data_6CX3 # _entry.id 6CX3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6CX3 pdb_00006cx3 10.2210/pdb6cx3/pdb WWPDB D_1000232909 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6CX3 _pdbx_database_status.recvd_initial_deposition_date 2018-04-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Powers, K.T.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS ONE' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1932-6203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first e0157023 _citation.page_last ? _citation.title 'Identification of New Mutations at the PCNA Subunit Interface that Block Translesion Synthesis.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pone.0157023 _citation.pdbx_database_id_PubMed 27258147 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kondratick, C.M.' 1 ? primary 'Boehm, E.M.' 2 ? primary 'Dieckman, L.M.' 3 ? primary 'Powers, K.T.' 4 ? primary 'Sanchez, J.C.' 5 ? primary 'Mueting, S.R.' 6 ? primary 'Washington, M.T.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6CX3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 123.756 _cell.length_a_esd ? _cell.length_b 123.756 _cell.length_b_esd ? _cell.length_c 123.756 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6CX3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Proliferating cell nuclear antigen' _entity.formula_weight 29096.223 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation S179T _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name PCNA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKIL RCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSIN IMITKETIKFVADGDIGSGTVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQF DLKSGFLQFFLAPKFNDEE ; _entity_poly.pdbx_seq_one_letter_code_can ;HMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKIL RCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSIN IMITKETIKFVADGDIGSGTVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQF DLKSGFLQFFLAPKFNDEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 LEU n 1 4 GLU n 1 5 ALA n 1 6 LYS n 1 7 PHE n 1 8 GLU n 1 9 GLU n 1 10 ALA n 1 11 SER n 1 12 LEU n 1 13 PHE n 1 14 LYS n 1 15 ARG n 1 16 ILE n 1 17 ILE n 1 18 ASP n 1 19 GLY n 1 20 PHE n 1 21 LYS n 1 22 ASP n 1 23 CYS n 1 24 VAL n 1 25 GLN n 1 26 LEU n 1 27 VAL n 1 28 ASN n 1 29 PHE n 1 30 GLN n 1 31 CYS n 1 32 LYS n 1 33 GLU n 1 34 ASP n 1 35 GLY n 1 36 ILE n 1 37 ILE n 1 38 ALA n 1 39 GLN n 1 40 ALA n 1 41 VAL n 1 42 ASP n 1 43 ASP n 1 44 SER n 1 45 ARG n 1 46 VAL n 1 47 LEU n 1 48 LEU n 1 49 VAL n 1 50 SER n 1 51 LEU n 1 52 GLU n 1 53 ILE n 1 54 GLY n 1 55 VAL n 1 56 GLU n 1 57 ALA n 1 58 PHE n 1 59 GLN n 1 60 GLU n 1 61 TYR n 1 62 ARG n 1 63 CYS n 1 64 ASP n 1 65 HIS n 1 66 PRO n 1 67 VAL n 1 68 THR n 1 69 LEU n 1 70 GLY n 1 71 MET n 1 72 ASP n 1 73 LEU n 1 74 THR n 1 75 SER n 1 76 LEU n 1 77 SER n 1 78 LYS n 1 79 ILE n 1 80 LEU n 1 81 ARG n 1 82 CYS n 1 83 GLY n 1 84 ASN n 1 85 ASN n 1 86 THR n 1 87 ASP n 1 88 THR n 1 89 LEU n 1 90 THR n 1 91 LEU n 1 92 ILE n 1 93 ALA n 1 94 ASP n 1 95 ASN n 1 96 THR n 1 97 PRO n 1 98 ASP n 1 99 SER n 1 100 ILE n 1 101 ILE n 1 102 LEU n 1 103 LEU n 1 104 PHE n 1 105 GLU n 1 106 ASP n 1 107 THR n 1 108 LYS n 1 109 LYS n 1 110 ASP n 1 111 ARG n 1 112 ILE n 1 113 ALA n 1 114 GLU n 1 