data_6DFL # _entry.id 6DFL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6DFL pdb_00006dfl 10.2210/pdb6dfl/pdb WWPDB D_1000234523 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-03 2 'Structure model' 1 1 2019-10-16 3 'Structure model' 1 2 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_entry_details 7 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6DFL _pdbx_database_status.recvd_initial_deposition_date 2018-05-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chopra, R.' 1 ? 'Vash, B.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 14124 _citation.page_last 14124 _citation.title 'Acylated-acyl carrier protein stabilizes the Pseudomonas aeruginosa WaaP lipopolysaccharide heptose kinase.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-018-32379-1 _citation.pdbx_database_id_PubMed 30237436 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kreamer, N.N.K.' 1 ? primary 'Chopra, R.' 2 ? primary 'Caughlan, R.E.' 3 ? primary 'Fabbro, D.' 4 ? primary 'Fang, E.' 5 ? primary 'Gee, P.' 6 ? primary 'Hunt, I.' 7 ? primary 'Li, M.' 8 ? primary 'Leon, B.C.' 9 ? primary 'Muller, L.' 10 ? primary 'Vash, B.' 11 ? primary 'Woods, A.L.' 12 ? primary 'Stams, T.' 13 ? primary 'Dean, C.R.' 14 ? primary 'Uehara, T.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lipopolysaccharide core heptose(I) kinase RfaP' 30470.348 1 2.7.1.-,2.7.10.2 ? ? ? 2 polymer man 'Acyl carrier protein' 8079.677 1 ? ? ? ? 3 non-polymer syn 'S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] hexadecanethioate' 596.757 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Lipopolysaccharide kinase WaaP' 2 ACP # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;(MSE)RLVLEEPFKRLWNGRDPFEAVEALQGKVYRELEGRRTLRTEVDGRGYFVKIHRGIGWGEIAKNLLTAKLPVLGAR QEWQAIRRLHEAGVAT(MSE)TAVAYGERGSDPARQHSFIVTEELAPTVDLEVFSQDWRERPPPPRLKRALVEAVAR (MSE)VGD(MSE)HRAGVNHRDCYICHFLLHTDKPVSADDFRLSVIDLHRAQTRDATPKRWRNKDLAALYFSALDIGLTR RDKLRFLRTYFRRPLREILRDEAGLLAW(MSE)ERKAEKLYE ; ;MRLVLEEPFKRLWNGRDPFEAVEALQGKVYRELEGRRTLRTEVDGRGYFVKIHRGIGWGEIAKNLLTAKLPVLGARQEWQ AIRRLHEAGVATMTAVAYGERGSDPARQHSFIVTEELAPTVDLEVFSQDWRERPPPPRLKRALVEAVARMVGDMHRAGVN HRDCYICHFLLHTDKPVSADDFRLSVIDLHRAQTRDATPKRWRNKDLAALYFSALDIGLTRRDKLRFLRTYFRRPLREIL RDEAGLLAWMERKAEKLYE ; A ? 2 'polypeptide(L)' no yes 'TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELV(MSE)ALEEEFDTEIPDEEAEKITTVQAAIDYIN' TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYIN B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] hexadecanethioate' _pdbx_entity_nonpoly.comp_id G9S # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ARG n 1 3 LEU n 1 4 VAL n 1 5 LEU n 1 6 GLU n 1 7 GLU n 1 8 PRO n 1 9 PHE n 1 10 LYS n 1 11 ARG n 1 12 LEU n 1 13 TRP n 1 14 ASN n 1 15 GLY n 1 16 ARG n 1 17 ASP n 1 18 PRO n 1 19 PHE n 1 20 GLU n 1 21 ALA n 1 22 VAL n 1 23 GLU n 1 24 ALA n 1 25 LEU n 1 26 GLN n 1 27 GLY n 1 28 LYS n 1 29 VAL n 1 30 TYR n 1 31 ARG n 1 32 GLU n 1 33 LEU n 1 34 GLU n 1 35 GLY n 1 36 ARG n 1 37 ARG n 1 38 THR n 1 39 LEU n 1 40 ARG n 1 41 THR n 1 42 GLU n 1 43 VAL n 1 44 ASP n 1 45 GLY n 1 46 ARG n 1 47 GLY n 1 48 TYR n 1 49 PHE n 1 50 VAL n 1 51 LYS n 1 52 ILE n 1 53 HIS n 1 54 ARG n 1 55 GLY n 1 56 ILE n 1 57 GLY n 1 58 TRP n 1 59 GLY n 1 60 GLU n 1 61 ILE n 1 62 ALA n 1 63 LYS n 1 64 ASN n 1 65 LEU n 1 66 LEU n 1 67 THR n 1 68 ALA n 1 69 LYS n 1 70 LEU n 1 71 PRO n 1 72 VAL n 1 73 LEU n 1 74 GLY n 1 75 ALA n 1 76 ARG n 1 77 GLN n 1 78 GLU n 1 79 TRP n 1 80 GLN n 1 81 ALA n 1 82 ILE n 1 83 ARG n 1 84 ARG n 1 85 LEU n 1 86 HIS n 1 87 GLU n 1 88 ALA n 1 89 GLY n 1 90 VAL n 1 91 ALA n 1 92 THR n 1 93 MSE n 1 94 THR n 1 95 ALA n 1 96 VAL n 1 97 ALA n 1 98 TYR n 1 99 GLY n 1 100 GLU n 1 101 ARG n 1 102 GLY n 1 103 SER n 1 104 ASP n 1 105 PRO n 1 106 ALA n 1 107 ARG n 1 108 GLN n 1 109 HIS n 1 110 SER n 1 111 PHE n 1 112 ILE n 1 113 VAL n 1 114 THR n 1 115 GLU n 1 116 GLU n 1 117 LEU n 1 118 ALA n 1 119 PRO n 1 120 THR n 1 121 VAL n 1 122 ASP n 1 123 LEU n 1 124 GLU n 1 125 VAL n 1 126 PHE n 1 127 SER n 1 128 GLN n 1 129 ASP n 1 130 TRP n 1 131 ARG n 1 132 GLU n 1 133 ARG n 1 134 PRO n 1 135 PRO n 1 136 PRO n 1 137 PRO n 1 138 ARG n 1 139 LEU n 1 140 LYS n 1 141 ARG n 1 142 ALA n 1 143 LEU n 1 144 VAL n 1 145 GLU n 1 146 ALA n 1 147 VAL n 1 148 ALA n 1 149 ARG n 1 150 MSE n 1 151 VAL n 1 152 GLY n 1 153 ASP n 1 154 MSE n 1 155 HIS n 1 156 ARG n 1 157 ALA n 1 158 GLY n 1 159 VAL n 1 160 ASN n 1 161 HIS n 1 162 ARG n 1 163 ASP n 1 164 CYS n 1 165 TYR n 1 166 ILE n 1 167 CYS n 1 168 HIS n 1 169 PHE n 1 170 LEU n 1 171 LEU n 1 172 HIS n 1 173 THR n 1 174 ASP n 1 175 LYS n 1 176 PRO n 1 177 VAL n 1 178 SER n 1 179 ALA n 1 180 ASP n 1 181 ASP n 1 182 PHE n 1 183 ARG n 1 184 LEU n 1 185 SER n 1 186 VAL n 1 187 ILE n 1 188 ASP n 1 189 LEU n 1 190 HIS n 1 191 ARG n 1 192 ALA n 1 193 GLN n 1 