1 105 TYR 105 589 589 TYR TYR A . n A 1 106 CYS 106 590 590 CYS CYS A . n A 1 107 GLN 107 591 591 GLN GLN A . n A 1 108 ASN 108 592 592 ASN ASN A . n A 1 109 LEU 109 593 593 LEU LEU A . n A 1 110 CYS 110 594 594 CYS CYS A . n A 1 111 LEU 111 595 595 LEU LEU A . n A 1 112 LEU 112 596 596 LEU LEU A . n A 1 113 ALA 113 597 597 ALA ALA A . n A 1 114 LYS 114 598 598 LYS LYS A . n A 1 115 LEU 115 599 599 LEU LEU A . n A 1 116 PHE 116 600 600 PHE PHE A . n A 1 117 LEU 117 601 601 LEU LEU A . n A 1 118 ASP 118 602 602 ASP ASP A . n A 1 119 HIS 119 603 603 HIS HIS A . n A 1 120 ALY 120 604 604 ALY ALY A . n A 1 121 THR 121 605 605 THR THR A . n A 1 122 LEU 122 606 606 LEU LEU A . n A 1 123 TYR 123 607 607 TYR TYR A . n A 1 124 PHE 124 608 608 PHE PHE A . n A 1 125 ASP 125 609 609 ASP ASP A . n A 1 126 VAL 126 610 610 VAL VAL A . n A 1 127 GLU 127 611 611 GLU GLU A . n A 1 128 PRO 128 612 612 PRO PRO A . n A 1 129 PHE 129 613 613 PHE PHE A . n A 1 130 VAL 130 614 614 VAL VAL A . n A 1 131 PHE 131 615 615 PHE PHE A . n A 1 132 TYR 132 616 616 TYR TYR A . n A 1 133 ILE 133 617 617 ILE ILE A . n A 1 134 LEU 134 618 618 LEU LEU A . n A 1 135 THR 135 619 619 THR THR A . n A 1 136 GLU 136 620 620 GLU GLU A . n A 1 137 VAL 137 621 621 VAL VAL A . n A 1 138 ASP 138 622 622 ASP ASP A . n A 1 139 ARG 139 623 623 ARG ARG A . n A 1 140 GLN 140 624 624 GLN GLN A . n A 1 141 GLY 141 625 625 GLY GLY A . n A 1 142 ALA 142 626 626 ALA ALA A . n A 1 143 HIS 143 627 627 HIS HIS A . n A 1 144 ILE 144 628 628 ILE ILE A . n A 1 145 VAL 145 629 629 VAL VAL A . n A 1 146 GLY 146 630 630 GLY GLY A . n A 1 147 TYR 147 631 631 TYR TYR A . n A 1 148 PHE 148 632 632 PHE PHE A . n A 1 149 SER 149 633 633 SER SER A . n A 1 150 LYS 150 634 634 LYS LYS A . n A 1 151 GLU 151 635 635 GLU GLU A . n A 1 152 LYS 152 636 636 LYS LYS A . n A 1 153 GLU 153 637 637 GLU GLU A . n A 1 154 SER 154 638 638 SER SER A . n A 1 155 PRO 155 639 639 PRO PRO A . n A 1 156 ASP 156 640 640 ASP ASP A . n A 1 157 GLY 157 641 641 GLY GLY A . n A 1 158 ASN 158 642 642 ASN ASN A . n A 1 159 ASN 159 643 643 ASN ASN A . n A 1 160 VAL 160 644 644 VAL VAL A . n A 1 161 SER 161 645 645 SER SER A . n A 1 162 CYS 162 646 646 CYS CYS A . n A 1 163 ILE 163 647 647 ILE ILE A . n A 1 164 MET 164 648 648 MET MET A . n A 1 165 ILE 165 649 649 ILE ILE A . n A 1 166 LEU 166 650 650 LEU LEU A . n A 1 167 PRO 167 651 651 PRO PRO A . n A 1 168 PRO 168 652 652 PRO PRO A . n A 1 169 TYR 169 653 653 TYR TYR A . n A 1 170 GLN 170 654 654 GLN GLN A . n A 1 171 ARG 171 655 655 ARG ARG A . n A 1 172 ARG 172 656 656 ARG ARG A . n A 1 173 GLY 173 657 657 GLY GLY A . n A 1 174 TYR 174 658 658 TYR TYR A . n A 1 175 GLY 175 659 659 GLY GLY A . n A 1 176 ARG 176 660 660 ARG ARG A . n A 1 177 PHE 177 661 661 PHE PHE A . n A 1 178 LEU 178 662 662 LEU LEU A . n A 1 179 ILE 179 663 663 ILE ILE A . n A 1 180 ALA 180 664 664 ALA ALA A . n A 1 181 PHE 181 665 665 PHE PHE A . n A 1 182 SER 182 666 666 SER SER A . n A 1 183 TYR 183 667 667 TYR TYR A . n A 1 184 GLU 184 668 668 GLU GLU A . n A 1 185 LEU 185 669 669 LEU LEU A . n A 1 186 SER 186 670 670 SER SER A . n A 1 187 LYS 187 671 671 LYS LYS A . n A 1 188 LEU 188 672 672 LEU LEU A . n A 1 189 GLU 189 673 673 GLU GLU A . n A 1 190 SER 190 674 674 SER SER A . n A 1 191 THR 191 675 675 THR THR A . n A 1 192 VAL 192 676 676 VAL VAL A . n A 1 193 GLY 193 677 677 GLY GLY A . n A 1 194 SER 194 678 678 SER SER A . n A 1 195 PRO 195 679 679 PRO PRO A . n A 1 196 GLU 196 680 680 GLU GLU A . n A 1 197 LYS 197 681 681 LYS LYS A . n A 1 198 PRO 198 682 682 PRO PRO A . n A 1 199 LEU 199 683 683 LEU LEU A . n A 1 200 SER 200 684 684 SER SER A . n A 1 201 ASP 201 685 685 ASP ASP A . n A 1 202 LEU 202 686 686 LEU LEU A . n A 1 203 GLY 203 687 687 GLY GLY A . n A 1 204 LYS 204 688 688 LYS LYS A . n A 1 205 LEU 205 689 689 LEU LEU A . n A 1 206 SER 206 690 690 SER SER A . n A 1 207 TYR 207 691 691 TYR TYR A . n A 1 208 ARG 208 692 692 ARG ARG A . n A 1 209 SER 209 693 693 SER SER A . n A 1 210 TYR 210 694 694 TYR TYR A . n A 1 211 TRP 211 695 695 TRP TRP A . n A 1 212 SER 212 696 696 SER SER A . n A 1 213 TRP 213 697 697 TRP TRP A . n A 1 214 VAL 214 698 698 VAL VAL A . n A 1 215 LEU 215 699 699 LEU LEU A . n A 1 216 LEU 216 700 700 LEU LEU A . n A 1 217 GLU 217 701 701 GLU GLU A . n A 1 218 ASN 218 702 702 ASN ASN A . n A 1 219 LEU 219 703 703 LEU LEU A . n A 1 220 ARG 220 704 704 ARG ARG A . n A 1 221 ASP 221 705 705 ASP ASP A . n A 1 222 PHE 222 706 706 PHE PHE A . n A 1 223 ARG 223 707 707 ARG ARG A . n A 1 224 GLY 224 708 708 GLY GLY A . n A 1 225 THR 225 709 709 THR THR A . n A 1 226 LEU 226 710 710 LEU LEU A . n A 1 227 SER 227 711 711 SER SER A . n A 1 228 ILE 228 712 712 ILE ILE A . n A 1 229 LYS 229 713 713 LYS LYS A . n A 1 230 ASP 230 714 714 ASP ASP A . n A 1 231 LEU 231 715 715 LEU LEU A . n A 1 232 SER 232 716 716 SER SER A . n A 1 233 GLN 233 717 717 GLN GLN A . n A 1 234 MET 234 718 718 MET MET A . n A 1 235 THR 235 719 719 THR THR A . n A 1 236 SER 236 720 720 SER SER A . n A 1 237 ILE 237 721 721 ILE ILE A . n A 1 238 THR 238 722 722 THR THR A . n A 1 239 GLN 239 723 723 GLN GLN A . n A 1 240 ASN 240 724 724 ASN ASN A . n A 1 241 ASP 241 725 725 ASP ASP A . n A 1 242 ILE 242 726 726 ILE ILE A . n A 1 243 ILE 243 727 727 ILE ILE A . n A 1 244 SER 244 728 728 SER SER A . n A 1 245 THR 245 729 729 THR THR A . n A 1 246 LEU 246 730 730 LEU LEU A . n A 1 247 GLN 247 731 731 GLN GLN A . n A 1 248 SER 248 732 732 SER SER A . n A 1 249 LEU 249 733 733 LEU LEU A . n A 1 250 ASN 250 734 734 ASN ASN A . n A 1 251 MET 251 735 735 MET MET A . n A 1 252 VAL 252 736 736 VAL VAL A . n A 1 253 LYS 253 737 737 LYS LYS A . n A 1 254 TYR 254 738 738 TYR TYR A . n A 1 255 TRP 255 739 739 TRP TRP A . n A 1 256 LYS 256 740 740 LYS LYS A . n A 1 257 GLY 257 741 741 GLY GLY A . n A 1 258 GLN 258 742 742 GLN GLN A . n A 1 259 HIS 259 743 743 HIS HIS A . n A 1 260 VAL 260 744 744 VAL VAL A . n A 1 261 ILE 261 745 745 ILE ILE A . n A 1 262 CYS 262 746 746 CYS CYS A . n A 1 263 VAL 263 747 747 VAL VAL A . n A 1 264 THR 264 748 748 THR THR A . n A 1 265 PRO 265 749 749 PRO PRO A . n A 1 266 LYS 266 750 750 LYS LYS A . n A 1 267 LEU 267 751 751 LEU LEU A . n A 1 268 VAL 268 752 752 VAL VAL A . n A 1 269 GLU 269 753 753 GLU GLU A . n A 1 270 GLU 270 754 754 GLU GLU A . n A 1 271 HIS 271 755 755 HIS HIS A . n A 1 272 LEU 272 756 756 LEU LEU A . n A 1 273 LYS 273 757 757 LYS LYS A . n A 1 274 SER 274 758 758 SER SER A . n A 1 275 ALA 275 759 759 ALA ALA A . n A 1 276 GLN 276 760 760 GLN GLN A . n A 1 277 TYR 277 761 761 TYR TYR A . n A 1 278 LYS 278 762 762 LYS LYS A . n A 1 279 LYS 279 763 763 LYS LYS A . n A 1 280 PRO 280 764 764 PRO PRO A . n A 1 281 PRO 281 765 765 PRO PRO A . n A 1 282 ILE 282 766 766 ILE ILE A . n A 1 283 THR 283 767 767 THR THR A . n A 1 284 VAL 284 768 768 VAL VAL A . n A 1 285 ASP 285 769 769 ASP ASP A . n A 1 286 SER 286 770 770 SER SER A . n A 1 287 VAL 287 771 771 VAL VAL A . n A 1 288 CYS 288 772 772 CYS CYS A . n A 1 289 LEU 289 773 773 LEU LEU A . n A 1 290 LYS 290 774 774 LYS LYS A . n A 1 291 TRP 291 775 775 TRP TRP A . n A 1 292 ALA 292 776 776 ALA ALA A . n A 1 293 PRO 293 777 777 PRO PRO A . n A 1 294 PRO 294 778 778 PRO PRO A . n A 1 295 LYS 295 779 779 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FCV 1 801 1 FCV CTX A . C 3 ZN 1 802 1 ZN ZN A . D 4 MG 1 803 1 MG MG A . E 5 HOH 1 901 97 HOH HOH A . E 5 HOH 2 902 31 HOH HOH A . E 5 HOH 3 903 27 HOH HOH A . E 5 HOH 4 904 110 HOH HOH A . E 5 HOH 5 905 96 HOH HOH A . E 5 HOH 6 906 68 HOH HOH A . E 5 HOH 7 907 76 HOH HOH A . E 5 HOH 8 908 125 HOH HOH A . E 5 HOH 9 909 100 HOH HOH A . E 5 HOH 10 910 3 HOH HOH A . E 5 HOH 11 911 128 HOH HOH A . E 5 HOH 12 912 102 HOH HOH A . E 5 HOH 13 913 2 HOH HOH A . E 5 HOH 14 914 17 HOH HOH A . E 5 HOH 15 915 82 HOH HOH A . E 5 HOH 16 916 89 HOH HOH A . E 5 HOH 17 917 112 HOH HOH A . E 5 HOH 18 918 42 HOH HOH A . E 5 HOH 19 919 91 HOH HOH A . E 5 HOH 20 920 74 HOH HOH A . E 5 HOH 21 921 62 HOH HOH A . E 5 HOH 22 922 93 HOH HOH A . E 5 HOH 23 923 78 HOH HOH A . E 5 HOH 24 924 101 HOH HOH A . E 5 HOH 25 925 45 HOH HOH A . E 5 HOH 26 926 131 HOH HOH A . E 5 HOH 27 927 5 HOH HOH A . E 5 HOH 28 928 4 HOH HOH A . E 5 HOH 29 929 121 HOH HOH A . E 5 HOH 30 930 6 HOH HOH A . E 5 HOH 31 931 63 HOH HOH A . E 5 HOH 32 932 122 HOH HOH A . E 5 HOH 33 933 34 HOH HOH A . E 5 HOH 34 934 59 HOH HOH A . E 5 HOH 35 935 30 HOH HOH A . E 5 HOH 36 936 20 HOH HOH A . E 5 HOH 37 937 22 HOH HOH A . E 5 HOH 38 938 25 HOH HOH A . E 5 HOH 39 939 36 HOH HOH A . E 5 HOH 40 940 58 HOH HOH A . E 5 HOH 41 941 12 HOH HOH A . E 5 HOH 42 942 41 HOH HOH A . E 5 HOH 43 943 111 HOH HOH A . E 5 HOH 44 944 19 HOH HOH A . E 5 HOH 45 945 39 HOH HOH A . E 5 HOH 46 946 29 HOH HOH A . E 5 HOH 47 947 71 HOH HOH A . E 5 HOH 48 948 129 HOH HOH A . E 5 HOH 49 949 61 HOH HOH A . E 5 HOH 50 950 13 HOH HOH A . E 5 HOH 51 951 1 HOH HOH A . E 5 HOH 52 952 115 HOH HOH A . E 5 HOH 53 953 16 HOH HOH A . E 5 HOH 54 954 83 HOH HOH A . E 5 HOH 55 955 26 HOH HOH A . E 5 HOH 56 956 119 HOH HOH A . E 5 HOH 57 957 75 HOH HOH A . E 5 HOH 58 958 79 HOH HOH A . E 5 HOH 59 959 38 HOH HOH A . E 5 HOH 60 960 72 HOH HOH A . E 5 HOH 61 961 28 HOH HOH A . E 5 HOH 62 962 52 HOH HOH A . E 5 HOH 63 963 94 HOH HOH A . E 5 HOH 64 964 11 HOH HOH A . E 5 HOH 65 965 57 HOH HOH A . E 5 HOH 66 966 114 HOH HOH A . E 5 HOH 67 967 109 HOH HOH A . E 5 HOH 68 968 37 HOH HOH A . E 5 HOH 69 969 24 HOH HOH A . E 5 HOH 70 970 51 HOH HOH A . E 5 HOH 71 971 84 HOH HOH A . E 5 HOH 72 972 54 HOH HOH A . E 5 HOH 73 973 55 HOH HOH A . E 5 HOH 74 974 14 HOH HOH A . E 5 HOH 75 975 80 HOH HOH A . E 5 HOH 76 976 46 HOH HOH A . E 5 HOH 77 977 103 HOH HOH A . E 5 HOH 78 978 108 HOH HOH A . E 5 HOH 79 979 33 HOH HOH A . E 5 HOH 80 980 35 HOH HOH A . E 5 HOH 81 981 92 HOH HOH A . E 5 HOH 82 982 105 HOH HOH A . E 5 HOH 83 983 15 HOH HOH A . E 5 HOH 84 984 65 HOH HOH A . E 5 HOH 85 985 9 HOH HOH A . E 5 HOH 86 986 21 HOH HOH A . E 5 HOH 87 987 70 HOH HOH A . E 5 HOH 88 988 56 HOH HOH A . E 5 HOH 89 989 49 HOH HOH A . E 5 HOH 90 990 118 HOH HOH A . E 5 HOH 91 991 88 HOH HOH A . E 5 HOH 92 992 18 HOH HOH A . E 5 HOH 93 993 53 HOH HOH A . E 5 HOH 94 994 66 HOH HOH A . E 5 HOH 95 995 90 HOH HOH A . E 5 HOH 96 996 67 HOH HOH A . E 5 HOH 97 997 8 HOH HOH A . E 5 HOH 98 998 86 HOH HOH A . E 5 HOH 99 999 113 HOH HOH A . E 5 HOH 100 1000 7 HOH HOH A . E 5 HOH 101 1001 126 HOH HOH A . E 5 HOH 102 1002 77 HOH HOH A . E 5 HOH 103 1003 123 HOH HOH A . E 5 HOH 104 1004 130 HOH HOH A . E 5 HOH 105 1005 43 HOH HOH A . E 5 HOH 106 1006 60 HOH HOH A . E 5 HOH 107 1007 116 HOH HOH A . E 5 HOH 108 1008 64 HOH HOH A . E 5 HOH 109 1009 85 HOH HOH A . E 5 HOH 110 1010 98 HOH HOH A . E 5 HOH 111 1011 10 HOH HOH A . E 5 HOH 112 1012 73 HOH HOH A . E 5 HOH 113 1013 99 HOH HOH A . E 5 HOH 114 1014 32 HOH HOH A . E 5 HOH 115 1015 127 HOH HOH A . E 5 HOH 116 1016 107 HOH HOH A . E 5 HOH 117 1017 124 HOH HOH A . E 5 HOH 118 1018 44 HOH HOH A . E 5 HOH 119 1019 40 HOH HOH A . E 5 HOH 120 1020 133 HOH HOH A . E 5 HOH 121 1021 81 HOH HOH A . E 5 HOH 122 1022 106 HOH HOH A . E 5 HOH 123 1023 132 HOH HOH A . E 5 HOH 124 1024 48 HOH HOH A . E 5 HOH 125 1025 104 HOH HOH A . E 5 HOH 126 1026 120 HOH HOH A . E 5 HOH 127 1027 134 HOH HOH A . E 5 HOH 128 1028 50 HOH HOH A . E 5 HOH 129 1029 135 HOH HOH A . E 5 HOH 130 1030 95 HOH HOH A . E 5 HOH 131 1031 87 HOH HOH A . E 5 HOH 132 1032 23 HOH HOH A . E 5 HOH 133 1033 117 HOH HOH A . E 5 HOH 134 1034 47 HOH HOH A . E 5 HOH 135 1035 69 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ALY _pdbx_struct_mod_residue.label_seq_id 120 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ALY _pdbx_struct_mod_residue.auth_seq_id 604 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 56 ? A CYS 540 ? 1_555 ZN ? C ZN . ? A ZN 802 ? 1_555 SG ? A CYS 59 ? A CYS 543 ? 1_555 105.2 ? 2 SG ? A CYS 56 ? A CYS 540 ? 1_555 ZN ? C ZN . ? A ZN 802 ? 1_555 NE2 ? A HIS 72 ? A HIS 556 ? 1_555 107.8 ? 3 SG ? A CYS 59 ? A CYS 543 ? 1_555 ZN ? C ZN . ? A ZN 802 ? 1_555 NE2 ? A HIS 72 ? A HIS 556 ? 1_555 96.7 ? 4 SG ? A CYS 56 ? A CYS 540 ? 1_555 ZN ? C ZN . ? A ZN 802 ? 1_555 SG ? A CYS 76 ? A CYS 560 ? 1_555 114.0 ? 5 SG ? A CYS 59 ? A CYS 543 ? 1_555 ZN ? C ZN . ? A ZN 802 ? 1_555 SG ? A CYS 76 ? A CYS 560 ? 1_555 123.0 ? 6 NE2 ? A HIS 72 ? A HIS 556 ? 1_555 ZN ? C ZN . ? A ZN 802 ? 1_555 SG ? A CYS 76 ? A CYS 560 ? 1_555 108.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-01 2 'Structure model' 1 1 2018-08-08 3 'Structure model' 1 2 2018-08-15 4 'Structure model' 1 3 2018-08-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation_author 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.pdbx_database_id_PubMed' 2 3 'Structure model' '_citation.title' 3 4 'Structure model' '_citation.journal_volume' 4 4 'Structure model' '_citation.page_first' 5 4 'Structure model' '_citation.page_last' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 14.9428 -17.0730 -3.1635 0.2513 0.2825 0.2076 0.0111 0.0145 -0.0147 3.3045 1.2581 3.1188 -0.1440 0.6425 -0.8426 0.0717 -0.0421 -0.1770 0.2451 -0.0223 0.0041 0.1538 0.2571 -0.0296 'X-RAY DIFFRACTION' 2 ? refined 24.5417 -7.7055 -6.3084 0.2435 0.2170 0.2262 -0.0304 -0.0156 -0.0045 3.3637 1.2749 5.5717 -1.1461 2.5153 -1.6224 -0.0580 -0.2421 -0.0855 -0.0322 0.1152 -0.0449 0.0834 0.1063 0.0249 'X-RAY DIFFRACTION' 3 ? refined 17.5128 -12.6436 -20.0861 0.1965 0.1830 0.1634 -0.0085 0.0038 0.0058 3.0647 1.7058 4.0094 0.4780 0.8275 -0.4393 -0.0710 0.1101 -0.0798 -0.1220 -0.0215 -0.0807 0.2679 0.2219 0.0673 'X-RAY DIFFRACTION' 4 ? refined 3.2383 -13.2878 -29.5167 0.2373 0.1572 0.2613 -0.0279 -0.0387 -0.0325 3.2789 1.9983 4.1358 0.0123 1.1692 -0.3147 -0.0678 -0.0904 0.2539 -0.3125 0.1949 0.2324 0.1339 -0.1767 -0.0021 'X-RAY DIFFRACTION' 5 ? refined -3.2675 -15.8520 -40.9613 0.4208 0.2891 0.3271 -0.0256 -0.0673 0.0234 3.2779 2.1243 2.2251 2.4324 0.7733 1.3902 -0.4498 0.4576 0.4229 -0.4547 0.2515 0.4027 -0.1632 -0.0737 0.1426 'X-RAY DIFFRACTION' 6 ? refined 3.6746 -2.3778 -30.2591 0.4342 0.4398 0.4855 0.0370 -0.0246 0.0279 2.2397 2.3872 0.3081 2.2578 0.6563 0.5295 0.1419 -0.7314 0.6293 0.0024 -0.3287 0.8128 0.2053 -0.2213 0.1561 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 506 through 528 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 529 through 575 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 576 through 672 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 673 through 705 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 706 through 748 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 749 through 779 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH A TYR 549 ? ? O A HOH 901 ? ? 1.99 2 1 O A ILE 766 ? B O A HOH 902 ? ? 2.11 3 1 O A HOH 968 ? ? O A HOH 1027 ? ? 2.11 4 1 O A HOH 1019 ? ? O A HOH 1026 ? ? 2.13 5 1 O A HOH 977 ? ? O A HOH 995 ? ? 2.14 6 1 O A GLY 708 ? ? O A HOH 903 ? ? 2.16 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 906 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 1018 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_445 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 566 ? ? -77.36 -169.63 2 1 SER A 574 ? ? 54.09 -125.66 3 1 SER A 645 ? ? -89.92 -72.99 4 1 SER A 645 ? ? -89.88 -73.03 5 1 THR A 709 ? ? -71.27 46.63 6 1 TYR A 761 ? ? -101.83 57.65 7 1 THR A 767 ? ? 121.90 131.89 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PRO _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 765 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ILE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 766 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 B _pdbx_validate_peptide_omega.omega 145.13 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 554 ? CD ? A ARG 70 CD 2 1 Y 1 A ARG 554 ? NE ? A ARG 70 NE 3 1 Y 1 A ARG 554 ? CZ ? A ARG 70 CZ 4 1 Y 1 A ARG 554 ? NH1 ? A ARG 70 NH1 5 1 Y 1 A ARG 554 ? NH2 ? A ARG 70 NH2 6 1 Y 1 A ARG 623 ? CG ? A ARG 139 CG 7 1 Y 1 A ARG 623 ? CD ? A ARG 139 CD 8 1 Y 1 A ARG 623 ? NE ? A ARG 139 NE 9 1 Y 1 A ARG 623 ? CZ ? A ARG 139 CZ 10 1 Y 1 A ARG 623 ? NH1 ? A ARG 139 NH1 11 1 Y 1 A ARG 623 ? NH2 ? A ARG 139 NH2 12 1 Y 1 A GLN 760 ? CG ? A GLN 276 CG 13 1 Y 1 A GLN 760 ? CD ? A GLN 276 CD 14 1 Y 1 A GLN 760 ? OE1 ? A GLN 276 OE1 15 1 Y 1 A GLN 760 ? NE2 ? A GLN 276 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 485 ? A MET 1 2 1 Y 1 A GLY 486 ? A GLY 2 3 1 Y 1 A SER 487 ? A SER 3 4 1 Y 1 A SER 488 ? A SER 4 5 1 Y 1 A HIS 489 ? A HIS 5 6 1 Y 1 A HIS 490 ? A HIS 6 7 1 Y 1 A HIS 491 ? A HIS 7 8 1 Y 1 A HIS 492 ? A HIS 8 9 1 Y 1 A HIS 493 ? A HIS 9 10 1 Y 1 A HIS 494 ? A HIS 10 11 1 Y 1 A SER 495 ? A SER 11 12 1 Y 1 A SER 496 ? A SER 12 13 1 Y 1 A GLY 497 ? A GLY 13 14 1 Y 1 A LEU 498 ? A LEU 14 15 1 Y 1 A VAL 499 ? A VAL 15 16 1 Y 1 A PRO 500 ? A PRO 16 17 1 Y 1 A ARG 501 ? A ARG 17 18 1 Y 1 A GLY 502 ? A GLY 18 19 1 Y 1 A SER 503 ? A SER 19 20 1 Y 1 A THR 504 ? A THR 20 21 1 Y 1 A LYS 505 ? A LYS 21 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FCV _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FCV _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "3-fluoro-N'-[(2-fluorophenyl)sulfonyl]-5-(pyridin-2-yl)benzohydrazide" FCV 3 'ZINC ION' ZN 4 'MAGNESIUM ION' MG 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #