data_6CX3
# 
_entry.id   6CX3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.379 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6CX3         pdb_00006cx3 10.2210/pdb6cx3/pdb 
WWPDB D_1000232909 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CX3 
_pdbx_database_status.recvd_initial_deposition_date   2018-04-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_audit_author.name               'Powers, K.T.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'PLoS ONE' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                e0157023 
_citation.page_last                 ? 
_citation.title                     
'Identification of New Mutations at the PCNA Subunit Interface that Block Translesion Synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0157023 
_citation.pdbx_database_id_PubMed   27258147 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kondratick, C.M.' 1 ? 
primary 'Boehm, E.M.'      2 ? 
primary 'Dieckman, L.M.'   3 ? 
primary 'Powers, K.T.'     4 ? 
primary 'Sanchez, J.C.'    5 ? 
primary 'Mueting, S.R.'    6 ? 
primary 'Washington, M.T.' 7 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CX3 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     123.756 
_cell.length_a_esd                 ? 
_cell.length_b                     123.756 
_cell.length_b_esd                 ? 
_cell.length_c                     123.756 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CX3 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                198 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Proliferating cell nuclear antigen' 
_entity.formula_weight             29096.223 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              S179T 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PCNA 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKIL
RCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSIN
IMITKETIKFVADGDIGSGTVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQF
DLKSGFLQFFLAPKFNDEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKIL
RCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSIN
IMITKETIKFVADGDIGSGTVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQF
DLKSGFLQFFLAPKFNDEE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   MET n 
1 3   LEU n 
1 4   GLU n 
1 5   ALA n 
1 6   LYS n 
1 7   PHE n 
1 8   GLU n 
1 9   GLU n 
1 10  ALA n 
1 11  SER n 
1 12  LEU n 
1 13  PHE n 
1 14  LYS n 
1 15  ARG n 
1 16  ILE n 
1 17  ILE n 
1 18  ASP n 
1 19  GLY n 
1 20  PHE n 
1 21  LYS n 
1 22  ASP n 
1 23  CYS n 
1 24  VAL n 
1 25  GLN n 
1 26  LEU n 
1 27  VAL n 
1 28  ASN n 
1 29  PHE n 
1 30  GLN n 
1 31  CYS n 
1 32  LYS n 
1 33  GLU n 
1 34  ASP n 
1 35  GLY n 
1 36  ILE n 
1 37  ILE n 
1 38  ALA n 
1 39  GLN n 
1 40  ALA n 
1 41  VAL n 
1 42  ASP n 
1 43  ASP n 
1 44  SER n 
1 45  ARG n 
1 46  VAL n 
1 47  LEU n 
1 48  LEU n 
1 49  VAL n 
1 50  SER n 
1 51  LEU n 
1 52  GLU n 
1 53  ILE n 
1 54  GLY n 
1 55  VAL n 
1 56  GLU n 
1 57  ALA n 
1 58  PHE n 
1 59  GLN n 
1 60  GLU n 
1 61  TYR n 
1 62  ARG n 
1 63  CYS n 
1 64  ASP n 
1 65  HIS n 
1 66  PRO n 
1 67  VAL n 
1 68  THR n 
1 69  LEU n 
1 70  GLY n 
1 71  MET n 
1 72  ASP n 
1 73  LEU n 
1 74  THR n 
1 75  SER n 
1 76  LEU n 
1 77  SER n 
1 78  LYS n 
1 79  ILE n 
1 80  LEU n 
1 81  ARG n 
1 82  CYS n 
1 83  GLY n 
1 84  ASN n 
1 85  ASN n 
1 86  THR n 
1 87  ASP n 
1 88  THR n 
1 89  LEU n 
1 90  THR n 
1 91  LEU n 
1 92  ILE n 
1 93  ALA n 
1 94  ASP n 
1 95  ASN n 
1 96  THR n 
1 97  PRO n 
1 98  ASP n 
1 99  SER n 
1 100 ILE n 
1 101 ILE n 
1 102 LEU n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 LYS n 
1 109 LYS n 
1 110 ASP n 
1 111 ARG n 
1 112 ILE n 
1 113 ALA n 
1 114 GLU n 
1 115 TYR n 
1 116 SER n 
1 117 LEU n 
1 118 LYS n 
1 119 LEU n 
1 120 MET n 
1 121 ASP n 
1 122 ILE n 
1 123 ASP n 
1 124 ALA n 
1 125 ASP n 
1 126 PHE n 
1 127 LEU n 
1 128 LYS n 
1 129 ILE n 
1 130 GLU n 
1 131 GLU n 
1 132 LEU n 
1 133 GLN n 
1 134 TYR n 
1 135 ASP n 
1 136 SER n 
1 137 THR n 
1 138 LEU n 
1 139 SER n 
1 140 LEU n 
1 141 PRO n 
1 142 SER n 
1 143 SER n 
1 144 GLU n 
1 145 PHE n 
1 146 SER n 
1 147 LYS n 
1 148 ILE n 
1 149 VAL n 
1 150 ARG n 
1 151 ASP n 
1 152 LEU n 
1 153 SER n 
1 154 GLN n 
1 155 LEU n 
1 156 SER n 
1 157 ASP n 