194 THR n 1 195 ARG n 1 196 ASP n 1 197 ALA n 1 198 THR n 1 199 PRO n 1 200 LYS n 1 201 ARG n 1 202 TRP n 1 203 ARG n 1 204 ASN n 1 205 LYS n 1 206 ASP n 1 207 LEU n 1 208 ALA n 1 209 ALA n 1 210 LEU n 1 211 TYR n 1 212 PHE n 1 213 SER n 1 214 ALA n 1 215 LEU n 1 216 ASP n 1 217 ILE n 1 218 GLY n 1 219 LEU n 1 220 THR n 1 221 ARG n 1 222 ARG n 1 223 ASP n 1 224 LYS n 1 225 LEU n 1 226 ARG n 1 227 PHE n 1 228 LEU n 1 229 ARG n 1 230 THR n 1 231 TYR n 1 232 PHE n 1 233 ARG n 1 234 ARG n 1 235 PRO n 1 236 LEU n 1 237 ARG n 1 238 GLU n 1 239 ILE n 1 240 LEU n 1 241 ARG n 1 242 ASP n 1 243 GLU n 1 244 ALA n 1 245 GLY n 1 246 LEU n 1 247 LEU n 1 248 ALA n 1 249 TRP n 1 250 MSE n 1 251 GLU n 1 252 ARG n 1 253 LYS n 1 254 ALA n 1 255 GLU n 1 256 LYS n 1 257 LEU n 1 258 TYR n 1 259 GLU n 2 1 THR n 2 2 ILE n 2 3 GLU n 2 4 GLU n 2 5 ARG n 2 6 VAL n 2 7 LYS n 2 8 LYS n 2 9 ILE n 2 10 ILE n 2 11 GLY n 2 12 GLU n 2 13 GLN n 2 14 LEU n 2 15 GLY n 2 16 VAL n 2 17 LYS n 2 18 GLN n 2 19 GLU n 2 20 GLU n 2 21 VAL n 2 22 THR n 2 23 ASN n 2 24 ASN n 2 25 ALA n 2 26 SER n 2 27 PHE n 2 28 VAL n 2 29 GLU n 2 30 ASP n 2 31 LEU n 2 32 GLY n 2 33 ALA n 2 34 ASP n 2 35 SER n 2 36 LEU n 2 37 ASP n 2 38 THR n 2 39 VAL n 2 40 GLU n 2 41 LEU n 2 42 VAL n 2 43 MSE n 2 44 ALA n 2 45 LEU n 2 46 GLU n 2 47 GLU n 2 48 GLU n 2 49 PHE n 2 50 ASP n 2 51 THR n 2 52 GLU n 2 53 ILE n 2 54 PRO n 2 55 ASP n 2 56 GLU n 2 57 GLU n 2 58 ALA n 2 59 GLU n 2 60 LYS n 2 61 ILE n 2 62 THR n 2 63 THR n 2 64 VAL n 2 65 GLN n 2 66 ALA n 2 67 ALA n 2 68 ILE n 2 69 ASP n 2 70 TYR n 2 71 ILE n 2 72 ASN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 259 ? ? 'rfaP, waaP, PA5009' ? ? ? ? ? ? 'Pseudomonas aeruginosa' 287 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 72 ? ? acpP ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G9S non-polymer . 'S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] hexadecanethioate' ? 'C27 H53 N2 O8 P S' 596.757 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLY 55 55 ? ? ? A . n A 1 56 ILE 56 56 ? ? ? A . n A 1 57 GLY 57 57 ? ? ? A . n A 1 58 TRP 58 58 ? ? ? A . n A 1 59 GLY 59 59 ? ? ? A . n A 1 60 GLU 60 60 ? ? ? A . n A 1 61 ILE 61 61 ? ? ? A . n A 1 62 ALA 62 62 ? ? ? A . n A 1 63 LYS 63 63 ? ? ? A . n A 1 64 ASN 64 64 ? ? ? A . n A 1 65 LEU 65 65 ? ? ? A . n A 1 66 LEU 66 66 ? ? ? A . n A 1 67 THR 67 67 ? ? ? A . n A 1 68 ALA 68 68 ? ? ? A . n A 1 69 LYS 69 69 ? ? ? A . n A 1 70 LEU 70 70 ? ? ? A . n A 1 71 PRO 71 71 ? ? ? A . n A 1 72 VAL 72 72 ? ? ? A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 MSE 93 93 93 MSE MSE A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 TRP 130 130 130 TRP TRP A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 MSE 150 150 150 MSE MSE A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 MSE 154 154 154 MSE MSE A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 CYS 167 167 167 CYS CYS A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 HIS 190 190 190 HIS HIS A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 TRP 202 202 202 TRP TRP A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 THR 220 220 220 THR THR A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 PHE 227 227 227 PHE PHE A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 TYR 231 231 231 TYR TYR A . n A 1 232 PHE 232 232 232 PHE PHE A . n A 1 233 ARG 233 233 233 ARG ARG A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 ARG 237 237 237 ARG ARG A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 ARG 241 241 241 ARG ARG A . n A 1 242 ASP 242 242 242 ASP ASP A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 GLY 245 245 245 GLY GLY A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 TRP 249 249 249 TRP TRP A . n A 1 250 MSE 250 250 250 MSE MSE A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 TYR 258 258 258 TYR TYR A . n A 1 259 GLU 259 259 259 GLU GLU A . n B 2 1 THR 1 2 2 THR THR B . n B 2 2 ILE 2 3 3 ILE ILE B . n B 2 3 GLU 3 4 4 GLU GLU B . n B 2 4 GLU 4 5 5 GLU GLU B . n B 2 5 ARG 5 6 6 ARG ARG B . n B 2 6 VAL 6 7 7 VAL VAL B . n B 2 7 LYS 7 8 8 LYS LYS B . n B 2 8 LYS 8 9 9 LYS LYS B . n B 2 9 ILE 9 10 10 ILE ILE B . n B 2 10 ILE 10 11 11 ILE ILE B . n B 2 11 GLY 11 12 12 GLY GLY B . n B 2 12 GLU 12 13 13 GLU GLU B . n B 2 13 GLN 13 14 14 GLN GLN B . n B 2 14 LEU 14 15 15 LEU LEU B . n B 2 15 GLY 15 16 16 GLY GLY B . n B 2 16 VAL 16 17 17 VAL VAL B . n B 2 17 LYS 17 18 18 LYS LYS B . n B 2 18 GLN 18 19 19 GLN GLN B . n B 2 19 GLU 19 20 20 GLU GLU B . n B 2 20 GLU 20 21 21 GLU GLU B . n B 2 21 VAL 21 22 22 VAL VAL B . n B 2 22 THR 22 23 23 THR THR B . n B 2 23 ASN 23 24 24 ASN ASN B . n B 2 24 ASN 24 25 25 ASN ASN B . n B 2 25 ALA 25 26 26 ALA ALA B . n B 2 26 SER 26 27 27 SER SER B . n B 2 27 PHE 27 28 28 PHE PHE B . n B 2 28 VAL 28 29 29 