115 TYR n 1 116 SER n 1 117 LEU n 1 118 LYS n 1 119 LEU n 1 120 MET n 1 121 ASP n 1 122 ILE n 1 123 ASP n 1 124 ALA n 1 125 ASP n 1 126 PHE n 1 127 LEU n 1 128 LYS n 1 129 ILE n 1 130 GLU n 1 131 GLU n 1 132 LEU n 1 133 GLN n 1 134 TYR n 1 135 ASP n 1 136 SER n 1 137 THR n 1 138 LEU n 1 139 SER n 1 140 LEU n 1 141 PRO n 1 142 SER n 1 143 SER n 1 144 GLU n 1 145 PHE n 1 146 SER n 1 147 LYS n 1 148 ILE n 1 149 VAL n 1 150 ARG n 1 151 ASP n 1 152 LEU n 1 153 SER n 1 154 GLN n 1 155 LEU n 1 156 SER n 1 157 ASP n 1 158 SER n 1 159 ILE n 1 160 ASN n 1 161 ILE n 1 162 MET n 1 163 ILE n 1 164 THR n 1 165 LYS n 1 166 GLU n 1 167 THR n 1 168 ILE n 1 169 LYS n 1 170 PHE n 1 171 VAL n 1 172 ALA n 1 173 ASP n 1 174 GLY n 1 175 ASP n 1 176 ILE n 1 177 GLY n 1 178 SER n 1 179 GLY n 1 180 THR n 1 181 VAL n 1 182 ILE n 1 183 ILE n 1 184 LYS n 1 185 PRO n 1 186 PHE n 1 187 VAL n 1 188 ASP n 1 189 MET n 1 190 GLU n 1 191 HIS n 1 192 PRO n 1 193 GLU n 1 194 THR n 1 195 SER n 1 196 ILE n 1 197 LYS n 1 198 LEU n 1 199 GLU n 1 200 MET n 1 201 ASP n 1 202 GLN n 1 203 PRO n 1 204 VAL n 1 205 ASP n 1 206 LEU n 1 207 THR n 1 208 PHE n 1 209 GLY n 1 210 ALA n 1 211 LYS n 1 212 TYR n 1 213 LEU n 1 214 LEU n 1 215 ASP n 1 216 ILE n 1 217 ILE n 1 218 LYS n 1 219 GLY n 1 220 SER n 1 221 SER n 1 222 LEU n 1 223 SER n 1 224 ASP n 1 225 ARG n 1 226 VAL n 1 227 GLY n 1 228 ILE n 1 229 ARG n 1 230 LEU n 1 231 SER n 1 232 SER n 1 233 GLU n 1 234 ALA n 1 235 PRO n 1 236 ALA n 1 237 LEU n 1 238 PHE n 1 239 GLN n 1 240 PHE n 1 241 ASP n 1 242 LEU n 1 243 LYS n 1 244 SER n 1 245 GLY n 1 246 PHE n 1 247 LEU n 1 248 GLN n 1 249 PHE n 1 250 PHE n 1 251 LEU n 1 252 ALA n 1 253 PRO n 1 254 LYS n 1 255 PHE n 1 256 ASN n 1 257 ASP n 1 258 GLU n 1 259 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 259 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'POL30, YBR088C, YBR0811' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant S288c _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PCNA_YEAST _struct_ref.pdbx_db_accession P15873 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILR CGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINI MITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFD LKSGFLQFFLAPKFNDEE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6CX3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 259 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15873 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 258 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 258 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6CX3 HIS A 1 ? UNP P15873 ? ? 'expression tag' 0 1 1 6CX3 THR A 180 ? UNP P15873 SER 179 'engineered mutation' 179 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6CX3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 77.74 _exptl_crystal.description 'Regular Cube' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;2.2M Ammonium sulfate 0.2 Sodium Formate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type NOIR-1 _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-04-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Rosenbaum-Rock si(111) saggitally focused mirrors' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6CX3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.100 _reflns.d_resolution_low 24.750 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11688 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.290 _reflns.pdbx_Rmerge_I_obs 0.142 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.140 _reflns.pdbx_scaling_rejects 821 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.150 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 109371 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.100 3.210 ? 