1 158 SER n 
1 159 ILE n 
1 160 ASN n 
1 161 ILE n 
1 162 MET n 
1 163 ILE n 
1 164 THR n 
1 165 LYS n 
1 166 GLU n 
1 167 THR n 
1 168 ILE n 
1 169 LYS n 
1 170 PHE n 
1 171 VAL n 
1 172 ALA n 
1 173 ASP n 
1 174 GLY n 
1 175 ASP n 
1 176 ILE n 
1 177 GLY n 
1 178 SER n 
1 179 GLY n 
1 180 THR n 
1 181 VAL n 
1 182 ILE n 
1 183 ILE n 
1 184 LYS n 
1 185 PRO n 
1 186 PHE n 
1 187 VAL n 
1 188 ASP n 
1 189 MET n 
1 190 GLU n 
1 191 HIS n 
1 192 PRO n 
1 193 GLU n 
1 194 THR n 
1 195 SER n 
1 196 ILE n 
1 197 LYS n 
1 198 LEU n 
1 199 GLU n 
1 200 MET n 
1 201 ASP n 
1 202 GLN n 
1 203 PRO n 
1 204 VAL n 
1 205 ASP n 
1 206 LEU n 
1 207 THR n 
1 208 PHE n 
1 209 GLY n 
1 210 ALA n 
1 211 LYS n 
1 212 TYR n 
1 213 LEU n 
1 214 LEU n 
1 215 ASP n 
1 216 ILE n 
1 217 ILE n 
1 218 LYS n 
1 219 GLY n 
1 220 SER n 
1 221 SER n 
1 222 LEU n 
1 223 SER n 
1 224 ASP n 
1 225 ARG n 
1 226 VAL n 
1 227 GLY n 
1 228 ILE n 
1 229 ARG n 
1 230 LEU n 
1 231 SER n 
1 232 SER n 
1 233 GLU n 
1 234 ALA n 
1 235 PRO n 
1 236 ALA n 
1 237 LEU n 
1 238 PHE n 
1 239 GLN n 
1 240 PHE n 
1 241 ASP n 
1 242 LEU n 
1 243 LYS n 
1 244 SER n 
1 245 GLY n 
1 246 PHE n 
1 247 LEU n 
1 248 GLN n 
1 249 PHE n 
1 250 PHE n 
1 251 LEU n 
1 252 ALA n 
1 253 PRO n 
1 254 LYS n 
1 255 PHE n 
1 256 ASN n 
1 257 ASP n 
1 258 GLU n 
1 259 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   259 
_entity_src_gen.gene_src_common_name               
;Baker's yeast
;
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POL30, YBR088C, YBR0811' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 204508 / S288c' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     559292 
_entity_src_gen.pdbx_gene_src_variant              S288c 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              DE3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PCNA_YEAST 
_struct_ref.pdbx_db_accession          P15873 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILR
CGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINI
MITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFD
LKSGFLQFFLAPKFNDEE
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6CX3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 259 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P15873 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  258 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       258 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6CX3 HIS A 1   ? UNP P15873 ?   ?   'expression tag'      0   1 
1 6CX3 THR A 180 ? UNP P15873 SER 179 'engineered mutation' 179 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CX3 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            5.53 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         77.74 
_exptl_crystal.description                 'Regular Cube' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;2.2M Ammonium sulfate
0.2 Sodium Formate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         NOIR-1 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-04-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Rosenbaum-Rock si(111) saggitally focused mirrors' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 4.2.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   4.2.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CX3 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.100 
_reflns.d_resolution_low                 24.750 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       11688 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  9.290 
_reflns.pdbx_Rmerge_I_obs                0.142 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.200 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.140 
_reflns.pdbx_scaling_rejects             821 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.150 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         109371 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.100 3.210  ? 2.100  ? ? ? ? 1135 100.000 ? ? ? ? 0.752 ? ? ? ? ? ? ? ? 9.320 ? 1.020 ? ? 0.796 ? ? 1  1 ? ? 
3.210 3.340  ? 2.300  ? ? ? ? 1170 100.000 ? ? ? ? 0.703 ? ? ? ? ? ? ? ? 9.560 ? 1.110 ? ? 0.743 ? ? 2  1 ? ? 
3.340 3.490  ? 2.500  ? ? ? ? 1150 100.000 ? ? ? ? 0.641 ? ? ? ? ? ? ? ? 9.530 ? 1.120 ? ? 0.678 ? ? 3  1 ? ? 
3.490 3.670  ? 3.400  ? ? ? ? 1138 100.000 ? ? ? ? 0.498 ? ? ? ? ? ? ? ? 9.490 ? 1.220 ? ? 0.527 ? ? 4  1 ? ? 
3.670 3.900  ? 4.700  ? ? ? ? 1181 100.000 ? ? ? ? 0.397 ? ? ? ? ? ? ? ? 9.480 ? 1.290 ? ? 0.419 ? ? 5  1 ? ? 
3.900 4.200  ? 5.100  ? ? ? ? 1153 99.900  ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 9.490 ? 1.200 ? ? 0.357 ? ? 6  1 ? ? 
4.200 4.620  ? 7.400  ? ? ? ? 1168 100.000 ? ? ? ? 0.262 ? ? ? ? ? ? ? ? 9.230 ? 1.310 ? ? 0.278 ? ? 7  1 ? ? 
4.620 5.290  ? 9.400  ? ? ? ? 1177 100.000 ? ? ? ? 0.213 ? ? ? ? ? ? ? ? 9.150 ? 1.180 ? ? 0.225 ? ? 8  1 ? ? 
5.290 6.640  ? 14.300 ? ? ? ? 1184 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 9.150 ? 1.010 ? ? 0.120 ? ? 9  1 ? ? 
6.640 24.750 ? 32.200 ? ? ? ? 1232 99.300  ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 8.520 ? 0.950 ? ? 0.048 ? ? 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                227.090 
_refine.B_iso_mean                               132.8438 
_refine.B_iso_min                                78.830 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CX3 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.1010 
_refine.ls_d_res_low                             24.750 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     11688 
_refine.ls_number_reflns_R_free                  556 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9000 
_refine.ls_percent_reflns_R_free                 4.7600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2352 
_refine.ls_R_factor_R_free                       0.2694 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2334 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1PLQ 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 33.4300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.1010 
_refine_hist.d_res_low                        24.750 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2000 
_refine_hist.pdbx_number_residues_total       255 
_refine_hist.pdbx_number_atoms_protein        2000 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
_struct.entry_id                     6CX3 
_struct.title                        'S179T Mutant of Yeast PCNA' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CX3 
_struct_keywords.text            'DNA Replication, DNA Repair, DNA Recombination Scaffold, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ALA A 10  ? ASP A 22  ? ALA A 9   ASP A 21  1 ? 13 
HELX_P HELX_P2 AA2 GLU A 56  ? PHE A 58  ? GLU A 55  PHE A 57  5 ? 3  
HELX_P HELX_P3 AA3 LEU A 73  ? GLY A 83  ? LEU A 72  GLY A 82  1 ? 11 
HELX_P HELX_P4 AA4 SER A 142 ? SER A 153 ? SER A 141 SER A 152 1 ? 12 
HELX_P HELX_P5 AA5 HIS A 191 ? SER A 195 ? HIS A 190 SER A 194 5 ? 5  
HELX_P HELX_P6 AA6 ALA A 210 ? ILE A 217 ? ALA A 209 ILE A 216 1 ? 8  
HELX_P HELX_P7 AA7 LYS A 218 ? LEU A 222 ? LYS A 217 LEU A 221 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 9 ? 
AA3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA2 7 8 ? anti-parallel 
AA2 8 9 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 60  ? CYS A 63  ? GLU A 59  CYS A 62  
AA1 2 LEU A 3   ? LYS A 6   ? LEU A 2   LYS A 5   
AA1 3 THR A 90  ? ALA A 93  ? THR A 89  ALA A 92  
AA1 4 SER A 99  ? GLU A 105 ? SER A 98  GLU A 104 
AA1 5 ILE A 112 ? LYS A 118 ? ILE A 111 LYS A 117 
AA2 1 VAL A 67  ? ASP A 72  ? VAL A 66  ASP A 71  
AA2 2 LEU A 26  ? LYS A 32  ? LEU A 25  LYS A 31  
AA2 3 GLY A 35  ? VAL A 41  ? GLY A 34  VAL A 40  
AA2 4 LEU A 47  ? GLY A 54  ? LEU A 46  GLY A 53  
AA2 5 GLY A 245 ? LEU A 251 ? GLY A 244 LEU A 250 
AA2 6 ALA A 236 ? ASP A 241 ? ALA A 235 ASP A 240 
AA2 7 ARG A 225 ? LEU A 230 ? ARG A 224 LEU A 229 
AA2 8 SER A 136 ? PRO A 141 ? SER A 135 PRO A 140 
AA2 9 LYS A 197 ? MET A 200 ? LYS A 196 MET A 199 
AA3 1 SER A 178 ? ILE A 183 ? SER A 177 ILE A 182 
AA3 2 THR A 167 ? ASP A 173 ? THR A 166 ASP A 172 
AA3 3 SER A 158 ? THR A 164 ? SER A 157 THR A 163 
AA3 4 VAL A 204 ? GLY A 209 ? VAL A 203 GLY A 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLU A 60  ? O GLU A 59  N LYS A 6   ? N LYS A 5   
AA1 2 3 N ALA A 5   ? N ALA A 4   O LEU A 91  ? O LEU A 90  
AA1 3 4 N ILE A 92  ? N ILE A 91  O ILE A 101 ? O ILE A 100 
AA1 4 5 N LEU A 102 ? N LEU A 101 O TYR A 115 ? O TYR A 114 
AA2 1 2 O VAL A 67  ? O VAL A 66  N CYS A 31  ? N CYS A 30  
AA2 2 3 N LYS A 32  ? N LYS A 31  O GLY A 35  ? O GLY A 34  
AA2 3 4 N ALA A 38  ? N ALA A 37  O LEU A 51  ? O LEU A 50  
AA2 4 5 N LEU A 48  ? N LEU A 47  O PHE A 250 ? O PHE A 249 
AA2 5 6 O PHE A 249 ? O PHE A 248 N PHE A 238 ? N PHE A 237 
AA2 6 7 O GLN A 239 ? O GLN A 238 N GLY A 227 ? N GLY A 226 
AA2 7 8 O LEU A 230 ? O LEU A 229 N SER A 136 ? N SER A 135 
AA2 8 9 N THR A 137 ? N THR A 136 O GLU A 199 ? O GLU A 198 
AA3 1 2 O VAL A 181 ? O VAL A 180 N PHE A 170 ? N PHE A 169 
AA3 2 3 O VAL A 171 ? O VAL A 170 N ASN A 160 ? N ASN A 159 
AA3 3 4 N ILE A 159 ? N ILE A 158 O PHE A 208 ? O PHE A 207 
# 
_atom_sites.entry_id                    6CX3 
_atom_sites.fract_transf_matrix[1][1]   0.008080 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008080 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008080 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   LEU 3   2   2   LEU LEU A . n 
A 1 4   GLU 4   3   3   GLU GLU A . n 
A 1 5   ALA 5   4   4   ALA ALA A . n 
A 1 6   LYS 6   5   5   LYS LYS A . n 
A 1 7   PHE 7   6   6   PHE PHE A . n 
A 1 8   GLU 8   7   7   GLU GLU A . n 
A 1 9   GLU 9   8   8   GLU GLU A . n 
A 1 10  ALA 10  9   9   ALA ALA A . n 
A 1 11  SER 11  10  10  SER SER A . n 
A 1 12  LEU 12  11  11  LEU LEU A . n 
A 1 13  PHE 13  12  12  PHE PHE A . n 
A 1 14  LYS 14  13  13  LYS LYS A . n 
A 1 15  ARG 15  14  14  ARG ARG A . n 
A 1 16  ILE 16  15  15  ILE ILE A . n 
A 1 17  ILE 17  16  16  ILE ILE A . n 
A 1 18  ASP 18  17  17  ASP ASP A . n 
A 1 19  GLY 19  18  18  GLY GLY A . n 
A 1 20  PHE 20  19  19  PHE PHE A . n 
A 1 21  LYS 21  20  20  LYS LYS A . n 
A 1 22  ASP 22  21  21  ASP ASP A . n 
A 1 23  CYS 23  22  22  CYS CYS A . n 
A 1 24  VAL 24  23  23  VAL VAL A . n 
A 1 25  GLN 25  24  24  GLN GLN A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  VAL 27  26  26  VAL VAL A . n 
A 1 28  ASN 28  27  27  ASN ASN A . n 
A 1 29  PHE 29  28  28  PHE PHE A . n 
A 1 30  GLN 30  29  29  GLN GLN A . n 
A 1 31  CYS 31  30  30  CYS CYS A . n 
A 1 32  LYS 32  31  31  LYS LYS A . n 
A 1 33  GLU 33  32  32  GLU GLU A . n 
A 1 34  ASP 34  33  33  ASP ASP A . n 
A 1 35  GLY 35  34  34  GLY GLY A . n 
A 1 36  ILE 36  35  35  ILE ILE A . n 
A 1 37  ILE 37  36  36  ILE ILE A . n 
A 1 38  ALA 38  37  37  ALA ALA A . n 
A 1 39  GLN 39  38  38  GLN GLN A . n 
A 1 40  ALA 40  39  39  ALA ALA A . n 
A 1 41  VAL 41  40  40  VAL VAL A . n 
A 1 42  ASP 42  41  41  ASP ASP A . n 
A 1 43  ASP 43  42  42  ASP ASP A . n 
A 1 44  SER 44  43  43  SER SER A . n 
A 1 45  ARG 45  44  44  ARG ARG A . n 
A 1 46  VAL 46  45  45  VAL VAL A . n 
A 1 47  LEU 47  46  46  LEU LEU A . n 
A 1 48  LEU 48  47  47  LEU LEU A . n 
A 1 49  VAL 49  48  48  VAL VAL A . n 
A 1 50  SER 50  49  49  SER SER A . n 
A 1 51  LEU 51  50  50  LEU LEU A . n 
A 1 52  GLU 52  51  51  GLU GLU A . n 
A 1 53  ILE 53  52  52  ILE ILE A . n 
A 1 54  GLY 54  53  53  GLY GLY A . n 
A 1 55  VAL 55  54  54  VAL VAL A . n 
A 1 56  GLU 56  55  55  GLU GLU A . n 
A 1 57  ALA 57  56  56  ALA ALA A . n 
A 1 58  PHE 58  57  57  PHE PHE A . n 
A 1 59  GLN 59  58  58  GLN GLN A . n 
A 1 60  GLU 60  59  59  GLU GLU A . n 
A 1 61  TYR 61  60  60  TYR TYR A . n 
A 1 62  ARG 62  61  61  ARG ARG A . n 
A 1 63  CYS 63  62  62  CYS CYS A . n 
A 1 64  ASP 64  63  63  ASP ASP A . n 
A 1 65  HIS 65  64  64  HIS HIS A . n 
A 1 66  PRO 66  65  65  PRO PRO A . n 
A 1 67  VAL 67  66  66  VAL VAL A . n 
A 1 68  THR 68  67  67  THR THR A . n 
A 1 69  LEU 69  68  68  LEU LEU A . n 
A 1 70  GLY 70  69  69  GLY GLY A . n 
A 1 71  MET 71  70  70  MET MET A . n 
A 1 72  ASP 72  71  71  ASP ASP A . n 
A 1 73  LEU 73  72  72  LEU LEU A . n 
A 1 74  THR 74  73  73  THR THR A . n 
A 1 75  SER 75  74  74  SER SER A . n 
A 1 76  LEU 76  75  75  LEU LEU A . n 
A 1 77  SER 77  76  76  SER SER A . n 
A 1 78  LYS 78  77  77  LYS LYS A . n 
A 1 79  ILE 79  78  78  ILE ILE A . n 
A 1 80  LEU 80  79  79  LEU LEU A . n 
A 1 81  ARG 81  80  80  ARG ARG A . n 
A 1 82  CYS 82  81  81  CYS CYS A . n 
A 1 83  GLY 83  82  82  GLY GLY A . n 
A 1 84  ASN 84  83  83  ASN ASN A . n 
A 1 85  ASN 85  84  84  ASN ASN A . n 
A 1 86  THR 86  85  85  THR THR A . n 
A 1 87  ASP 87  86  86  ASP ASP A . n 
A 1 88  THR 88  87  87  THR THR A . n 
A 1 89  LEU 89  88  88  LEU LEU A . n 
A 1 90  THR 90  89  89  THR THR A . n 
A 1 91  LEU 91  90  90  LEU LEU A . n 
A 1 92  ILE 92  91  91  ILE ILE A . n 
A 1 93  ALA 93  92  92  ALA ALA A . n 
A 1 94  ASP 94  93  93  ASP ASP A . n 
A 1 95  ASN 95  94  94  ASN ASN A . n 
A 1 96  THR 96  95  95  THR THR A . n 
A 1 97  PRO 97  96  96  PRO PRO A . n 
A 1 98  ASP 98  97  97  ASP ASP A . n 
A 1 99  SER 99  98  98  SER SER A . n 
A 1 100 ILE 100 99  99  ILE ILE A . n 
A 1 101 ILE 101 100 100 ILE ILE A . n 
A 1 102 LEU 102 101 101 LEU LEU A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 PHE 104 103 103 PHE PHE A . n 
A 1 105 GLU 105 104 104 GLU GLU A . n 
A 1 106 ASP 106 105 105 ASP ASP A . n 
A 1 107 THR 107 106 106 THR THR A . n 
A 1 108 LYS 108 107 107 LYS LYS A . n 
A 1 109 LYS 109 108 108 LYS LYS A . n 
A 1 110 ASP 110 109 109 ASP ASP A . n 
A 1 111 ARG 111 110 110 ARG ARG A . n 
A 1 112 ILE 112 111 111 ILE ILE A . n 
A 1 113 ALA 113 112 112 ALA ALA A . n 
A 1 114 GLU 114 113 113 GLU GLU A . n 
A 1 115 TYR 115 114 114 TYR TYR A . n 
A 1 116 SER 116 115 115 SER SER A . n 
A 1 117 LEU 117 116 116 LEU LEU A . n 
A 1 118 LYS 118 117 117 LYS LYS A . n 
A 1 119 LEU 119 118 118 LEU LEU A . n 
A 1 120 MET 120 119 119 MET MET A . n 
A 1 121 ASP 121 120 120 ASP ASP A . n 
A 1 122 ILE 122 121 121 ILE ILE A . n 
A 1 123 ASP 123 122 122 ASP ASP A . n 
A 1 124 ALA 124 123 123 ALA ALA A . n 
A 1 125 ASP 125 124 124 ASP ASP A . n 
A 1 126 PHE 126 125 125 PHE PHE A . n 
A 1 127 LEU 127 126 126 LEU LEU A . n 
A 1 128 LYS 128 127 127 LYS LYS A . n 
A 1 129 ILE 129 128 128 ILE ILE A . n 
A 1 130 GLU 130 129 129 GLU GLU A . n 
A 1 131 GLU 131 130 130 GLU GLU A . n 
A 1 132 LEU 132 131 131 LEU LEU A . n 
A 1 133 GLN 133 132 132 GLN GLN A . n 
A 1 134 TYR 134 133 133 TYR TYR A . n 
A 1 135 ASP 135 134 134 ASP ASP A . n 
A 1 136 SER 136 135 135 SER SER A . n 
A 1 137 THR 137 136 136 THR THR A . n 
A 1 138 LEU 138 137 137 LEU LEU A . n 
A 1 139 SER 139 138 138 SER SER A . n 
A 1 140 LEU 140 139 139 LEU LEU A . n 
A 1 141 PRO 141 140 140 PRO PRO A . n 
A 1 142 SER 142 141 141 SER SER A . n 
A 1 143 SER 143 142 142 SER SER A . n 
A 1 144 GLU 144 143 143 GLU GLU A . n 
A 1 145 PHE 145 144 144 PHE PHE A . n 
A 1 146 SER 146 145 145 SER SER A . n 
A 1 147 LYS 147 146 146 LYS LYS A . n 
A 1 148 ILE 148 147 147 ILE ILE A . n 
A 1 149 VAL 149 148 148 VAL VAL A . n 
A 1 150 ARG 150 149 149 ARG ARG A . n 
A 1 151 ASP 151 150 150 ASP ASP A . n 
A 1 152 LEU 152 151 151 LEU LEU A . n 
A 1 153 SER 153 152 152 SER SER A . n 
A 1 154 GLN 154 153 153 GLN GLN A . n 
A 1 155 LEU 155 154 154 LEU LEU A . n 
A 1 156 SER 156 155 155 SER SER A . n 
A 1 157 ASP 157 156 156 ASP ASP A . n 
A 1 158 SER 158 157 157 SER SER A . n 
A 1 159 ILE 159 158 158 ILE ILE A . n 
A 1 160 ASN 160 159 159 ASN ASN A . n 
A 1 161 ILE 161 160 160 ILE ILE A . n 
A 1 162 MET 162 161 161 MET MET A . n 
A 1 163 ILE 163 162 162 ILE ILE A . n 
A 1 164 THR 164 163 163 THR THR A . n 
A 1 165 LYS 165 164 164 LYS LYS A . n 
A 1 166 GLU 166 165 165 GLU GLU A . n 
A 1 167 THR 167 166 166 THR THR A . n 
A 1 168 ILE 168 167 167 ILE ILE A . n 
A 1 169 LYS 169 168 168 LYS LYS A . n 
A 1 170 PHE 170 169 169 PHE PHE A . n 
A 1 171 VAL 171 170 170 VAL VAL A . n 
A 1 172 ALA 172 171 171 ALA ALA A . n 
A 1 173 ASP 173 172 172 ASP ASP A . n 
A 1 174 GLY 174 173 173 GLY GLY A . n 
A 1 175 ASP 175 174 174 ASP ASP A . n 
A 1 176 ILE 176 175 175 ILE ILE A . n 
A 1 177 GLY 177 176 176 GLY GLY A . n 
A 1 178 SER 178 177 177 SER SER A . n 
A 1 179 GLY 179 178 178 GLY GLY A . n 
A 1 180 THR 180 179 179 THR THR A . n 
A 1 181 VAL 181 180 180 VAL VAL A . n 
A 1 182 ILE 182 181 181 ILE ILE A . n 
A 1 183 ILE 183 182 182 ILE ILE A . n 
A 1 184 LYS 184 183 183 LYS LYS A . n 
A 1 185 PRO 185 184 184 PRO PRO A . n 
A 1 186 PHE 186 185 185 PHE PHE A . n 
A 1 187 VAL 187 186 186 VAL VAL A . n 
A 1 188 ASP 188 187 187 ASP ASP A . n 
A 1 189 MET 189 188 188 MET MET A . n 
A 1 190 GLU 190 189 189 GLU GLU A . n 
A 1 191 HIS 191 190 190 HIS HIS A . n 
A 1 192 PRO 192 191 191 PRO PRO A . n 
A 1 193 GLU 193 192 192 GLU GLU A . n 
A 1 194 THR 194 193 193 THR THR A . n 
A 1 195 SER 195 194 194 SER SER A . n 
A 1 196 ILE 196 195 195 ILE ILE A . n 
A 1 197 LYS 197 196 196 LYS LYS A . n 
A 1 198 LEU 198 197 197 LEU LEU A . n 
A 1 199 GLU 199 198 198 GLU GLU A . n 
A 1 200 MET 200 199 199 MET MET A . n 
A 1 201 ASP 201 200 200 ASP ASP A . n 
A 1 202 GLN 202 201 201 GLN GLN A . n 
A 1 203 PRO 203 202 202 PRO PRO A . n 
A 1 204 VAL 204 203 203 VAL VAL A . n 
A 1 205 ASP 205 204 204 ASP ASP A . n 
A 1 206 LEU 206 205 205 LEU LEU A . n 
A 1 207 THR 207 206 206 THR THR A . n 
A 1 208 PHE 208 207 207 PHE PHE A . n 
A 1 209 GLY 209 208 208 GLY GLY A . n 
A 1 210 ALA 210 209 209 ALA ALA A . n 
A 1 211 LYS 211 210 210 LYS LYS A . n 
A 1 212 TYR 212 211 211 TYR TYR A . n 
A 1 213 LEU 213 212 212 LEU LEU A . n 
A 1 214 LEU 214 213 213 LEU LEU A . n 
A 1 215 ASP 215 214 214 ASP ASP A . n 
A 1 216 ILE 216 215 215 ILE ILE A . n 
A 1 217 ILE 217 216 216 ILE ILE A . n 
A 1 218 LYS 218 217 217 LYS LYS A . n 
A 1 219 GLY 219 218 218 GLY GLY A . n 
A 1 220 SER 220 219 219 SER SER A . n 
A 1 221 SER 221 220 220 SER SER A . n 
A 1 222 LEU 222 221 221 LEU LEU A . n 
A 1 223 SER 223 222 222 SER SER A . n 
A 1 224 ASP 224 223 223 ASP ASP A . n 
A 1 225 ARG 225 224 224 ARG ARG A . n 
A 1 226 VAL 226 225 225 VAL VAL A . n 
A 1 227 GLY 227 226 226 GLY GLY A . n 
A 1 228 ILE 228 227 227 ILE ILE A . n 
A 1 229 ARG 229 228 228 ARG ARG A . n 
A 1 230 LEU 230 229 229 LEU LEU A . n 
A 1 231 SER 231 230 230 SER SER A . n 
A 1 232 SER 232 231 231 SER SER A . n 
A 1 233 GLU 233 232 232 GLU GLU A . n 
A 1 234 ALA 234 233 233 ALA ALA A . n 
A 1 235 PRO 235 234 234 PRO PRO A . n 
A 1 236 ALA 236 235 235 ALA ALA A . n 
A 1 237 LEU 237 236 236 LEU LEU A . n 
A 1 238 PHE 238 237 237 PHE PHE A . n 
A 1 239 GLN 239 238 238 GLN GLN A . n 
A 1 240 PHE 240 239 239 PHE PHE A . n 
A 1 241 ASP 241 240 240 ASP ASP A . n 
A 1 242 LEU 242 241 241 LEU LEU A . n 
A 1 243 LYS 243 242 242 LYS LYS A . n 
A 1 244 SER 244 243 243 SER SER A . n 
A 1 245 GLY 245 244 244 GLY GLY A . n 
A 1 246 PHE 246 245 245 PHE PHE A . n 
A 1 247 LEU 247 246 246 LEU LEU A . n 
A 1 248 GLN 248 247 247 GLN GLN A . n 
A 1 249 PHE 249 248 248 PHE PHE A . n 
A 1 250 PHE 250 249 249 PHE PHE A . n 
A 1 251 LEU 251 250 250 LEU LEU A . n 
A 1 252 ALA 252 251 251 ALA ALA A . n 
A 1 253 PRO 253 252 252 PRO PRO A . n 
A 1 254 LYS 254 253 253 LYS LYS A . n 
A 1 255 PHE 255 254 254 PHE PHE A . n 
A 1 256 ASN 256 255 255 ASN ASN A . n 
A 1 257 ASP 257 256 ?   ?   ?   A . n 
A 1 258 GLU 258 257 ?   ?   ?   A . n 
A 1 259 GLU 259 258 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 
3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-04-11 
2 'Structure model' 1 1 2020-01-01 
3 'Structure model' 1 2 2020-10-07 
4 'Structure model' 1 3 2023-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 3 'Structure model' 'Derived calculations'       
3 4 'Structure model' 'Data collection'            
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Refinement description'     
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support            
2 3 'Structure model' pdbx_struct_assembly          
3 3 'Structure model' pdbx_struct_assembly_gen      
4 3 'Structure model' pdbx_struct_assembly_prop     
5 3 'Structure model' pdbx_struct_oper_list         
6 4 'Structure model' chem_comp_atom                
7 4 'Structure model' chem_comp_bond                
8 4 'Structure model' database_2                    
9 4 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization'  
2 3 'Structure model' '_pdbx_struct_assembly.details'             
3 3 'Structure model' '_pdbx_struct_assembly.method_details'      
4 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count'    
5 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details'  
6 3 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 
7 4 'Structure model' '_database_2.pdbx_DOI'                      
8 4 'Structure model' '_database_2.pdbx_database_accession'       
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.7.0032    1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24        2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? d*TREK      ? ? ? .           3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? d*TREK      ? ? ? .           4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .           5 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice     ? ? ? .           6 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot        ? ? ? 0.8.6.1     7 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.11.1-2575 8 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 22  ? ? -142.94 -66.76  
2 1 GLN A 24  ? ? -113.04 -77.73  
3 1 THR A 85  ? ? 75.69   47.91   
4 1 THR A 87  ? ? 26.42   61.88   
5 1 LEU A 154 ? ? -87.31  -141.79 
6 1 ASP A 156 ? ? -86.98  30.14   
7 1 GLU A 192 ? ? -96.68  31.71   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 242 ? CG ? A LYS 243 CG 
2 1 Y 1 A LYS 242 ? CD ? A LYS 243 CD 
3 1 Y 1 A LYS 242 ? CE ? A LYS 243 CE 
4 1 Y 1 A LYS 242 ? NZ ? A LYS 243 NZ 
5 1 Y 1 A SER 243 ? OG ? A SER 244 OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 0   ? A HIS 1   
2 1 Y 1 A ASP 256 ? A ASP 257 
3 1 Y 1 A GLU 257 ? A GLU 258 
4 1 Y 1 A GLU 258 ? A GLU 259 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TYR N    N N N 318 
TYR CA   C N S 319 
TYR C    C N N 320 
TYR O    O N N 321 
TYR CB   C N N 322 
TYR CG   C Y N 323 
TYR CD1  C Y N 324 
TYR CD2  C Y N 325 
TYR CE1  C Y N 326 
TYR CE2  C Y N 327 
TYR CZ   C Y N 328 
TYR OH   O N N 329 
TYR OXT  O N N 330 
TYR H    H N N 331 
TYR H2   H N N 332 
TYR HA   H N N 333 
TYR HB2  H N N 334 
TYR HB3  H N N 335 
TYR HD1  H N N 336 
TYR HD2  H N N 337 
TYR HE1  H N N 338 
TYR HE2  H N N 339 
TYR HH   H N N 340 
TYR HXT  H N N 341 
VAL N    N N N 342 
VAL CA   C N S 343 
VAL C    C N N 344 
VAL O    O N N 345 
VAL CB   C N N 346 
VAL CG1  C N N 347 
VAL CG2  C N N 348 
VAL OXT  O N N 349 
VAL H    H N N 350 
VAL H2   H N N 351 
VAL HA   H N N 352 
VAL HB   H N N 353 
VAL HG11 H N N 354 
VAL HG12 H N N 355 
VAL HG13 H N N 356 
VAL HG21 H N N 357 
VAL HG22 H N N 358 
VAL HG23 H N N 359 
VAL HXT  H N N 360 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TYR N   CA   sing N N 304 
TYR N   H    sing N N 305 
TYR N   H2   sing N N 306 
TYR CA  C    sing N N 307 
TYR CA  CB   sing N N 308 
TYR CA  HA   sing N N 309 
TYR C   O    doub N N 310 
TYR C   OXT  sing N N 311 
TYR CB  CG   sing N N 312 
TYR CB  HB2  sing N N 313 
TYR CB  HB3  sing N N 314 
TYR CG  CD1  doub Y N 315 
TYR CG  CD2  sing Y N 316 
TYR CD1 CE1  sing Y N 317 
TYR CD1 HD1  sing N N 318 
TYR CD2 CE2  doub Y N 319 
TYR CD2 HD2  sing N N 320 
TYR CE1 CZ   doub Y N 321 
TYR CE1 HE1  sing N N 322 
TYR CE2 CZ   sing Y N 323 
TYR CE2 HE2  sing N N 324 
TYR CZ  OH   sing N N 325 
TYR OH  HH   sing N N 326 
TYR OXT HXT  sing N N 327 
VAL N   CA   sing N N 328 
VAL N   H    sing N N 329 
VAL N   H2   sing N N 330 
VAL CA  C    sing N N 331 
VAL CA  CB   sing N N 332 
VAL CA  HA   sing N N 333 
VAL C   O    doub N N 334 
VAL C   OXT  sing N N 335 
VAL CB  CG1  sing N N 336 
VAL CB  CG2  sing N N 337 
VAL CB  HB   sing N N 338 
VAL CG1 HG11 sing N N 339 
VAL CG1 HG12 sing N N 340 
VAL CG1 HG13 sing N N 341 
VAL CG2 HG21 sing N N 342 
VAL CG2 HG22 sing N N 343 
VAL CG2 HG23 sing N N 344 
VAL OXT HXT  sing N N 345 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           TGM081433 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1PLQ 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#