VAL VAL B . n B 2 29 GLU 29 30 30 GLU GLU B . n B 2 30 ASP 30 31 31 ASP ASP B . n B 2 31 LEU 31 32 32 LEU LEU B . n B 2 32 GLY 32 33 33 GLY GLY B . n B 2 33 ALA 33 34 34 ALA ALA B . n B 2 34 ASP 34 35 35 ASP ASP B . n B 2 35 SER 35 36 36 SER SPP B . n B 2 36 LEU 36 37 37 LEU LEU B . n B 2 37 ASP 37 38 38 ASP ASP B . n B 2 38 THR 38 39 39 THR THR B . n B 2 39 VAL 39 40 40 VAL VAL B . n B 2 40 GLU 40 41 41 GLU GLU B . n B 2 41 LEU 41 42 42 LEU LEU B . n B 2 42 VAL 42 43 43 VAL VAL B . n B 2 43 MSE 43 44 44 MSE MSE B . n B 2 44 ALA 44 45 45 ALA ALA B . n B 2 45 LEU 45 46 46 LEU LEU B . n B 2 46 GLU 46 47 47 GLU GLU B . n B 2 47 GLU 47 48 48 GLU GLU B . n B 2 48 GLU 48 49 49 GLU GLU B . n B 2 49 PHE 49 50 50 PHE PHE B . n B 2 50 ASP 50 51 51 ASP ASP B . n B 2 51 THR 51 52 52 THR THR B . n B 2 52 GLU 52 53 53 GLU GLU B . n B 2 53 ILE 53 54 54 ILE ILE B . n B 2 54 PRO 54 55 55 PRO PRO B . n B 2 55 ASP 55 56 56 ASP ASP B . n B 2 56 GLU 56 57 57 GLU GLU B . n B 2 57 GLU 57 58 58 GLU GLU B . n B 2 58 ALA 58 59 59 ALA ALA B . n B 2 59 GLU 59 60 60 GLU GLU B . n B 2 60 LYS 60 61 61 LYS LYS B . n B 2 61 ILE 61 62 62 ILE ILE B . n B 2 62 THR 62 63 63 THR THR B . n B 2 63 THR 63 64 64 THR THR B . n B 2 64 VAL 64 65 65 VAL VAL B . n B 2 65 GLN 65 66 66 GLN GLN B . n B 2 66 ALA 66 67 67 ALA ALA B . n B 2 67 ALA 67 68 68 ALA ALA B . n B 2 68 ILE 68 69 69 ILE ILE B . n B 2 69 ASP 69 70 70 ASP ASP B . n B 2 70 TYR 70 71 71 TYR TYR B . n B 2 71 ILE 71 72 72 ILE ILE B . n B 2 72 ASN 72 73 73 ASN ASN B . n # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id G9S _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 36 _pdbx_nonpoly_scheme.pdb_mon_id G9S _pdbx_nonpoly_scheme.auth_mon_id SPP _pdbx_nonpoly_scheme.pdb_strand_id B _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 1 ? 'data scaling' ? ? 'Phil Evans' ? ? ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program . 2 ? phasing ? ? 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de ? ? ? ? Fortran_77 http://shelx.uni-ac.gwdg.de/SHELX/ ? SHELX ? ? package . 3 ? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++ http://www.phenix-online.org/ ? PHENIX ? ? package 1.13_2998 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6DFL _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.023 _cell.length_a_esd ? _cell.length_b 92.023 _cell.length_b_esd ? _cell.length_c 99.172 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6DFL _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6DFL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM HEPES pH 7.4, 5% Jeffamine M-600' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 77 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-09-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 70.650 _reflns.entry_id 6DFL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.396 _reflns.d_resolution_low 79.694 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19544 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.700 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.068 _reflns.pdbx_Rpim_I_all 0.015 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 384314 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.396 2.404 ? ? ? ? ? ? 222 100.000 ? ? ? ? 1.340 ? ? ? ? ? ? ? ? 20.300 ? ? ? ? 1.374 0.303 ? 1 1 0.927 ? 11.111 79.694 ? ? ? ? ? ? 230 99.100 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 16.300 ? ? ? ? 0.051 0.012 ? 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 145.720 _refine.B_iso_mean 87.8044 _refine.B_iso_min 54.660 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6DFL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3960 _refine.ls_d_res_low 62.1220 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19486 _refine.ls_number_reflns_R_free 945 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6400 _refine.ls_percent_reflns_R_free 4.8500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2350 _refine.ls_R_factor_R_free 0.2693 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2332 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.2300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3960 _refine_hist.d_res_low 62.1220 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2599 _refine_hist.pdbx_number_residues_total 313 _refine_hist.pdbx_number_atoms_protein 2599 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3960 2.5223 2734 . 131 2603 99.0000 . . . 0.4239 0.0000 0.3422 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.5223 2.6804 2753 . 117 2636 99.0000 . . . 0.3516 0.0000 0.3326 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.6804 2.8873 2756 . 128 2628 100.0000 . . . 0.3812 0.0000 0.3079 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.8873 3.1779 2741 . 134 2607 99.0000 . . . 