2.100 ? ? ? ? 1135 100.000 ? ? ? ? 0.752 ? ? ? ? ? ? ? ? 9.320 ? 1.020 ? ? 0.796 ? ? 1 1 ? ? 3.210 3.340 ? 2.300 ? ? ? ? 1170 100.000 ? ? ? ? 0.703 ? ? ? ? ? ? ? ? 9.560 ? 1.110 ? ? 0.743 ? ? 2 1 ? ? 3.340 3.490 ? 2.500 ? ? ? ? 1150 100.000 ? ? ? ? 0.641 ? ? ? ? ? ? ? ? 9.530 ? 1.120 ? ? 0.678 ? ? 3 1 ? ? 3.490 3.670 ? 3.400 ? ? ? ? 1138 100.000 ? ? ? ? 0.498 ? ? ? ? ? ? ? ? 9.490 ? 1.220 ? ? 0.527 ? ? 4 1 ? ? 3.670 3.900 ? 4.700 ? ? ? ? 1181 100.000 ? ? ? ? 0.397 ? ? ? ? ? ? ? ? 9.480 ? 1.290 ? ? 0.419 ? ? 5 1 ? ? 3.900 4.200 ? 5.100 ? ? ? ? 1153 99.900 ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 9.490 ? 1.200 ? ? 0.357 ? ? 6 1 ? ? 4.200 4.620 ? 7.400 ? ? ? ? 1168 100.000 ? ? ? ? 0.262 ? ? ? ? ? ? ? ? 9.230 ? 1.310 ? ? 0.278 ? ? 7 1 ? ? 4.620 5.290 ? 9.400 ? ? ? ? 1177 100.000 ? ? ? ? 0.213 ? ? ? ? ? ? ? ? 9.150 ? 1.180 ? ? 0.225 ? ? 8 1 ? ? 5.290 6.640 ? 14.300 ? ? ? ? 1184 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 9.150 ? 1.010 ? ? 0.120 ? ? 9 1 ? ? 6.640 24.750 ? 32.200 ? ? ? ? 1232 99.300 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 8.520 ? 0.950 ? ? 0.048 ? ? 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 227.090 _refine.B_iso_mean 132.8438 _refine.B_iso_min 78.830 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6CX3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.1010 _refine.ls_d_res_low 24.750 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11688 _refine.ls_number_reflns_R_free 556 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9000 _refine.ls_percent_reflns_R_free 4.7600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2352 _refine.ls_R_factor_R_free 0.2694 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2334 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1PLQ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.4300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.1010 _refine_hist.d_res_low 24.750 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2000 _refine_hist.pdbx_number_residues_total 255 _refine_hist.pdbx_number_atoms_protein 2000 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # _struct.entry_id 6CX3 _struct.title 'S179T Mutant of Yeast PCNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6CX3 _struct_keywords.text 'DNA Replication, DNA Repair, DNA Recombination Scaffold, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 10 ? ASP A 22 ? ALA A 9 ASP A 21 1 ? 13 HELX_P HELX_P2 AA2 GLU A 56 ? PHE A 58 ? GLU A 55 PHE A 57 5 ? 3 HELX_P HELX_P3 AA3 LEU A 73 ? GLY A 83 ? LEU A 72 GLY A 82 1 ? 11 HELX_P HELX_P4 AA4 SER A 142 ? SER A 153 ? SER A 141 SER A 152 1 ? 12 HELX_P HELX_P5 AA5 HIS A 191 ? SER A 195 ? HIS A 190 SER A 194 5 ? 5 HELX_P HELX_P6 AA6 ALA A 210 ? ILE A 217 ? ALA A 209 ILE A 216 1 ? 