0.3152 0.0000 0.2901 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.1779 3.6377 2775 . 155 2620 100.0000 . . . 0.3639 0.0000 0.2655 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.6377 4.5829 2793 . 133 2660 100.0000 . . . 0.2513 0.0000 0.2179 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 4.5829 62.1425 2934 . 147 2787 100.0000 . . . 0.2111 0.0000 0.1957 . . . . . . 7 . . . # _struct.entry_id 6DFL _struct.title 'WaaP in complex with acyl carrier protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6DFL _struct_keywords.text 'Bacterial sugar kinase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP RFAP_PSEAE Q9HUF7 ? 1 ;RLVLEEPFKRLWNGRDPFEAVEALQGKVYRELEGRRTLRTEVDGRGYFVKIHRGIGWGEIAKNLLTAKLPVLGARQEWQA IRRLHEAGVATMTAVAYGERGSDPARQHSFIVTEELAPTVDLEVFSQDWRERPPPPRLKRALVEAVARMVGDMHRAGVNH RDCYICHFLLHTDKPVSADDFRLSVIDLHRAQTRDATPKRWRNKDLAALYFSALDIGLTRRDKLRFLRTYFRRPLREILR DEAGLLAWMERKAEKLYE ; 2 2 UNP ACP_ECO45 B7MJ81 ? 2 TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYIN 3 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6DFL A 2 ? 259 ? Q9HUF7 2 ? 259 ? 2 259 2 2 6DFL B 1 ? 72 ? B7MJ81 3 ? 74 ? 2 73 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6DFL _struct_ref_seq_dif.mon_id MSE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9HUF7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2300 ? 1 MORE -4 ? 1 'SSA (A^2)' 16530 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 8 ? TRP A 13 ? PRO A 8 TRP A 13 1 ? 6 HELX_P HELX_P2 AA2 ASP A 17 ? LEU A 25 ? ASP A 17 LEU A 25 1 ? 9 HELX_P HELX_P3 AA3 ALA A 75 ? ALA A 88 ? ALA A 75 ALA A 88 1 ? 14 HELX_P HELX_P4 AA4 LEU A 123 ? GLN A 128 ? LEU A 123 GLN A 128 1 ? 6 HELX_P HELX_P5 AA5 PRO A 136 ? ALA A 157 ? PRO A 136 ALA A 157 1 ? 22 HELX_P HELX_P6 AA6 TYR A 165 ? CYS A 167 ? TYR A 165 CYS A 167 5 ? 3 HELX_P HELX_P7 AA7 PRO A 199 ? SER A 213 ? PRO A 199 SER A 213 1 ? 15 HELX_P HELX_P8 AA8 THR A 220 ? ARG A 233 ? THR A 220 ARG A 233 1 ? 14 HELX_P HELX_P9 AA9 PRO A 235 ? GLU A 243 ? PRO A 235 GLU A 243 1 ? 9 HELX_P HELX_P10 AB1 GLU A 243 ? TYR A 258 ? GLU A 243 TYR A 258 1 ? 16 HELX_P HELX_P11 AB2 ILE B 2 ? GLY B 15 ? ILE B 3 GLY B 16 1 ? 14 HELX_P HELX_P12 AB3 LYS B 17 ? VAL B 21 ? LYS B 18 VAL B 22 5 ? 5 HELX_P HELX_P13 AB4 ASP B 34 ? PHE B 49 ? ASP B 35 PHE B 50 1 ? 16 HELX_P HELX_P14 AB5 PRO B 54 ? GLU B 59 ? PRO B 55 GLU B 60 1 ? 6 HELX_P HELX_P15 AB6 THR B 63 ? ASN B 72 ? THR B 64 ASN B 73 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ARG 2 N ? ? A MSE 1 A ARG 2 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A THR 92 C ? ? ? 1_555 A MSE 93 N ? ? A THR 92 A MSE 93 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A MSE 93 C ? ? ? 1_555 A THR 94 N ? ? A MSE 93 A THR 94 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale4 covale both ? A ARG 149 C ? ? ? 1_555 A MSE 150 N ? ? A ARG 149 A MSE 150 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale5 covale both ? A MSE 150 C ? ? ? 1_555 A VAL 151 N ? ? A MSE 150 A VAL 151 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A ASP 153 C ? ? ? 1_555 A MSE 154 N ? ? A ASP 153 A MSE 154 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale7 covale both ? A MSE 154 C ? ? ? 1_555 A HIS 155 N ? ? A MSE 154 A HIS 155 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale8 covale both ? A TRP 249 C ? ? ? 1_555 A MSE 250 N ? ? A TRP 249 A MSE 250 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale9 covale both ? A MSE 250 C ? ? ? 1_555 A GLU 251 N ? ? A MSE 250 A GLU 251 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale10 covale one ? B SER 35 OG ? ? ? 1_555 C G9S . P1 ? ? B SER 36 B G9S 101 1_555 ? ? ? ? ? ? ? 1.561 ? ? covale11 covale both ? B VAL 42 C ? ? ? 1_555 B MSE 43 N ? ? B VAL 43 B MSE 44 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale12 covale both ? B MSE 43 C ? ? ? 1_555 B ALA 44 N ? ? B MSE 44 B ALA 45 1_555 ? ? ? ? ? ? ? 1.341 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 1 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 93 ? . . . . MSE A 93 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 150 ? . . . . MSE A 150 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 154 ? . . . . MSE A 154 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 250 ? . . . . MSE A 250 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE B 43 ? . . . . MSE B 44 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 G9S C . ? SER B 35 ? G9S B 101 ? 1_555 SER B 36 ? 1_555 P1 OG SER 1 G9S None 'Covalent chemical modification' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 7 A . ? GLU 7 A PRO 8 A ? PRO 8 A 1 6.79 2 ALA 118 A . ? ALA 118 A PRO 119 A ? PRO 119 A 1 0.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 2 ? LEU A 5 ? ARG A 2 LEU A 5 AA1 2 ALA A 95 ? ARG A 101 ? ALA A 95 ARG A 101 AA1 3 HIS A 109 ? GLU A 115 ? HIS A 109 GLU A 115 AA1 4 TYR A 48 ? HIS A 53 ? TYR A 48 HIS A 53 AA1 5 ARG A 37 ? THR A 41 ? ARG A 37 THR A 41 AA2 1 THR A 120 ? ASP A 122 ? THR A 120 ASP A 122 AA2 2 PHE A 169 ? HIS A 172 ? PHE A 169 HIS A 172 AA2 3 LEU A 184 ? VAL A 186 ? LEU A 184 VAL A 186 AA3 1 VAL A 159 ? ASN A 160 ? VAL A 159 ASN A 160 AA3 2 GLN A 193 ? THR A 194 ? GLN A 193 THR A 194 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 2 ? N ARG A 2 O GLU A 100 ? O GLU A 100 AA1 2 3 N ARG A 101 ? N ARG A 101 O HIS A 109 ? O HIS A 109 AA1 3 4 O THR A 114 ? O THR A 114 N PHE A 49 ? N PHE A 49 AA1 4 5 O VAL A 50 ? O VAL A 50 N LEU A 39 ? N LEU A 39 AA2 1 2 N VAL A 121 ? N VAL A 121 O LEU A 171 ? O LEU A 171 AA2 2 3 N LEU A 170 ? N LEU A 170 O SER A 185 ? O SER A 185 AA3 1 2 N ASN A 160 ? N ASN A 160 O GLN A 193 ? O GLN A 193 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id B _struct_site.pdbx_auth_comp_id G9S _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue G9S B 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 TYR A 211 ? TYR A 211 . ? 1_555 ? 2 AC1 9 ARG A 221 ? ARG A 221 . ? 1_555 ? 3 AC1 9 LEU A 225 ? LEU A 225 . ? 1_555 ? 4 AC1 9 PHE A 227 ? PHE A 227 . ? 1_555 ? 5 AC1 9 LEU A 228 ? LEU A 228 . ? 1_555 ? 6 AC1 9 LEU A 247 ? LEU A 247 . ? 1_555 ? 7 AC1 9 MSE A 250 ? MSE A 250 . ? 1_555 ? 8 AC1 9 GLU A 251 ? GLU A 251 . ? 1_555 ? 9 AC1 9 SER B 35 ? SER B 36 . ? 1_555 ? # _pdbx_entry_details.entry_id 6DFL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OH _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 98 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 100 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 14 ? ? -64.76 -75.38 2 1 TYR A 30 ? ? -126.01 -135.00 3 1 GLU A 32 ? ? -118.33 52.58 4 1 GLU A 34 ? ? 54.19 85.77 5 1 ARG A 37 ? ? -173.22 138.99 6 1 ARG A 107 ? ? -102.40 77.16 7 1 GLN A 128 ? ? -24.96 -51.14 8 1 ARG A 133 ? ? -116.18 73.85 9 1 ARG A 162 ? ? 87.45 -21.22 10 1 ILE A 187 ? ? -128.09 -166.23 11 1 ASP A 188 ? ? 35.65 87.49 12 1 SER B 36 ? ? -19.03 -69.92 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 93 A MSE 93 ? MET 'modified residue' 2 A MSE 150 A MSE 150 ? MET 'modified residue' 3 A MSE 154 A MSE 154 ? MET 'modified residue' 4 A MSE 250 A MSE 250 ? MET 'modified residue' 5 B MSE 43 B MSE 44 ? MET 'modified residue' # _phasing.method SAD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 55 ? A GLY 55 2 1 Y 1 A ILE 56 ? A ILE 56 3 1 Y 1 A GLY 57 ? A GLY 57 4 1 Y 1 A TRP 58 ? A TRP 58 5 1 Y 1 A GLY 59 ? A GLY 59 6 1 Y 1 A GLU 60 ? A GLU 60 7 1 Y 1 A ILE 61 ? A ILE 61 8 1 Y 1 A ALA 62 ? A ALA 62 9 1 Y 1 A LYS 63 ? A LYS 63 10 1 Y 1 A ASN 64 ? A ASN 64 11 1 Y 1 A LEU 65 ? A LEU 65 12 1 Y 1 A LEU 66 ? A LEU 66 13 1 Y 1 A THR 67 ? A THR 67 14 1 Y 1 A ALA 68 ? A ALA 68 15 1 Y 1 A LYS 69 ? A LYS 69 16 1 Y 1 A LEU 70 ? A LEU 70 17 1 Y 1 A PRO 71 ? A PRO 71 18 1 Y 1 A VAL 72 ? A VAL 72 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 G9S C1 C N N 88 G9S C2 C N N 89 G9S C3 C N N 90 G9S C4 C N N 91 G9S C5 C N N 92 G9S C6 C N N 93 G9S C7 C N N 94 G9S C8 C N N 95 G9S C10 C N N 96 G9S C11 C N N 97 G9S C12 C N N 98 G9S C13 C N N 99 G9S C14 C N N 100 G9S C15 C N N 101 G9S C16 C N N 102 G9S N2 N N N 103 G9S C19 C N N 104 G9S C20 C N N 105 G9S C21 C N N 106 G9S C22 C N N 107 G9S C23 C N N 108 G9S C24 C N N 109 G9S C25 C N N 110 G9S C26 C N N 111 G9S C27 C N N 112 G9S C28 C N N 113 G9S C29 C N N 114 G9S C30 C N S 115 G9S N3 N N N 116 G9S O2 O N N 117 G9S O3 O N N 118 G9S O4 O N N 119 G9S O5 O N N 120 G9S O6 O N N 121 G9S O8 O N N 122 G9S O9 O N N 123 G9S P1 P N N 124 G9S S1 S N N 125 G9S O1 O N N 126 G9S H1 H N N 127 G9S H2 H N N 128 G9S H3 H N N 129 G9S H4 H N N 130 G9S H5 H N N 131 G9S H6 H N N 132 G9S H7 H N N 133 G9S H8 H N N 134 G9S H9 H N N 135 G9S H10 H N N 136 G9S H11 H N N 137 G9S H12 H N N 138 G9S H13 H N N 139 G9S H14 H N N 140 G9S H15 H N N 141 G9S H16 H N N 142 G9S H17 H N N 143 G9S H18 H N N 144 G9S H19 H N N 145 G9S H20 H N N 146 G9S H21 H N N 147 G9S H22 H N N 148 G9S H23 H N N 149 G9S H24 H N N 150 G9S H25 H N N 151 G9S H26 H N N 152 G9S H27 H N N 153 G9S H28 H N N 154 G9S H29 H N N 155 G9S H30 H N N 156 G9S H31 H N N 157 G9S H32 H N N 158 G9S H33 H N N 159 G9S H34 H N N 160 G9S H35 H N N 161 G9S H36 H N N 162 G9S H37 H N N 163 G9S H38 H N N 164 G9S H39 H N N 165 G9S H40 H N N 166 G9S H41 H N N 167 G9S H42 H N N 168 G9S H43 H N N 169 G9S H44 H N N 170 G9S H45 H N N 171 G9S H46 H N N 172 G9S H47 H N N 173 G9S H48 H N N 174 G9S H49 H N N 175 G9S H50 H N N 176 G9S H51 H N N 177 G9S H52 H N N 178 G9S H53 H N N 179 GLN N N N N 180 GLN CA C N S 181 GLN C C N N 182 GLN O O N N 183 GLN CB C N N 184 GLN CG C N N 185 GLN CD C N N 186 GLN OE1 O N N 187 GLN NE2 N N N 188 GLN OXT O N N 189 GLN H H N N 190 GLN H2 H N N 191 GLN HA H N N 192 GLN HB2 H N N 193 GLN HB3 H N N 194 GLN HG2 H N N 195 GLN HG3 H N N 196 GLN HE21 H N N 197 GLN HE22 H N N 198 GLN HXT H N N 199 GLU N N N N 200 GLU CA C N S 201 GLU C C N N 202 GLU O O N N 203 GLU CB C N N 204 GLU CG C N N 205 GLU CD C N N 206 GLU OE1 O N N 207 GLU OE2 O N N 208 GLU OXT O N N 209 GLU H H N N 210 GLU H2 H N N 211 GLU HA H N N 212 GLU HB2 H N N 213 GLU HB3 H N N 214 GLU HG2 H N N 215 GLU HG3 H N N 216 GLU HE2 H N N 217 GLU HXT H N N 218 GLY N N N N 219 GLY CA C N N 220 GLY C C N N 221 GLY O O N N 222 GLY OXT O N N 223 GLY H H N N 224 GLY H2 H N N 225 GLY HA2 H N N 226 GLY HA3 H N N 227 GLY HXT H N N 228 HIS N N N N 229 HIS CA C N S 230 HIS C C N N 231 HIS O O N N 232 HIS CB C N N 233 HIS CG C Y N 234 HIS ND1 N Y N 235 HIS CD2 C Y N 236 HIS CE1 C Y N 237 HIS NE2 N Y N 238 HIS OXT O N N 239 HIS H H N N 240 HIS H2 H N N 241 HIS HA H N N 242 HIS HB2 H N N 243 HIS HB3 H N N 244 HIS HD1 H N N 245 HIS HD2 H N N 246 HIS HE1 H N N 247 HIS HE2 H N N 248 HIS HXT H N N 249 ILE N N N N 250 ILE CA C N S 251 ILE C C N N 252 ILE O O N N 253 ILE CB C N S 254 ILE CG1 C N N 255 ILE CG2 C N N 256 ILE CD1 C N N 257 ILE OXT O N N 258 ILE H H N N 259 ILE H2 H N N 260 ILE HA H N N 261 ILE HB H N N 262 ILE HG12 H N N 263 ILE HG13 H N N 264 ILE HG21 H N N 265 ILE HG22 H N N 266 ILE HG23 H N N 267 ILE HD11 H N N 268 ILE HD12 H N N 269 ILE HD13 H N N 270 ILE HXT H N N 271 LEU N N N N 272 LEU CA C N S 273 LEU C C N N 274 LEU O O N N 275 LEU CB C N N 276 LEU CG C N N 277 LEU CD1 C N N 278 LEU CD2 C N N 279 LEU OXT O N N 280 LEU H H N N 281 LEU H2 H N N 282 LEU HA H N N 283 LEU HB2 H N N 284 LEU HB3 H N N 285 LEU HG H N N 286 LEU HD11 H N N 287 LEU HD12 H N N 288 LEU HD13 H N N 289 LEU HD21 H N N 290 LEU HD22 H N N 291 LEU HD23 H N N 292 LEU HXT H N N 293 LYS N N N N 294 LYS CA C N S 295 LYS C C N N 296 LYS O O N N 297 LYS CB C N N 298 LYS CG C N N 299 LYS CD C N N 300 LYS CE C N N 301 LYS NZ N N N 302 LYS OXT O N N 303 LYS H H N N 304 LYS H2 H N N 305 LYS HA H N N 306 LYS HB2 H N N 307 LYS HB3 H N N 308 LYS HG2 H N N 309 LYS HG3 H N N 310 LYS HD2 H N N 311 LYS HD3 H N N 312 LYS HE2 H N N 313 LYS HE3 H N N 314 LYS HZ1 H N N 315 LYS HZ2 H N N 316 LYS HZ3 H N N 317 LYS HXT H N N 318 MSE N N N N 319 MSE CA C N S 320 MSE C C N N 321 MSE O O N N 322 MSE OXT O N N 323 MSE CB C N N 324 MSE CG C N N 325 MSE SE SE N N 326 MSE CE C N N 327 MSE H H N N 328 MSE H2 H N N 329 MSE HA H N N 330 MSE HXT H N N 331 MSE HB2 H N N 332 MSE HB3 H N N 333 MSE HG2 H N N 334 MSE HG3 H N N 335 MSE HE1 H N N 336 MSE HE2 H N N 337 MSE HE3 H N N 338 PHE N N N N 339 PHE CA C N S 340 PHE C C N N 341 PHE O O N N 342 PHE CB C N N 343 PHE CG C Y N 344 PHE CD1 C Y N 345 PHE CD2 C Y N 346 PHE CE1 C Y N 347 PHE CE2 C Y N 348 PHE CZ C Y N 349 PHE OXT O N N 350 PHE H H N N 351 PHE H2 H N N 352 PHE HA H N N 353 PHE HB2 H N N 354 PHE HB3 H N N 355 PHE HD1 H N N 356 PHE HD2 H N N 357 PHE HE1 H N N 358 PHE HE2 H N N 359 PHE HZ H N N 360 PHE HXT H N N 361 PRO N N N N 362 PRO CA C N S 363 PRO C C N N 364 PRO O O N N 365 PRO CB C N N 366 PRO CG C N N 367 PRO CD C N N 368 PRO OXT O N N 369 PRO H H N N 370 PRO HA H N N 371 PRO HB2 H N N 372 PRO HB3 H N N 373 PRO HG2 H N N 374 PRO HG3 H N N 375 PRO HD2 H N N 376 PRO HD3 H N N 377 PRO HXT H N N 378 SER N N N N 379 SER CA C N S 380 SER C C N N 381 SER O O N N 382 SER CB C N N 383 SER OG O N N 384 SER OXT O N N 385 SER H H N N 386 SER H2 H N N 387 SER HA H N N 388 SER HB2 H N N 389 SER HB3 H N N 390 SER HG H N N 391 SER HXT H N N 392 THR N N N N 393 THR CA C N S 394 THR C C N N 395 THR O O N N 396 THR CB C N R 397 THR OG1 O N N 398 THR CG2 C N N 399 THR OXT O N N 400 THR H H N N 401 THR H2 H N N 402 THR HA H N N 403 THR HB H N N 404 THR HG1 H N N 405 THR HG21 H N N 406 THR HG22 H N N 407 THR HG23 H N N 408 THR HXT H N N 409 TRP N N N N 410 TRP CA C N S 411 TRP C C N N 412 TRP O O N N 413 TRP CB C N N 414 TRP CG C Y N 415 TRP CD1 C Y N 416 TRP CD2 C Y N 417 TRP NE1 N Y N 418 TRP CE2 C Y N 419 TRP CE3 C Y N 420 TRP CZ2 C Y N 421 TRP CZ3 C Y N 422 TRP CH2 C Y N 423 TRP OXT O N N 424 TRP H H N N 425 TRP H2 H N N 426 TRP HA H N N 427 TRP HB2 H N N 428 TRP HB3 H N N 429 TRP HD1 H N N 430 TRP HE1 H N N 431 TRP HE3 H N N 432 TRP HZ2 H N N 433 TRP HZ3 H N N 434 TRP HH2 H N N 435 TRP HXT H N N 436 TYR N N N N 437 TYR CA C N S 438 TYR C C N N 439 TYR O O N N 440 TYR CB C N N 441 TYR CG C Y N 442 TYR CD1 C Y N 443 TYR CD2 C Y N 444 TYR CE1 C Y N 445 TYR CE2 C Y N 446 TYR CZ C Y N 447 TYR OH O N N 448 TYR OXT O N N 449 TYR H H N N 450 TYR H2 H N N 451 TYR HA H N N 452 TYR HB2 H N N 453 TYR HB3 H N N 454 TYR HD1 H N N 455 TYR HD2 H N N 456 TYR HE1 H N N 457 TYR HE2 H N N 458 TYR HH H N N 459 TYR HXT H N N 460 VAL N N N N 461 VAL CA C N S 462 VAL C C N N 463 VAL O O N N 464 VAL CB C N N 465 VAL CG1 C N N 466 VAL CG2 C N N 467 VAL OXT O N N 468 VAL H H N N 469 VAL H2 H N N 470 VAL HA H N N 471 VAL HB H N N 472 VAL HG11 H N N 473 VAL HG12 H N N 474 VAL HG13 H N N 475 VAL HG21 H N N 476 VAL HG22 H N N 477 VAL HG23 H N N 478 VAL HXT H N N 479 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 G9S O9 P1 doub N N 83 G9S P1 O8 sing N N 84 G9S P1 O6 sing N N 85 G9S O6 C7 sing N N 86 G9S C7 C6 sing N N 87 G9S C20 C6 sing N N 88 G9S C6 C8 sing N N 89 G9S C6 C30 sing N N 90 G9S C30 O5 sing N N 91 G9S C30 C5 sing N N 92 G9S O4 C5 doub N N 93 G9S C5 N3 sing N N 94 G9S N3 C4 sing N N 95 G9S O2 C2 doub N N 96 G9S C4 C3 sing N N 97 G9S C2 C3 sing N N 98 G9S C2 N2 sing N N 99 G9S C1 N2 sing N N 100 G9S C1 C19 sing N N 101 G9S C19 S1 sing N N 102 G9S O3 C10 doub N N 103 G9S C10 S1 sing N N 104 G9S C10 C11 sing N N 105 G9S C14 C13 sing N N 106 G9S C14 C15 sing N N 107 G9S C11 C12 sing N N 108 G9S C13 C12 sing N N 109 G9S C15 C16 sing N N 110 G9S C16 C21 sing N N 111 G9S C21 C22 sing N N 112 G9S C22 C23 sing N N 113 G9S C24 C23 sing N N 114 G9S C24 C25 sing N N 115 G9S C26 C25 sing N N 116 G9S C26 C27 sing N N 117 G9S C28 C27 sing N N 118 G9S C28 C29 sing N N 119 G9S P1 O1 sing N N 120 G9S C1 H1 sing N N 121 G9S C1 H2 sing N N 122 G9S C3 H3 sing N N 123 G9S C3 H4 sing N N 124 G9S C4 H5 sing N N 125 G9S C4 H6 sing N N 126 G9S C7 H7 sing N N 127 G9S C7 H8 sing N N 128 G9S C8 H9 sing N N 129 G9S C8 H10 sing N N 130 G9S C8 H11 sing N N 131 G9S C11 H12 sing N N 132 G9S C11 H13 sing N N 133 G9S C12 H14 sing N N 134 G9S C12 H15 sing N N 135 G9S C13 H16 sing N N 136 G9S C13 H17 sing N N 137 G9S C14 H18 sing N N 138 G9S C14 H19 sing N N 139 G9S C15 H20 sing N N 140 G9S C15 H21 sing N N 141 G9S C16 H22 sing N N 142 G9S C16 H23 sing N N 143 G9S N2 H24 sing N N 144 G9S C19 H25 sing N N 145 G9S C19 H26 sing N N 146 G9S C20 H27 sing N N 147 G9S C20 H28 sing N N 148 G9S C20 H29 sing N N 149 G9S C21 H30 sing N N 150 G9S C21 H31 sing N N 151 G9S C22 H32 sing N N 152 G9S C22 H33 sing N N 153 G9S C23 H34 sing N N 154 G9S C24 H35 sing N N 155 G9S C25 H36 sing N N 156 G9S C25 H37 sing N N 157 G9S C26 H38 sing N N 158 G9S C27 H39 sing N N 159 G9S C28 H40 sing N N 160 G9S C28 H41 sing N N 161 G9S C29 H42 sing N N 162 G9S C29 H43 sing N N 163 G9S C29 H44 sing N N 164 G9S C30 H45 sing N N 165 G9S N3 H46 sing N N 166 G9S O5 H47 sing N N 167 G9S O8 H48 sing N N 168 G9S O1 H49 sing N N 169 G9S C23 H50 sing N N 170 G9S C24 H51 sing N N 171 G9S C26 H52 sing N N 172 G9S C27 H53 sing N N 173 GLN N CA sing N N 174 GLN N H sing N N 175 GLN N H2 sing N N 176 GLN CA C sing N N 177 GLN CA CB sing N N 178 GLN CA HA sing N N 179 GLN C O doub N N 180 GLN C OXT sing N N 181 GLN CB CG sing N N 182 GLN CB HB2 sing N N 183 GLN CB HB3 sing N N 184 GLN CG CD sing N N 185 GLN CG HG2 sing N N 186 GLN CG HG3 sing N N 187 GLN CD OE1 doub N N 188 GLN CD NE2 sing N N 189 GLN NE2 HE21 sing N N 190 GLN NE2 HE22 sing N N 191 GLN OXT HXT sing N N 192 GLU N CA sing N N 193 GLU N H sing N N 194 GLU N H2 sing N N 195 GLU CA C sing N N 196 GLU CA CB sing N N 197 GLU CA HA sing N N 198 GLU C O doub N N 199 GLU C OXT sing N N 200 GLU CB CG sing N N 201 GLU CB HB2 sing N N 202 GLU CB HB3 sing N N 203 GLU CG CD sing N N 204 GLU CG HG2 sing N N 205 GLU CG HG3 sing N N 206 GLU CD OE1 doub N N 207 GLU CD OE2 sing N N 208 GLU OE2 HE2 sing N N 209 GLU OXT HXT sing N N 210 GLY N CA sing N N 211 GLY N H sing N N 212 GLY N H2 sing N N 213 GLY CA C sing N N 214 GLY CA HA2 sing N N 215 GLY CA HA3 sing N N 216 GLY C O doub N N 217 GLY C OXT sing N N 218 GLY OXT HXT sing N N 219 HIS N CA sing N N 220 HIS N H sing N N 221 HIS N H2 sing N N 222 HIS CA C sing N N 223 HIS CA CB sing N N 224 HIS CA HA sing N N 225 HIS C O doub N N 226 HIS C OXT sing N N 227 HIS CB CG sing N N 228 HIS CB HB2 sing N N 229 HIS CB HB3 sing N N 230 HIS CG ND1 sing Y N 231 HIS CG CD2 doub Y N 232 HIS ND1 CE1 doub Y N 233 HIS ND1 HD1 sing N N 234 HIS CD2 NE2 sing Y N 235 HIS CD2 HD2 sing N N 236 HIS CE1 NE2 sing Y N 237 HIS CE1 HE1 sing N N 238 HIS NE2 HE2 sing N N 239 HIS OXT HXT sing N N 240 ILE N CA sing N N 241 ILE N H sing N N 242 ILE N H2 sing N N 243 ILE CA C sing N N 244 ILE CA CB sing N N 245 ILE CA HA sing N N 246 ILE C O doub N N 247 ILE C OXT sing N N 248 ILE CB CG1 sing N N 249 ILE CB CG2 sing N N 250 ILE CB HB sing N N 251 ILE CG1 CD1 sing N N 252 ILE CG1 HG12 sing N N 253 ILE CG1 HG13 sing N N 254 ILE CG2 HG21 sing N N 255 ILE CG2 HG22 sing N N 256 ILE CG2 HG23 sing N N 257 ILE CD1 HD11 sing N N 258 ILE CD1 HD12 sing N N 259 ILE CD1 HD13 sing N N 260 ILE OXT HXT sing N N 261 LEU N CA sing N N 262 LEU N H sing N N 263 LEU N H2 sing N N 264 LEU CA C sing N N 265 LEU CA CB sing N N 266 LEU CA HA sing N N 267 LEU C O doub N N 268 LEU C OXT sing N N 269 LEU CB CG sing N N 270 LEU CB HB2 sing N N 271 LEU CB HB3 sing N N 272 LEU CG CD1 sing N N 273 LEU CG CD2 sing N N 274 LEU CG HG sing N N 275 LEU CD1 HD11 sing N N 276 LEU CD1 HD12 sing N N 277 LEU CD1 HD13 sing N N 278 LEU CD2 HD21 sing N N 279 LEU CD2 HD22 sing N N 280 LEU CD2 HD23 sing N N 281 LEU OXT HXT sing N N 282 LYS N CA sing N N 283 LYS N H sing N N 284 LYS N H2 sing N N 285 LYS CA C sing N N 286 LYS CA CB sing N N 287 LYS CA HA sing N N 288 LYS C O doub N N 289 LYS C OXT sing N N 290 LYS CB CG sing N N 291 LYS CB HB2 sing N N 292 LYS CB HB3 sing N N 293 LYS CG CD sing N N 294 LYS CG HG2 sing N N 295 LYS CG HG3 sing N N 296 LYS CD CE sing N N 297 LYS CD HD2 sing N N 298 LYS CD HD3 sing N N 299 LYS CE NZ sing N N 300 LYS CE HE2 sing N N 301 LYS CE HE3 sing N N 302 LYS NZ HZ1 sing N N 303 LYS NZ HZ2 sing N N 304 LYS NZ HZ3 sing N N 305 LYS OXT HXT sing N N 306 MSE N CA sing N N 307 MSE N H sing N N 308 MSE N H2 sing N N 309 MSE CA C sing N N 310 MSE CA CB sing N N 311 MSE CA HA sing N N 312 MSE C O doub N N 313 MSE C OXT sing N N 314 MSE OXT HXT sing N N 315 MSE CB CG sing N N 316 MSE CB HB2 sing N N 317 MSE CB HB3 sing N N 318 MSE CG SE sing N N 319 MSE CG HG2 sing N N 320 MSE CG HG3 sing N N 321 MSE SE CE sing N N 322 MSE CE HE1 sing N N 323 MSE CE HE2 sing N N 324 MSE CE HE3 sing N N 325 PHE N CA sing N N 326 PHE N H sing N N 327 PHE N H2 sing N N 328 PHE CA C sing N N 329 PHE CA CB sing N N 330 PHE CA HA sing N N 331 PHE C O doub N N 332 PHE C OXT sing N N 333 PHE CB CG sing N N 334 PHE CB HB2 sing N N 335 PHE CB HB3 sing N N 336 PHE CG CD1 doub Y N 337 PHE CG CD2 sing Y N 338 PHE CD1 CE1 sing Y N 339 PHE CD1 HD1 sing N N 340 PHE CD2 CE2 doub Y N 341 PHE CD2 HD2 sing N N 342 PHE CE1 CZ doub Y N 343 PHE CE1 HE1 sing N N 344 PHE CE2 CZ sing Y N 345 PHE CE2 HE2 sing N N 346 PHE CZ HZ sing N N 347 PHE OXT HXT sing N N 348 PRO N CA sing N N 349 PRO N CD sing N N 350 PRO N H sing N N 351 PRO CA C sing N N 352 PRO CA CB sing N N 353 PRO CA HA sing N N 354 PRO C O doub N N 355 PRO C OXT sing N N 356 PRO CB CG sing N N 357 PRO CB HB2 sing N N 358 PRO CB HB3 sing N N 359 PRO CG CD sing N N 360 PRO CG HG2 sing N N 361 PRO CG HG3 sing N N 362 PRO CD HD2 sing N N 363 PRO CD HD3 sing N N 364 PRO OXT HXT sing N N 365 SER N CA sing N N 366 SER N H sing N N 367 SER N H2 sing N N 368 SER CA C sing N N 369 SER CA CB sing N N 370 SER CA HA sing N N 371 SER C O doub N N 372 SER C OXT sing N N 373 SER CB OG sing N N 374 SER CB HB2 sing N N 375 SER CB HB3 sing N N 376 SER OG HG sing N N 377 SER OXT HXT sing N N 378 THR N CA sing N N 379 THR N H sing N N 380 THR N H2 sing N N 381 THR CA C sing N N 382 THR CA CB sing N N 383 THR CA HA sing N N 384 THR C O doub N N 385 THR C OXT sing N N 386 THR CB OG1 sing N N 387 THR CB CG2 sing N N 388 THR CB HB sing N N 389 THR OG1 HG1 sing N N 390 THR CG2 HG21 sing N N 391 THR CG2 HG22 sing N N 392 THR CG2 HG23 sing N N 393 THR OXT HXT sing N N 394 TRP N CA sing N N 395 TRP N H sing N N 396 TRP N H2 sing N N 397 TRP CA C sing N N 398 TRP CA CB sing N N 399 TRP CA HA sing N N 400 TRP C O doub N N 401 TRP C OXT sing N N 402 TRP CB CG sing N N 403 TRP CB HB2 sing N N 404 TRP CB HB3 sing N N 405 TRP CG CD1 doub Y N 406 TRP CG CD2 sing Y N 407 TRP CD1 NE1 sing Y N 408 TRP CD1 HD1 sing N N 409 TRP CD2 CE2 doub Y N 410 TRP CD2 CE3 sing Y N 411 TRP NE1 CE2 sing Y N 412 TRP NE1 HE1 sing N N 413 TRP CE2 CZ2 sing Y N 414 TRP CE3 CZ3 doub Y N 415 TRP CE3 HE3 sing N N 416 TRP CZ2 CH2 doub Y N 417 TRP CZ2 HZ2 sing N N 418 TRP CZ3 CH2 sing Y N 419 TRP CZ3 HZ3 sing N N 420 TRP CH2 HH2 sing N N 421 TRP OXT HXT sing N N 422 TYR N CA sing N N 423 TYR N H sing N N 424 TYR N H2 sing N N 425 TYR CA C sing N N 426 TYR CA CB sing N N 427 TYR CA HA sing N N 428 TYR C O doub N N 429 TYR C OXT sing N N 430 TYR CB CG sing N N 431 TYR CB HB2 sing N N 432 TYR CB HB3 sing N N 433 TYR CG CD1 doub Y N 434 TYR CG CD2 sing Y N 435 TYR CD1 CE1 sing Y N 436 TYR CD1 HD1 sing N N 437 TYR CD2 CE2 doub Y N 438 TYR CD2 HD2 sing N N 439 TYR CE1 CZ doub Y N 440 TYR CE1 HE1 sing N N 441 TYR CE2 CZ sing Y N 442 TYR CE2 HE2 sing N N 443 TYR CZ OH sing N N 444 TYR OH HH sing N N 445 TYR OXT HXT sing N N 446 VAL N CA sing N N 447 VAL N H sing N N 448 VAL N H2 sing N N 449 VAL CA C sing N N 450 VAL CA CB sing N N 451 VAL CA HA sing N N 452 VAL C O doub N N 453 VAL C OXT sing N N 454 VAL CB CG1 sing N N 455 VAL CB CG2 sing N N 456 VAL CB HB sing N N 457 VAL CG1 HG11 sing N N 458 VAL CG1 HG12 sing N N 459 VAL CG1 HG13 sing N N 460 VAL CG2 HG21 sing N N 461 VAL CG2 HG22 sing N N 462 VAL CG2 HG23 sing N N 463 VAL OXT HXT sing N N 464 # _atom_sites.entry_id 6DFL _atom_sites.fract_transf_matrix[1][1] 0.010867 _atom_sites.fract_transf_matrix[1][2] 0.006274 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012548 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010083 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S SE # loop_