8 HELX_P HELX_P7 AA7 LYS A 218 ? LEU A 222 ? LYS A 217 LEU A 221 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 9 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 60 ? CYS A 63 ? GLU A 59 CYS A 62 AA1 2 LEU A 3 ? LYS A 6 ? LEU A 2 LYS A 5 AA1 3 THR A 90 ? ALA A 93 ? THR A 89 ALA A 92 AA1 4 SER A 99 ? GLU A 105 ? SER A 98 GLU A 104 AA1 5 ILE A 112 ? LYS A 118 ? ILE A 111 LYS A 117 AA2 1 VAL A 67 ? ASP A 72 ? VAL A 66 ASP A 71 AA2 2 LEU A 26 ? LYS A 32 ? LEU A 25 LYS A 31 AA2 3 GLY A 35 ? VAL A 41 ? GLY A 34 VAL A 40 AA2 4 LEU A 47 ? GLY A 54 ? LEU A 46 GLY A 53 AA2 5 GLY A 245 ? LEU A 251 ? GLY A 244 LEU A 250 AA2 6 ALA A 236 ? ASP A 241 ? ALA A 235 ASP A 240 AA2 7 ARG A 225 ? LEU A 230 ? ARG A 224 LEU A 229 AA2 8 SER A 136 ? PRO A 141 ? SER A 135 PRO A 140 AA2 9 LYS A 197 ? MET A 200 ? LYS A 196 MET A 199 AA3 1 SER A 178 ? ILE A 183 ? SER A 177 ILE A 182 AA3 2 THR A 167 ? ASP A 173 ? THR A 166 ASP A 172 AA3 3 SER A 158 ? THR A 164 ? SER A 157 THR A 163 AA3 4 VAL A 204 ? GLY A 209 ? VAL A 203 GLY A 208 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 60 ? O GLU A 59 N LYS A 6 ? N LYS A 5 AA1 2 3 N ALA A 5 ? N ALA A 4 O LEU A 91 ? O LEU A 90 AA1 3 4 N ILE A 92 ? N ILE A 91 O ILE A 101 ? O ILE A 100 AA1 4 5 N LEU A 102 ? N LEU A 101 O TYR A 115 ? O TYR A 114 AA2 1 2 O VAL A 67 ? O VAL A 66 N CYS A 31 ? N CYS A 30 AA2 2 3 N LYS A 32 ? N LYS A 31 O GLY A 35 ? O GLY A 34 AA2 3 4 N ALA A 38 ? N ALA A 37 O LEU A 51 ? O LEU A 50 AA2 4 5 N LEU A 48 ? N LEU A 47 O PHE A 250 ? O PHE A 249 AA2 5 6 O PHE A 249 ? O PHE A 248 N PHE A 238 ? N PHE A 237 AA2 6 7 O GLN A 239 ? O GLN A 238 N GLY A 227 ? N GLY A 226 AA2 7 8 O LEU A 230 ? O LEU A 229 N SER A 136 ? N SER A 135 AA2 8 9 N THR A 137 ? N THR A 136 O GLU A 199 ? O GLU A 198 AA3 1 2 O VAL A 181 ? O VAL A 180 N PHE A 170 ? N PHE A 169 AA3 2 3 O VAL A 171 ? O VAL A 170 N ASN A 160 ? N ASN A 159 AA3 3 4 N ILE A 159 ? N ILE A 158 O PHE A 208 ? O PHE A 207 # _atom_sites.entry_id 6CX3 _atom_sites.fract_transf_matrix[1][1] 0.008080 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008080 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008080 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 0 ? ? ? A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 GLU 4 3 3 GLU GLU A . n A 1 5 ALA 5 4 4 ALA ALA A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 PHE 7 6 6 PHE PHE A . n A 1 8 GLU 8 7 7 GLU GLU A . n A 1 9 GLU 9 8 8 GLU GLU A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 SER 11 10 10 SER SER A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 PHE 13 12 12 PHE PHE A . n A 1 14 LYS 14 13 13 LYS LYS A . n A 1 15 ARG 15 14 14 ARG ARG A . n A 1 16 ILE 16 15 15 ILE ILE A . n A 1 17 ILE 17 16 16 ILE ILE A . n A 1 18 ASP 18 17 17 ASP ASP A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 PHE 20 19 19 PHE PHE A . n A 1 21 LYS 21 20 20 LYS LYS A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 CYS 23 22 22 CYS CYS A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 GLN 25 24 24 GLN GLN A . n A 1 26 LEU 26 25 25 LEU LEU A . n A 1 27 VAL 27 26 26 VAL VAL A . n A 1 28 ASN 28 27 27 ASN ASN A . n A 1 29 PHE 29 28 28 PHE PHE A . n A 1 30 GLN 30 29 29 GLN GLN A . n A 1 31 CYS 31 30 30 CYS CYS A . n A 1 32 LYS 32 31 31 LYS LYS A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 ASP 34 33 33 ASP ASP A . n A 1 35 GLY 35 34 34 GLY GLY A . n A 1 36 ILE 36 35 35 ILE ILE A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 GLN 39 38 38 GLN GLN A . n A 1 40 ALA 40 39 39 ALA ALA A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 ASP 42 41 41 ASP ASP A . n A 1 43 ASP 43 42 42 ASP ASP A . n A 1 44 SER 44 43 43 SER SER A . n A 1 45 ARG 45 44 44 ARG ARG A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 LEU 47 46 46 LEU LEU A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 SER 50 49 49 SER SER A . n A 1 51 LEU 51 50 50 LEU LEU A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 ILE 53 52 52 ILE ILE A . n A 1 54 GLY 54 53 53 GLY GLY A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 PHE 58 57 57 PHE PHE A . n A 1 59 GLN 59 58 58 GLN GLN A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 TYR 61 60 60 TYR TYR A . n A 1 62 ARG 62 61 61 ARG ARG A . n A 1 63 CYS 63 62 62 CYS CYS A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 HIS 65 64 64 HIS HIS A . n A 1 66 PRO 66 65 65 PRO PRO A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 LEU 69 68 68 LEU LEU A . n A 1 70 GLY 70 69 69 GLY GLY A . n A 1 71 MET 71 70 70 MET MET A . n A 1 72 ASP 72 71 71 ASP ASP A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 THR 74 73 73 THR THR A . n A 1 75 SER 75 74 74 SER SER A . n A 1 76 LEU 76 75 75 LEU LEU A . n A 1 77 SER 77 76 76 SER SER A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 ILE 79 78 78 ILE ILE A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 ARG 81 80 80 ARG ARG A . n A 1 82 CYS 82 81 81 CYS CYS A . n A 1 83 GLY 83 82 82 GLY GLY A . n A 1 84 ASN 84 83 83 ASN ASN A . n A 1 85 ASN 85 84 84 ASN ASN A . n A 1 86 THR 86 85 85 THR THR A . n A 1 87 ASP 87 86 86 ASP ASP A . n A 1 88 THR 88 87 87 THR THR A . n A 1 89 LEU 89 88 88 LEU LEU A . n A 1 90 THR 90 89 89 THR THR A . n A 1 91 LEU 91 90 90 LEU LEU A . n A 1 92 ILE 92 91 91 ILE ILE A . n A 1 93 ALA 93 92 92 ALA ALA A . n A 1 94 ASP 94 93 93 ASP ASP A . n A 1 95 ASN 95 94 94 ASN ASN A . n A 1 96 THR 96 95 95 THR THR A . n A 1 97 PRO 97 96 96 PRO PRO A . n A 1 98 ASP 98 97 97 ASP ASP A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 ILE 101 100 100 ILE ILE A . n A 1 102 LEU 102 101 101 LEU LEU A . n A 1 103 LEU 103 102 102 LEU LEU A . n A 1 104 PHE 104 103 103 PHE PHE A . n A 1 105 GLU 105 104 104 GLU GLU A . n A 1 106 ASP 106 105 105 ASP ASP A . n A 1 107 THR 107 106 106 THR THR A . n A 1 108 LYS 108 107 107 LYS LYS A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 ASP 110 109 109 ASP ASP A . n A 1 111 ARG 111 110 110 ARG ARG A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ALA 113 112 112 ALA ALA A . n A 1 114 GLU 114 113 113 GLU GLU A . n A 1 115 TYR 115 114 114 TYR TYR A . n A 1 116 SER 116 115 115 SER SER A . n A 1 117 LEU 117 116 116 LEU LEU A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 MET 120 119 119 MET MET A . n A 1 121 ASP 121 120 120 ASP ASP A . n A 1 122 ILE 122 121 121 ILE ILE A . n A 1 123 ASP 123 122 122 ASP ASP A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 PHE 126 125 125 PHE PHE A . n A 1 127 LEU 127 126 126 LEU LEU A . n A 1 128 LYS 128 127 127 LYS LYS A . n A 1 129 ILE 129 128 128 ILE ILE A . n A 1 130 GLU 130 129 129 GLU GLU A . n A 1 131 GLU 131 130 130 GLU GLU A . n A 1 132 LEU 132 131 131 LEU LEU A . n A 1 133 GLN 133 132 132 GLN GLN A . n A 1 134 TYR 134 133 133 TYR TYR A . n A 1 135 ASP 135 134 134 ASP ASP A . n A 1 136 SER 136 135 135 SER SER A . n A 1 137 THR 137 136 136 THR THR A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 SER 139 138 138 SER SER A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 PRO 141 140 140 PRO PRO A . n A 1 142 SER 142 141 141 SER SER A . n A 1 143 SER 143 142 142 SER SER A . n A 1 144 GLU 144 143 143 GLU GLU A . n A 1 145 PHE 145 144 144 PHE PHE A . n A 1 146 SER 146 145 145 SER SER A . n A 1 147 LYS 147 146 146 LYS LYS A . n A 1 148 ILE 148 147 147 ILE ILE A . n A 1 149 VAL 149 148 148 VAL VAL A . n A 1 150 ARG 150 149 149 ARG ARG A . n A 1 151 ASP 151 150 150 ASP ASP A . n A 1 152 LEU 152 151 151 LEU LEU A . n A 1 153 SER 153 152 152 SER SER A . n A 1 154 GLN 154 153 153 GLN GLN A . n A 1 155 LEU 155 154 154 LEU LEU A . n A 1 156 SER 156 155 155 SER SER A . n A 1 157 ASP 157 156 156 ASP ASP A . n A 1 158 SER 158 157 157 SER SER A . n A 1 159 ILE 159 158 158 ILE ILE A . n A 1 160 ASN 160 159 159 ASN ASN A . n A 1 161 ILE 161 160 160 ILE ILE A . n A 1 162 MET 162 161 161 MET MET A . n A 1 163 ILE 163 162 162 ILE ILE A . n A 1 164 THR 164 163 163 THR THR A . n A 1 165 LYS 165 164 164 LYS LYS A . n A 1 166 GLU 166 165 165 GLU GLU A . n A 1 167 THR 167 166 166 THR THR A . n A 1 168 ILE 168 167 167 ILE ILE A . n A 1 169 LYS 169 168 168 LYS LYS A . n A 1 170 PHE 170 169 169 PHE PHE A . n A 1 171 VAL 171 170 170 VAL VAL A . n A 1 172 ALA 172 171 171 ALA ALA A . n A 1 173 ASP 173 172 172 ASP ASP A . n A 1 174 GLY 174 173 173 GLY GLY A . n A 1 175 ASP 175 174 174 ASP ASP A . n A 1 176 ILE 176 175 175 ILE ILE A . n A 1 177 GLY 177 176 176 GLY GLY A . n A 1 178 SER 178 177 177 SER SER A . n A 1 179 GLY 179 178 178 GLY GLY A . n A 1 180 THR 180 179 179 THR THR A . n A 1 181 VAL 181 180 180 VAL VAL A . n A 1 182 ILE 182 181 181 ILE ILE A . n A 1 183 ILE 183 182 182 ILE ILE A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 PRO 185 184 184 PRO PRO A . n A 1 186 PHE 186 185 185 PHE PHE A . n A 1 187 VAL 187 186 186 VAL VAL A . n A 1 188 ASP 188 187 187 ASP ASP A . n A 1 189 MET 189 188 188 MET MET A . n A 1 190 GLU 190 189 189 GLU GLU A . n A 1 191 HIS 191 190 190 HIS HIS A . n A 1 192 PRO 192 191 191 PRO PRO A . n A 1 193 GLU 193 192 192 GLU GLU A . n A 1 194 THR 194 193 193 THR THR A . n A 1 195 SER 195 194 194 SER SER A . n A 1 196 ILE 196 195 195 ILE ILE A . n A 1 197 LYS 197 196 196 LYS LYS A . n A 1 198 LEU 198 197 197 LEU LEU A . n A 1 199 GLU 199 198 198 GLU GLU A . n A 1 200 MET 200 199 199 MET MET A . n A 1 201 ASP 201 200 200 ASP ASP A . n A 1 202 GLN 202 201 201 GLN GLN A . n A 1 203 PRO 203 202 202 PRO PRO A . n A 1 204 VAL 204 203 203 VAL VAL A . n A 1 205 ASP 205 204 204 ASP ASP A . n A 1 206 LEU 206 205 205 LEU LEU A . n A 1 207 THR 207 206 206 THR THR A . n A 1 208 PHE 208 207 207 PHE PHE A . n A 1 209 GLY 209 208 208 GLY GLY A . n A 1 210 ALA 210 209 209 ALA ALA A . n A 1 211 LYS 211 210 210 LYS LYS A . n A 1 212 TYR 212 211 211 TYR TYR A . n A 1 213 LEU 213 212 212 LEU LEU A . n A 1 214 LEU 214 213 213 LEU LEU A . n A 1 215 ASP 215 214 214 ASP ASP A . n A 1 216 ILE 216 215 215 ILE ILE A . n A 1 217 ILE 217 216 216 ILE ILE A . n A 1 218 LYS 218 217 217 LYS LYS A . n A 1 219 GLY 219 218 218 GLY GLY A . n A 1 220 SER 220 219 219 SER SER A . n A 1 221 SER 221 220 220 SER SER A . n A 1 222 LEU 222 221 221 LEU LEU A . n A 1 223 SER 223 222 222 SER SER A . n A 1 224 ASP 224 223 223 ASP ASP A . n A 1 225 ARG 225 224 224 ARG ARG A . n A 1 226 VAL 226 225 225 VAL VAL A . n A 1 227 GLY 227 226 226 GLY GLY A . n A 1 228 ILE 228 227 227 ILE ILE A . n A 1 229 ARG 229 228 228 ARG ARG A . n A 1 230 LEU 230 229 229 LEU LEU A . n A 1 231 SER 231 230 230 SER SER A . n A 1 232 SER 232 231 231 SER SER A . n A 1 233 GLU 233 232 232 GLU GLU A . n A 1 234 ALA 234 233 233 ALA ALA A . n A 1 235 PRO 235 234 234 PRO PRO A . n A 1 236 ALA 236 235 235 ALA ALA A . n A 1 237 LEU 237 236 236 LEU LEU A . n A 1 238 PHE 238 237 237 PHE PHE A . n A 1 239 GLN 239 238 238 GLN GLN A . n A 1 240 PHE 240 239 239 PHE PHE A . n A 1 241 ASP 241 240 240 ASP ASP A . n A 1 242 LEU 242 241 241 LEU LEU A . n A 1 243 LYS 243 242 242 LYS LYS A . n A 1 244 SER 244 243 243 SER SER A . n A 1 245 GLY 245 244 244 GLY GLY A . n A 1 246 PHE 246 245 245 PHE PHE A . n A 1 247 LEU 247 246 246 LEU LEU A . n A 1 248 GLN 248 247 247 GLN GLN A . n A 1 249 PHE 249 248 248 PHE PHE A . n A 1 250 PHE 250 249 249 PHE PHE A . n A 1 251 LEU 251 250 250 LEU LEU A . n A 1 252 ALA 252 251 251 ALA ALA A . n A 1 253 PRO 253 252 252 PRO PRO A . n A 1 254 LYS 254 253 253 LYS LYS A . n A 1 255 PHE 255 254 254 PHE PHE A . n A 1 256 ASN 256 255 255 ASN ASN A . n A 1 257 ASP 257 256 ? ? ? A . n A 1 258 GLU 258 257 ? ? ? A . n A 1 259 GLU 259 258 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-11 2 'Structure model' 1 1 2020-01-01 3 'Structure model' 1 2 2020-10-07 4 'Structure model' 1 3 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Derived calculations' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_assembly_gen 4 3 'Structure model' pdbx_struct_assembly_prop 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_struct_assembly.details' 3 3 'Structure model' '_pdbx_struct_assembly.method_details' 4 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 5 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 6 3 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0032 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice ? ? ? . 6 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.8.6.1 7 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1-2575 8 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 22 ? ? -142.94 -66.76 2 1 GLN A 24 ? ? -113.04 -77.73 3 1 THR A 85 ? ? 75.69 47.91 4 1 THR A 87 ? ? 26.42 61.88 5 1 LEU A 154 ? ? -87.31 -141.79 6 1 ASP A 156 ? ? -86.98 30.14 7 1 GLU A 192 ? ? -96.68 31.71 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 242 ? CG ? A LYS 243 CG 2 1 Y 1 A LYS 242 ? CD ? A LYS 243 CD 3 1 Y 1 A LYS 242 ? CE ? A LYS 243 CE 4 1 Y 1 A LYS 242 ? NZ ? A LYS 243 NZ 5 1 Y 1 A SER 243 ? OG ? A SER 244 OG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 0 ? A HIS 1 2 1 Y 1 A ASP 256 ? A ASP 257 3 1 Y 1 A GLU 257 ? A GLU 258 4 1 Y 1 A GLU 258 ? A GLU 259 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number TGM081433 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1PLQ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #