data_6DFL
#
_entry.id 6DFL
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.398
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 6DFL pdb_00006dfl 10.2210/pdb6dfl/pdb
WWPDB D_1000234523 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2019-04-03
2 'Structure model' 1 1 2019-10-16
3 'Structure model' 1 2 2024-11-06
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Data collection'
2 2 'Structure model' 'Database references'
3 3 'Structure model' 'Data collection'
4 3 'Structure model' 'Database references'
5 3 'Structure model' 'Structure summary'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' citation
2 2 'Structure model' citation_author
3 3 'Structure model' chem_comp_atom
4 3 'Structure model' chem_comp_bond
5 3 'Structure model' database_2
6 3 'Structure model' pdbx_entry_details
7 3 'Structure model' pdbx_modification_feature
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.country'
2 2 'Structure model' '_citation.journal_abbrev'
3 2 'Structure model' '_citation.journal_id_CSD'
4 2 'Structure model' '_citation.journal_id_ISSN'
5 2 'Structure model' '_citation.journal_volume'
6 2 'Structure model' '_citation.page_first'
7 2 'Structure model' '_citation.page_last'
8 2 'Structure model' '_citation.pdbx_database_id_DOI'
9 2 'Structure model' '_citation.pdbx_database_id_PubMed'
10 2 'Structure model' '_citation.title'
11 2 'Structure model' '_citation.year'
12 3 'Structure model' '_database_2.pdbx_DOI'
13 3 'Structure model' '_database_2.pdbx_database_accession'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 6DFL
_pdbx_database_status.recvd_initial_deposition_date 2018-05-15
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site RCSB
_pdbx_database_status.process_site RCSB
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
_pdbx_database_status.status_code_nmr_data ?
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Chopra, R.' 1 ?
'Vash, B.' 2 ?
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country UK
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev 'Sci Rep'
_citation.journal_id_ASTM ?
_citation.journal_id_CSD ?
_citation.journal_id_ISSN 2045-2322
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 8
_citation.language ?
_citation.page_first 14124
_citation.page_last 14124
_citation.title
'Acylated-acyl carrier protein stabilizes the Pseudomonas aeruginosa WaaP lipopolysaccharide heptose kinase.'
_citation.year 2018
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1038/s41598-018-32379-1
_citation.pdbx_database_id_PubMed 30237436
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Kreamer, N.N.K.' 1 ?
primary 'Chopra, R.' 2 ?
primary 'Caughlan, R.E.' 3 ?
primary 'Fabbro, D.' 4 ?
primary 'Fang, E.' 5 ?
primary 'Gee, P.' 6 ?
primary 'Hunt, I.' 7 ?
primary 'Li, M.' 8 ?
primary 'Leon, B.C.' 9 ?
primary 'Muller, L.' 10 ?
primary 'Vash, B.' 11 ?
primary 'Woods, A.L.' 12 ?
primary 'Stams, T.' 13 ?
primary 'Dean, C.R.' 14 ?
primary 'Uehara, T.' 15 ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Lipopolysaccharide core heptose(I) kinase RfaP'
30470.348 1 2.7.1.-,2.7.10.2 ? ? ?
2 polymer man 'Acyl carrier protein'
8079.677 1 ? ? ? ?
3 non-polymer syn 'S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] hexadecanethioate'
596.757 1 ? ? ? ?
#
loop_
_entity_name_com.entity_id
_entity_name_com.name
1 'Lipopolysaccharide kinase WaaP'
2 ACP
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_target_identifier
1 'polypeptide(L)' no yes
;(MSE)RLVLEEPFKRLWNGRDPFEAVEALQGKVYRELEGRRTLRTEVDGRGYFVKIHRGIGWGEIAKNLLTAKLPVLGAR
QEWQAIRRLHEAGVAT(MSE)TAVAYGERGSDPARQHSFIVTEELAPTVDLEVFSQDWRERPPPPRLKRALVEAVAR
(MSE)VGD(MSE)HRAGVNHRDCYICHFLLHTDKPVSADDFRLSVIDLHRAQTRDATPKRWRNKDLAALYFSALDIGLTR
RDKLRFLRTYFRRPLREILRDEAGLLAW(MSE)ERKAEKLYE
;
;MRLVLEEPFKRLWNGRDPFEAVEALQGKVYRELEGRRTLRTEVDGRGYFVKIHRGIGWGEIAKNLLTAKLPVLGARQEWQ
AIRRLHEAGVATMTAVAYGERGSDPARQHSFIVTEELAPTVDLEVFSQDWRERPPPPRLKRALVEAVARMVGDMHRAGVN
HRDCYICHFLLHTDKPVSADDFRLSVIDLHRAQTRDATPKRWRNKDLAALYFSALDIGLTRRDKLRFLRTYFRRPLREIL
RDEAGLLAWMERKAEKLYE
;
A ?
2 'polypeptide(L)' no yes 'TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELV(MSE)ALEEEFDTEIPDEEAEKITTVQAAIDYIN'
TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYIN B ?
#
_pdbx_entity_nonpoly.entity_id 3
_pdbx_entity_nonpoly.name
'S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] hexadecanethioate'
_pdbx_entity_nonpoly.comp_id G9S
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MSE n
1 2 ARG n
1 3 LEU n
1 4 VAL n
1 5 LEU n
1 6 GLU n
1 7 GLU n
1 8 PRO n
1 9 PHE n
1 10 LYS n
1 11 ARG n
1 12 LEU n
1 13 TRP n
1 14 ASN n
1 15 GLY n
1 16 ARG n
1 17 ASP n
1 18 PRO n
1 19 PHE n
1 20 GLU n
1 21 ALA n
1 22 VAL n
1 23 GLU n
1 24 ALA n
1 25 LEU n
1 26 GLN n
1 27 GLY n
1 28 LYS n
1 29 VAL n
1 30 TYR n
1 31 ARG n
1 32 GLU n
1 33 LEU n
1 34 GLU n
1 35 GLY n
1 36 ARG n
1 37 ARG n
1 38 THR n
1 39 LEU n
1 40 ARG n
1 41 THR n
1 42 GLU n
1 43 VAL n
1 44 ASP n
1 45 GLY n
1 46 ARG n
1 47 GLY n
1 48 TYR n
1 49 PHE n
1 50 VAL n
1 51 LYS n
1 52 ILE n
1 53 HIS n
1 54 ARG n
1 55 GLY n
1 56 ILE n
1 57 GLY n
1 58 TRP n
1 59 GLY n
1 60 GLU n
1 61 ILE n
1 62 ALA n
1 63 LYS n
1 64 ASN n
1 65 LEU n
1 66 LEU n
1 67 THR n
1 68 ALA n
1 69 LYS n
1 70 LEU n
1 71 PRO n
1 72 VAL n
1 73 LEU n
1 74 GLY n
1 75 ALA n
1 76 ARG n
1 77 GLN n
1 78 GLU n
1 79 TRP n
1 80 GLN n
1 81 ALA n
1 82 ILE n
1 83 ARG n
1 84 ARG n
1 85 LEU n
1 86 HIS n
1 87 GLU n
1 88 ALA n
1 89 GLY n
1 90 VAL n
1 91 ALA n
1 92 THR n
1 93 MSE n
1 94 THR n
1 95 ALA n
1 96 VAL n
1 97 ALA n
1 98 TYR n
1 99 GLY n
1 100 GLU n
1 101 ARG n
1 102 GLY n
1 103 SER n
1 104 ASP n
1 105 PRO n
1 106 ALA n
1 107 ARG n
1 108 GLN n
1 109 HIS n
1 110 SER n
1 111 PHE n
1 112 ILE n
1 113 VAL n
1 114 THR n
1 115 GLU n
1 116 GLU n
1 117 LEU n
1 118 ALA n
1 119 PRO n
1 120 THR n
1 121 VAL n
1 122 ASP n
1 123 LEU n
1 124 GLU n
1 125 VAL n
1 126 PHE n
1 127 SER n
1 128 GLN n
1 129 ASP n
1 130 TRP n
1 131 ARG n
1 132 GLU n
1 133 ARG n
1 134 PRO n
1 135 PRO n
1 136 PRO n
1 137 PRO n
1 138 ARG n
1 139 LEU n
1 140 LYS n
1 141 ARG n
1 142 ALA n
1 143 LEU n
1 144 VAL n
1 145 GLU n
1 146 ALA n
1 147 VAL n
1 148 ALA n
1 149 ARG n
1 150 MSE n
1 151 VAL n
1 152 GLY n
1 153 ASP n
1 154 MSE n
1 155 HIS n
1 156 ARG n
1 157 ALA n
1 158 GLY n
1 159 VAL n
1 160 ASN n
1 161 HIS n
1 162 ARG n
1 163 ASP n
1 164 CYS n
1 165 TYR n
1 166 ILE n
1 167 CYS n
1 168 HIS n
1 169 PHE n
1 170 LEU n
1 171 LEU n
1 172 HIS n
1 173 THR n
1 174 ASP n
1 175 LYS n
1 176 PRO n
1 177 VAL n
1 178 SER n
1 179 ALA n
1 180 ASP n
1 181 ASP n
1 182 PHE n
1 183 ARG n
1 184 LEU n
1 185 SER n
1 186 VAL n
1 187 ILE n
1 188 ASP n
1 189 LEU n
1 190 HIS n
1 191 ARG n
1 192 ALA n
1 193 GLN n
1 194 THR n
1 195 ARG n
1 196 ASP n
1 197 ALA n
1 198 THR n
1 199 PRO n
1 200 LYS n
1 201 ARG n
1 202 TRP n
1 203 ARG n
1 204 ASN n
1 205 LYS n
1 206 ASP n
1 207 LEU n
1 208 ALA n
1 209 ALA n
1 210 LEU n
1 211 TYR n
1 212 PHE n
1 213 SER n
1 214 ALA n
1 215 LEU n
1 216 ASP n
1 217 ILE n
1 218 GLY n
1 219 LEU n
1 220 THR n
1 221 ARG n
1 222 ARG n
1 223 ASP n
1 224 LYS n
1 225 LEU n
1 226 ARG n
1 227 PHE n
1 228 LEU n
1 229 ARG n
1 230 THR n
1 231 TYR n
1 232 PHE n
1 233 ARG n
1 234 ARG n
1 235 PRO n
1 236 LEU n
1 237 ARG n
1 238 GLU n
1 239 ILE n
1 240 LEU n
1 241 ARG n
1 242 ASP n
1 243 GLU n
1 244 ALA n
1 245 GLY n
1 246 LEU n
1 247 LEU n
1 248 ALA n
1 249 TRP n
1 250 MSE n
1 251 GLU n
1 252 ARG n
1 253 LYS n
1 254 ALA n
1 255 GLU n
1 256 LYS n
1 257 LEU n
1 258 TYR n
1 259 GLU n
2 1 THR n
2 2 ILE n
2 3 GLU n
2 4 GLU n
2 5 ARG n
2 6 VAL n
2 7 LYS n
2 8 LYS n
2 9 ILE n
2 10 ILE n
2 11 GLY n
2 12 GLU n
2 13 GLN n
2 14 LEU n
2 15 GLY n
2 16 VAL n
2 17 LYS n
2 18 GLN n
2 19 GLU n
2 20 GLU n
2 21 VAL n
2 22 THR n
2 23 ASN n
2 24 ASN n
2 25 ALA n
2 26 SER n
2 27 PHE n
2 28 VAL n
2 29 GLU n
2 30 ASP n
2 31 LEU n
2 32 GLY n
2 33 ALA n
2 34 ASP n
2 35 SER n
2 36 LEU n
2 37 ASP n
2 38 THR n
2 39 VAL n
2 40 GLU n
2 41 LEU n
2 42 VAL n
2 43 MSE n
2 44 ALA n
2 45 LEU n
2 46 GLU n
2 47 GLU n
2 48 GLU n
2 49 PHE n
2 50 ASP n
2 51 THR n
2 52 GLU n
2 53 ILE n
2 54 PRO n
2 55 ASP n
2 56 GLU n
2 57 GLU n
2 58 ALA n
2 59 GLU n
2 60 LYS n
2 61 ILE n
2 62 THR n
2 63 THR n
2 64 VAL n
2 65 GLN n
2 66 ALA n
2 67 ALA n
2 68 ILE n
2 69 ASP n
2 70 TYR n
2 71 ILE n
2 72 ASN n
#
loop_
_entity_src_gen.entity_id
_entity_src_gen.pdbx_src_id
_entity_src_gen.pdbx_alt_source_flag
_entity_src_gen.pdbx_seq_type
_entity_src_gen.pdbx_beg_seq_num
_entity_src_gen.pdbx_end_seq_num
_entity_src_gen.gene_src_common_name
_entity_src_gen.gene_src_genus
_entity_src_gen.pdbx_gene_src_gene
_entity_src_gen.gene_src_species
_entity_src_gen.gene_src_strain
_entity_src_gen.gene_src_tissue
_entity_src_gen.gene_src_tissue_fraction
_entity_src_gen.gene_src_details
_entity_src_gen.pdbx_gene_src_fragment
_entity_src_gen.pdbx_gene_src_scientific_name
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id
_entity_src_gen.pdbx_gene_src_variant
_entity_src_gen.pdbx_gene_src_cell_line
_entity_src_gen.pdbx_gene_src_atcc
_entity_src_gen.pdbx_gene_src_organ
_entity_src_gen.pdbx_gene_src_organelle
_entity_src_gen.pdbx_gene_src_cell
_entity_src_gen.pdbx_gene_src_cellular_location
_entity_src_gen.host_org_common_name
_entity_src_gen.pdbx_host_org_scientific_name
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id
_entity_src_gen.host_org_genus
_entity_src_gen.pdbx_host_org_gene
_entity_src_gen.pdbx_host_org_organ
_entity_src_gen.host_org_species
_entity_src_gen.pdbx_host_org_tissue
_entity_src_gen.pdbx_host_org_tissue_fraction
_entity_src_gen.pdbx_host_org_strain
_entity_src_gen.pdbx_host_org_variant
_entity_src_gen.pdbx_host_org_cell_line
_entity_src_gen.pdbx_host_org_atcc
_entity_src_gen.pdbx_host_org_culture_collection
_entity_src_gen.pdbx_host_org_cell
_entity_src_gen.pdbx_host_org_organelle
_entity_src_gen.pdbx_host_org_cellular_location
_entity_src_gen.pdbx_host_org_vector_type
_entity_src_gen.pdbx_host_org_vector
_entity_src_gen.host_org_details
_entity_src_gen.expression_system_id
_entity_src_gen.plasmid_name
_entity_src_gen.plasmid_details
_entity_src_gen.pdbx_description
1 1 sample 'Biological sequence' 1 259 ? ? 'rfaP, waaP, PA5009' ? ? ? ? ? ? 'Pseudomonas aeruginosa' 287 ? ? ? ? ? ? ? ?
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?
2 1 sample 'Biological sequence' 1 72 ? ? acpP ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ?
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
G9S non-polymer .
'S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] hexadecanethioate' ? 'C27 H53 N2 O8 P S'
596.757
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 MSE 1 1 1 MSE MSE A . n
A 1 2 ARG 2 2 2 ARG ARG A . n
A 1 3 LEU 3 3 3 LEU LEU A . n
A 1 4 VAL 4 4 4 VAL VAL A . n
A 1 5 LEU 5 5 5 LEU LEU A . n
A 1 6 GLU 6 6 6 GLU GLU A . n
A 1 7 GLU 7 7 7 GLU GLU A . n
A 1 8 PRO 8 8 8 PRO PRO A . n
A 1 9 PHE 9 9 9 PHE PHE A . n
A 1 10 LYS 10 10 10 LYS LYS A . n
A 1 11 ARG 11 11 11 ARG ARG A . n
A 1 12 LEU 12 12 12 LEU LEU A . n
A 1 13 TRP 13 13 13 TRP TRP A . n
A 1 14 ASN 14 14 14 ASN ASN A . n
A 1 15 GLY 15 15 15 GLY GLY A . n
A 1 16 ARG 16 16 16 ARG ARG A . n
A 1 17 ASP 17 17 17 ASP ASP A . n
A 1 18 PRO 18 18 18 PRO PRO A . n
A 1 19 PHE 19 19 19 PHE PHE A . n
A 1 20 GLU 20 20 20 GLU GLU A . n
A 1 21 ALA 21 21 21 ALA ALA A . n
A 1 22 VAL 22 22 22 VAL VAL A . n
A 1 23 GLU 23 23 23 GLU GLU A . n
A 1 24 ALA 24 24 24 ALA ALA A . n
A 1 25 LEU 25 25 25 LEU LEU A . n
A 1 26 GLN 26 26 26 GLN GLN A . n
A 1 27 GLY 27 27 27 GLY GLY A . n
A 1 28 LYS 28 28 28 LYS LYS A . n
A 1 29 VAL 29 29 29 VAL VAL A . n
A 1 30 TYR 30 30 30 TYR TYR A . n
A 1 31 ARG 31 31 31 ARG ARG A . n
A 1 32 GLU 32 32 32 GLU GLU A . n
A 1 33 LEU 33 33 33 LEU LEU A . n
A 1 34 GLU 34 34 34 GLU GLU A . n
A 1 35 GLY 35 35 35 GLY GLY A . n
A 1 36 ARG 36 36 36 ARG ARG A . n
A 1 37 ARG 37 37 37 ARG ARG A . n
A 1 38 THR 38 38 38 THR THR A . n
A 1 39 LEU 39 39 39 LEU LEU A . n
A 1 40 ARG 40 40 40 ARG ARG A . n
A 1 41 THR 41 41 41 THR THR A . n
A 1 42 GLU 42 42 42 GLU GLU A . n
A 1 43 VAL 43 43 43 VAL VAL A . n
A 1 44 ASP 44 44 44 ASP ASP A . n
A 1 45 GLY 45 45 45 GLY GLY A . n
A 1 46 ARG 46 46 46 ARG ARG A . n
A 1 47 GLY 47 47 47 GLY GLY A . n
A 1 48 TYR 48 48 48 TYR TYR A . n
A 1 49 PHE 49 49 49 PHE PHE A . n
A 1 50 VAL 50 50 50 VAL VAL A . n
A 1 51 LYS 51 51 51 LYS LYS A . n
A 1 52 ILE 52 52 52 ILE ILE A . n
A 1 53 HIS 53 53 53 HIS HIS A . n
A 1 54 ARG 54 54 54 ARG ARG A . n
A 1 55 GLY 55 55 ? ? ? A . n
A 1 56 ILE 56 56 ? ? ? A . n
A 1 57 GLY 57 57 ? ? ? A . n
A 1 58 TRP 58 58 ? ? ? A . n
A 1 59 GLY 59 59 ? ? ? A . n
A 1 60 GLU 60 60 ? ? ? A . n
A 1 61 ILE 61 61 ? ? ? A . n
A 1 62 ALA 62 62 ? ? ? A . n
A 1 63 LYS 63 63 ? ? ? A . n
A 1 64 ASN 64 64 ? ? ? A . n
A 1 65 LEU 65 65 ? ? ? A . n
A 1 66 LEU 66 66 ? ? ? A . n
A 1 67 THR 67 67 ? ? ? A . n
A 1 68 ALA 68 68 ? ? ? A . n
A 1 69 LYS 69 69 ? ? ? A . n
A 1 70 LEU 70 70 ? ? ? A . n
A 1 71 PRO 71 71 ? ? ? A . n
A 1 72 VAL 72 72 ? ? ? A . n
A 1 73 LEU 73 73 73 LEU LEU A . n
A 1 74 GLY 74 74 74 GLY GLY A . n
A 1 75 ALA 75 75 75 ALA ALA A . n
A 1 76 ARG 76 76 76 ARG ARG A . n
A 1 77 GLN 77 77 77 GLN GLN A . n
A 1 78 GLU 78 78 78 GLU GLU A . n
A 1 79 TRP 79 79 79 TRP TRP A . n
A 1 80 GLN 80 80 80 GLN GLN A . n
A 1 81 ALA 81 81 81 ALA ALA A . n
A 1 82 ILE 82 82 82 ILE ILE A . n
A 1 83 ARG 83 83 83 ARG ARG A . n
A 1 84 ARG 84 84 84 ARG ARG A . n
A 1 85 LEU 85 85 85 LEU LEU A . n
A 1 86 HIS 86 86 86 HIS HIS A . n
A 1 87 GLU 87 87 87 GLU GLU A . n
A 1 88 ALA 88 88 88 ALA ALA A . n
A 1 89 GLY 89 89 89 GLY GLY A . n
A 1 90 VAL 90 90 90 VAL VAL A . n
A 1 91 ALA 91 91 91 ALA ALA A . n
A 1 92 THR 92 92 92 THR THR A . n
A 1 93 MSE 93 93 93 MSE MSE A . n
A 1 94 THR 94 94 94 THR THR A . n
A 1 95 ALA 95 95 95 ALA ALA A . n
A 1 96 VAL 96 96 96 VAL VAL A . n
A 1 97 ALA 97 97 97 ALA ALA A . n
A 1 98 TYR 98 98 98 TYR TYR A . n
A 1 99 GLY 99 99 99 GLY GLY A . n
A 1 100 GLU 100 100 100 GLU GLU A . n
A 1 101 ARG 101 101 101 ARG ARG A . n
A 1 102 GLY 102 102 102 GLY GLY A . n
A 1 103 SER 103 103 103 SER SER A . n
A 1 104 ASP 104 104 104 ASP ASP A . n
A 1 105 PRO 105 105 105 PRO PRO A . n
A 1 106 ALA 106 106 106 ALA ALA A . n
A 1 107 ARG 107 107 107 ARG ARG A . n
A 1 108 GLN 108 108 108 GLN GLN A . n
A 1 109 HIS 109 109 109 HIS HIS A . n
A 1 110 SER 110 110 110 SER SER A . n
A 1 111 PHE 111 111 111 PHE PHE A . n
A 1 112 ILE 112 112 112 ILE ILE A . n
A 1 113 VAL 113 113 113 VAL VAL A . n
A 1 114 THR 114 114 114 THR THR A . n
A 1 115 GLU 115 115 115 GLU GLU A . n
A 1 116 GLU 116 116 116 GLU GLU A . n
A 1 117 LEU 117 117 117 LEU LEU A . n
A 1 118 ALA 118 118 118 ALA ALA A . n
A 1 119 PRO 119 119 119 PRO PRO A . n
A 1 120 THR 120 120 120 THR THR A . n
A 1 121 VAL 121 121 121 VAL VAL A . n
A 1 122 ASP 122 122 122 ASP ASP A . n
A 1 123 LEU 123 123 123 LEU LEU A . n
A 1 124 GLU 124 124 124 GLU GLU A . n
A 1 125 VAL 125 125 125 VAL VAL A . n
A 1 126 PHE 126 126 126 PHE PHE A . n
A 1 127 SER 127 127 127 SER SER A . n
A 1 128 GLN 128 128 128 GLN GLN A . n
A 1 129 ASP 129 129 129 ASP ASP A . n
A 1 130 TRP 130 130 130 TRP TRP A . n
A 1 131 ARG 131 131 131 ARG ARG A . n
A 1 132 GLU 132 132 132 GLU GLU A . n
A 1 133 ARG 133 133 133 ARG ARG A . n
A 1 134 PRO 134 134 134 PRO PRO A . n
A 1 135 PRO 135 135 135 PRO PRO A . n
A 1 136 PRO 136 136 136 PRO PRO A . n
A 1 137 PRO 137 137 137 PRO PRO A . n
A 1 138 ARG 138 138 138 ARG ARG A . n
A 1 139 LEU 139 139 139 LEU LEU A . n
A 1 140 LYS 140 140 140 LYS LYS A . n
A 1 141 ARG 141 141 141 ARG ARG A . n
A 1 142 ALA 142 142 142 ALA ALA A . n
A 1 143 LEU 143 143 143 LEU LEU A . n
A 1 144 VAL 144 144 144 VAL VAL A . n
A 1 145 GLU 145 145 145 GLU GLU A . n
A 1 146 ALA 146 146 146 ALA ALA A . n
A 1 147 VAL 147 147 147 VAL VAL A . n
A 1 148 ALA 148 148 148 ALA ALA A . n
A 1 149 ARG 149 149 149 ARG ARG A . n
A 1 150 MSE 150 150 150 MSE MSE A . n
A 1 151 VAL 151 151 151 VAL VAL A . n
A 1 152 GLY 152 152 152 GLY GLY A . n
A 1 153 ASP 153 153 153 ASP ASP A . n
A 1 154 MSE 154 154 154 MSE MSE A . n
A 1 155 HIS 155 155 155 HIS HIS A . n
A 1 156 ARG 156 156 156 ARG ARG A . n
A 1 157 ALA 157 157 157 ALA ALA A . n
A 1 158 GLY 158 158 158 GLY GLY A . n
A 1 159 VAL 159 159 159 VAL VAL A . n
A 1 160 ASN 160 160 160 ASN ASN A . n
A 1 161 HIS 161 161 161 HIS HIS A . n
A 1 162 ARG 162 162 162 ARG ARG A . n
A 1 163 ASP 163 163 163 ASP ASP A . n
A 1 164 CYS 164 164 164 CYS CYS A . n
A 1 165 TYR 165 165 165 TYR TYR A . n
A 1 166 ILE 166 166 166 ILE ILE A . n
A 1 167 CYS 167 167 167 CYS CYS A . n
A 1 168 HIS 168 168 168 HIS HIS A . n
A 1 169 PHE 169 169 169 PHE PHE A . n
A 1 170 LEU 170 170 170 LEU LEU A . n
A 1 171 LEU 171 171 171 LEU LEU A . n
A 1 172 HIS 172 172 172 HIS HIS A . n
A 1 173 THR 173 173 173 THR THR A . n
A 1 174 ASP 174 174 174 ASP ASP A . n
A 1 175 LYS 175 175 175 LYS LYS A . n
A 1 176 PRO 176 176 176 PRO PRO A . n
A 1 177 VAL 177 177 177 VAL VAL A . n
A 1 178 SER 178 178 178 SER SER A . n
A 1 179 ALA 179 179 179 ALA ALA A . n
A 1 180 ASP 180 180 180 ASP ASP A . n
A 1 181 ASP 181 181 181 ASP ASP A . n
A 1 182 PHE 182 182 182 PHE PHE A . n
A 1 183 ARG 183 183 183 ARG ARG A . n
A 1 184 LEU 184 184 184 LEU LEU A . n
A 1 185 SER 185 185 185 SER SER A . n
A 1 186 VAL 186 186 186 VAL VAL A . n
A 1 187 ILE 187 187 187 ILE ILE A . n
A 1 188 ASP 188 188 188 ASP ASP A . n
A 1 189 LEU 189 189 189 LEU LEU A . n
A 1 190 HIS 190 190 190 HIS HIS A . n
A 1 191 ARG 191 191 191 ARG ARG A . n
A 1 192 ALA 192 192 192 ALA ALA A . n
A 1 193 GLN 193 193 193 GLN GLN A . n
A 1 194 THR 194 194 194 THR THR A . n
A 1 195 ARG 195 195 195 ARG ARG A . n
A 1 196 ASP 196 196 196 ASP ASP A . n
A 1 197 ALA 197 197 197 ALA ALA A . n
A 1 198 THR 198 198 198 THR THR A . n
A 1 199 PRO 199 199 199 PRO PRO A . n
A 1 200 LYS 200 200 200 LYS LYS A . n
A 1 201 ARG 201 201 201 ARG ARG A . n
A 1 202 TRP 202 202 202 TRP TRP A . n
A 1 203 ARG 203 203 203 ARG ARG A . n
A 1 204 ASN 204 204 204 ASN ASN A . n
A 1 205 LYS 205 205 205 LYS LYS A . n
A 1 206 ASP 206 206 206 ASP ASP A . n
A 1 207 LEU 207 207 207 LEU LEU A . n
A 1 208 ALA 208 208 208 ALA ALA A . n
A 1 209 ALA 209 209 209 ALA ALA A . n
A 1 210 LEU 210 210 210 LEU LEU A . n
A 1 211 TYR 211 211 211 TYR TYR A . n
A 1 212 PHE 212 212 212 PHE PHE A . n
A 1 213 SER 213 213 213 SER SER A . n
A 1 214 ALA 214 214 214 ALA ALA A . n
A 1 215 LEU 215 215 215 LEU LEU A . n
A 1 216 ASP 216 216 216 ASP ASP A . n
A 1 217 ILE 217 217 217 ILE ILE A . n
A 1 218 GLY 218 218 218 GLY GLY A . n
A 1 219 LEU 219 219 219 LEU LEU A . n
A 1 220 THR 220 220 220 THR THR A . n
A 1 221 ARG 221 221 221 ARG ARG A . n
A 1 222 ARG 222 222 222 ARG ARG A . n
A 1 223 ASP 223 223 223 ASP ASP A . n
A 1 224 LYS 224 224 224 LYS LYS A . n
A 1 225 LEU 225 225 225 LEU LEU A . n
A 1 226 ARG 226 226 226 ARG ARG A . n
A 1 227 PHE 227 227 227 PHE PHE A . n
A 1 228 LEU 228 228 228 LEU LEU A . n
A 1 229 ARG 229 229 229 ARG ARG A . n
A 1 230 THR 230 230 230 THR THR A . n
A 1 231 TYR 231 231 231 TYR TYR A . n
A 1 232 PHE 232 232 232 PHE PHE A . n
A 1 233 ARG 233 233 233 ARG ARG A . n
A 1 234 ARG 234 234 234 ARG ARG A . n
A 1 235 PRO 235 235 235 PRO PRO A . n
A 1 236 LEU 236 236 236 LEU LEU A . n
A 1 237 ARG 237 237 237 ARG ARG A . n
A 1 238 GLU 238 238 238 GLU GLU A . n
A 1 239 ILE 239 239 239 ILE ILE A . n
A 1 240 LEU 240 240 240 LEU LEU A . n
A 1 241 ARG 241 241 241 ARG ARG A . n
A 1 242 ASP 242 242 242 ASP ASP A . n
A 1 243 GLU 243 243 243 GLU GLU A . n
A 1 244 ALA 244 244 244 ALA ALA A . n
A 1 245 GLY 245 245 245 GLY GLY A . n
A 1 246 LEU 246 246 246 LEU LEU A . n
A 1 247 LEU 247 247 247 LEU LEU A . n
A 1 248 ALA 248 248 248 ALA ALA A . n
A 1 249 TRP 249 249 249 TRP TRP A . n
A 1 250 MSE 250 250 250 MSE MSE A . n
A 1 251 GLU 251 251 251 GLU GLU A . n
A 1 252 ARG 252 252 252 ARG ARG A . n
A 1 253 LYS 253 253 253 LYS LYS A . n
A 1 254 ALA 254 254 254 ALA ALA A . n
A 1 255 GLU 255 255 255 GLU GLU A . n
A 1 256 LYS 256 256 256 LYS LYS A . n
A 1 257 LEU 257 257 257 LEU LEU A . n
A 1 258 TYR 258 258 258 TYR TYR A . n
A 1 259 GLU 259 259 259 GLU GLU A . n
B 2 1 THR 1 2 2 THR THR B . n
B 2 2 ILE 2 3 3 ILE ILE B . n
B 2 3 GLU 3 4 4 GLU GLU B . n
B 2 4 GLU 4 5 5 GLU GLU B . n
B 2 5 ARG 5 6 6 ARG ARG B . n
B 2 6 VAL 6 7 7 VAL VAL B . n
B 2 7 LYS 7 8 8 LYS LYS B . n
B 2 8 LYS 8 9 9 LYS LYS B . n
B 2 9 ILE 9 10 10 ILE ILE B . n
B 2 10 ILE 10 11 11 ILE ILE B . n
B 2 11 GLY 11 12 12 GLY GLY B . n
B 2 12 GLU 12 13 13 GLU GLU B . n
B 2 13 GLN 13 14 14 GLN GLN B . n
B 2 14 LEU 14 15 15 LEU LEU B . n
B 2 15 GLY 15 16 16 GLY GLY B . n
B 2 16 VAL 16 17 17 VAL VAL B . n
B 2 17 LYS 17 18 18 LYS LYS B . n
B 2 18 GLN 18 19 19 GLN GLN B . n
B 2 19 GLU 19 20 20 GLU GLU B . n
B 2 20 GLU 20 21 21 GLU GLU B . n
B 2 21 VAL 21 22 22 VAL VAL B . n
B 2 22 THR 22 23 23 THR THR B . n
B 2 23 ASN 23 24 24 ASN ASN B . n
B 2 24 ASN 24 25 25 ASN ASN B . n
B 2 25 ALA 25 26 26 ALA ALA B . n
B 2 26 SER 26 27 27 SER SER B . n
B 2 27 PHE 27 28 28 PHE PHE B . n
B 2 28 VAL 28 29 29 VAL VAL B . n
B 2 29 GLU 29 30 30 GLU GLU B . n
B 2 30 ASP 30 31 31 ASP ASP B . n
B 2 31 LEU 31 32 32 LEU LEU B . n
B 2 32 GLY 32 33 33 GLY GLY B . n
B 2 33 ALA 33 34 34 ALA ALA B . n
B 2 34 ASP 34 35 35 ASP ASP B . n
B 2 35 SER 35 36 36 SER SPP B . n
B 2 36 LEU 36 37 37 LEU LEU B . n
B 2 37 ASP 37 38 38 ASP ASP B . n
B 2 38 THR 38 39 39 THR THR B . n
B 2 39 VAL 39 40 40 VAL VAL B . n
B 2 40 GLU 40 41 41 GLU GLU B . n
B 2 41 LEU 41 42 42 LEU LEU B . n
B 2 42 VAL 42 43 43 VAL VAL B . n
B 2 43 MSE 43 44 44 MSE MSE B . n
B 2 44 ALA 44 45 45 ALA ALA B . n
B 2 45 LEU 45 46 46 LEU LEU B . n
B 2 46 GLU 46 47 47 GLU GLU B . n
B 2 47 GLU 47 48 48 GLU GLU B . n
B 2 48 GLU 48 49 49 GLU GLU B . n
B 2 49 PHE 49 50 50 PHE PHE B . n
B 2 50 ASP 50 51 51 ASP ASP B . n
B 2 51 THR 51 52 52 THR THR B . n
B 2 52 GLU 52 53 53 GLU GLU B . n
B 2 53 ILE 53 54 54 ILE ILE B . n
B 2 54 PRO 54 55 55 PRO PRO B . n
B 2 55 ASP 55 56 56 ASP ASP B . n
B 2 56 GLU 56 57 57 GLU GLU B . n
B 2 57 GLU 57 58 58 GLU GLU B . n
B 2 58 ALA 58 59 59 ALA ALA B . n
B 2 59 GLU 59 60 60 GLU GLU B . n
B 2 60 LYS 60 61 61 LYS LYS B . n
B 2 61 ILE 61 62 62 ILE ILE B . n
B 2 62 THR 62 63 63 THR THR B . n
B 2 63 THR 63 64 64 THR THR B . n
B 2 64 VAL 64 65 65 VAL VAL B . n
B 2 65 GLN 65 66 66 GLN GLN B . n
B 2 66 ALA 66 67 67 ALA ALA B . n
B 2 67 ALA 67 68 68 ALA ALA B . n
B 2 68 ILE 68 69 69 ILE ILE B . n
B 2 69 ASP 69 70 70 ASP ASP B . n
B 2 70 TYR 70 71 71 TYR TYR B . n
B 2 71 ILE 71 72 72 ILE ILE B . n
B 2 72 ASN 72 73 73 ASN ASN B . n
#
_pdbx_nonpoly_scheme.asym_id C
_pdbx_nonpoly_scheme.entity_id 3
_pdbx_nonpoly_scheme.mon_id G9S
_pdbx_nonpoly_scheme.ndb_seq_num 1
_pdbx_nonpoly_scheme.pdb_seq_num 101
_pdbx_nonpoly_scheme.auth_seq_num 36
_pdbx_nonpoly_scheme.pdb_mon_id G9S
_pdbx_nonpoly_scheme.auth_mon_id SPP
_pdbx_nonpoly_scheme.pdb_strand_id B
_pdbx_nonpoly_scheme.pdb_ins_code .
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ?
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 1
? 'data scaling' ? ? 'Phil Evans' ? ? ? ? ? ?
http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program . 2
? phasing ? ? 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de ? ? ? ? Fortran_77
http://shelx.uni-ac.gwdg.de/SHELX/ ? SHELX ? ? package . 3
? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++
http://www.phenix-online.org/ ? PHENIX ? ? package 1.13_2998 4
? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 90.000
_cell.angle_beta_esd ?
_cell.angle_gamma 120.000
_cell.angle_gamma_esd ?
_cell.entry_id 6DFL
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 92.023
_cell.length_a_esd ?
_cell.length_b 92.023
_cell.length_b_esd ?
_cell.length_c 99.172
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 6
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 6DFL
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 152
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'P 31 2 1'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 6DFL
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 3.12
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 60.53
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH ?
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 277
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '100mM HEPES pH 7.4, 5% Jeffamine M-600'
_exptl_crystal_grow.pdbx_pH_range ?
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 77
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
#
_diffrn_detector.details ?
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS PILATUS3 6M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2008-09-25
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.9791
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'SLS BEAMLINE X10SA'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.9791
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline X10SA
_diffrn_source.pdbx_synchrotron_site SLS
#
_reflns.B_iso_Wilson_estimate 70.650
_reflns.entry_id 6DFL
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 2.396
_reflns.d_resolution_low 79.694
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 19544
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 100.000
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 19.700
_reflns.pdbx_Rmerge_I_obs 0.066
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 32.700
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all 0.068
_reflns.pdbx_Rpim_I_all 0.015
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all 384314
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 0.999
_reflns.pdbx_R_split ?
#
loop_
_reflns_shell.d_res_high
_reflns_shell.d_res_low
_reflns_shell.meanI_over_sigI_all
_reflns_shell.meanI_over_sigI_obs
_reflns_shell.number_measured_all
_reflns_shell.number_measured_obs
_reflns_shell.number_possible
_reflns_shell.number_unique_all
_reflns_shell.number_unique_obs
_reflns_shell.percent_possible_all
_reflns_shell.percent_possible_obs
_reflns_shell.Rmerge_F_all
_reflns_shell.Rmerge_F_obs
_reflns_shell.Rmerge_I_all
_reflns_shell.Rmerge_I_obs
_reflns_shell.meanI_over_sigI_gt
_reflns_shell.meanI_over_uI_all
_reflns_shell.meanI_over_uI_gt
_reflns_shell.number_measured_gt
_reflns_shell.number_unique_gt
_reflns_shell.percent_possible_gt
_reflns_shell.Rmerge_F_gt
_reflns_shell.Rmerge_I_gt
_reflns_shell.pdbx_redundancy
_reflns_shell.pdbx_Rsym_value
_reflns_shell.pdbx_chi_squared
_reflns_shell.pdbx_netI_over_sigmaI_all
_reflns_shell.pdbx_netI_over_sigmaI_obs
_reflns_shell.pdbx_Rrim_I_all
_reflns_shell.pdbx_Rpim_I_all
_reflns_shell.pdbx_rejects
_reflns_shell.pdbx_ordinal
_reflns_shell.pdbx_diffrn_id
_reflns_shell.pdbx_CC_half
_reflns_shell.pdbx_R_split
2.396 2.404 ? ? ? ? ? ? 222 100.000 ? ? ? ? 1.340 ? ? ? ? ? ? ? ? 20.300 ? ? ? ? 1.374 0.303 ? 1 1 0.927 ?
11.111 79.694 ? ? ? ? ? ? 230 99.100 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 16.300 ? ? ? ? 0.051 0.012 ? 2 1 0.999 ?
#
_refine.aniso_B[1][1] ?
_refine.aniso_B[1][2] ?
_refine.aniso_B[1][3] ?
_refine.aniso_B[2][2] ?
_refine.aniso_B[2][3] ?
_refine.aniso_B[3][3] ?
_refine.B_iso_max 145.720
_refine.B_iso_mean 87.8044
_refine.B_iso_min 54.660
_refine.correlation_coeff_Fo_to_Fc ?
_refine.correlation_coeff_Fo_to_Fc_free ?
_refine.details ?
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 6DFL
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 2.3960
_refine.ls_d_res_low 62.1220
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 19486
_refine.ls_number_reflns_R_free 945
_refine.ls_number_reflns_R_work ?
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 99.6400
_refine.ls_percent_reflns_R_free 4.8500
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.2350
_refine.ls_R_factor_R_free 0.2693
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.2332
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details ?
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 1.340
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.pdbx_method_to_determine_struct SAD
_refine.pdbx_starting_model ?
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details ?
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free ?
_refine.pdbx_solvent_vdw_probe_radii 1.1100
_refine.pdbx_solvent_ion_probe_radii ?
_refine.pdbx_solvent_shrinkage_radii 0.9000
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error 36.2300
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B ?
_refine.overall_SU_ML 0.3400
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_hist.cycle_id final
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.d_res_high 2.3960
_refine_hist.d_res_low 62.1220
_refine_hist.pdbx_number_atoms_ligand 0
_refine_hist.number_atoms_solvent 0
_refine_hist.number_atoms_total 2599
_refine_hist.pdbx_number_residues_total 313
_refine_hist.pdbx_number_atoms_protein 2599
_refine_hist.pdbx_number_atoms_nucleic_acid 0
#
loop_
_refine_ls_shell.pdbx_refine_id
_refine_ls_shell.d_res_high
_refine_ls_shell.d_res_low
_refine_ls_shell.number_reflns_all
_refine_ls_shell.number_reflns_obs
_refine_ls_shell.number_reflns_R_free
_refine_ls_shell.number_reflns_R_work
_refine_ls_shell.percent_reflns_obs
_refine_ls_shell.percent_reflns_R_free
_refine_ls_shell.R_factor_all
_refine_ls_shell.R_factor_obs
_refine_ls_shell.R_factor_R_free
_refine_ls_shell.R_factor_R_free_error
_refine_ls_shell.R_factor_R_work
_refine_ls_shell.redundancy_reflns_all
_refine_ls_shell.redundancy_reflns_obs
_refine_ls_shell.wR_factor_all
_refine_ls_shell.wR_factor_obs
_refine_ls_shell.wR_factor_R_free
_refine_ls_shell.wR_factor_R_work
_refine_ls_shell.pdbx_total_number_of_bins_used
_refine_ls_shell.pdbx_phase_error
_refine_ls_shell.pdbx_fsc_work
_refine_ls_shell.pdbx_fsc_free
'X-RAY DIFFRACTION' 2.3960 2.5223 2734 . 131 2603 99.0000 . . . 0.4239 0.0000 0.3422 . . . . . . 7 . . .
'X-RAY DIFFRACTION' 2.5223 2.6804 2753 . 117 2636 99.0000 . . . 0.3516 0.0000 0.3326 . . . . . . 7 . . .
'X-RAY DIFFRACTION' 2.6804 2.8873 2756 . 128 2628 100.0000 . . . 0.3812 0.0000 0.3079 . . . . . . 7 . . .
'X-RAY DIFFRACTION' 2.8873 3.1779 2741 . 134 2607 99.0000 . . . 0.3152 0.0000 0.2901 . . . . . . 7 . . .
'X-RAY DIFFRACTION' 3.1779 3.6377 2775 . 155 2620 100.0000 . . . 0.3639 0.0000 0.2655 . . . . . . 7 . . .
'X-RAY DIFFRACTION' 3.6377 4.5829 2793 . 133 2660 100.0000 . . . 0.2513 0.0000 0.2179 . . . . . . 7 . . .
'X-RAY DIFFRACTION' 4.5829 62.1425 2934 . 147 2787 100.0000 . . . 0.2111 0.0000 0.1957 . . . . . . 7 . . .
#
_struct.entry_id 6DFL
_struct.title 'WaaP in complex with acyl carrier protein'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 6DFL
_struct_keywords.text 'Bacterial sugar kinase, HYDROLASE'
_struct_keywords.pdbx_keywords HYDROLASE
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
#
loop_
_struct_ref.id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_db_isoform
_struct_ref.entity_id
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.pdbx_align_begin
1 UNP RFAP_PSEAE Q9HUF7 ? 1
;RLVLEEPFKRLWNGRDPFEAVEALQGKVYRELEGRRTLRTEVDGRGYFVKIHRGIGWGEIAKNLLTAKLPVLGARQEWQA
IRRLHEAGVATMTAVAYGERGSDPARQHSFIVTEELAPTVDLEVFSQDWRERPPPPRLKRALVEAVARMVGDMHRAGVNH
RDCYICHFLLHTDKPVSADDFRLSVIDLHRAQTRDATPKRWRNKDLAALYFSALDIGLTRRDKLRFLRTYFRRPLREILR
DEAGLLAWMERKAEKLYE
;
2
2 UNP ACP_ECO45 B7MJ81 ? 2 TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYIN 3
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.pdbx_PDB_id_code
_struct_ref_seq.pdbx_strand_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.pdbx_seq_align_beg_ins_code
_struct_ref_seq.seq_align_end
_struct_ref_seq.pdbx_seq_align_end_ins_code
_struct_ref_seq.pdbx_db_accession
_struct_ref_seq.db_align_beg
_struct_ref_seq.pdbx_db_align_beg_ins_code
_struct_ref_seq.db_align_end
_struct_ref_seq.pdbx_db_align_end_ins_code
_struct_ref_seq.pdbx_auth_seq_align_beg
_struct_ref_seq.pdbx_auth_seq_align_end
1 1 6DFL A 2 ? 259 ? Q9HUF7 2 ? 259 ? 2 259
2 2 6DFL B 1 ? 72 ? B7MJ81 3 ? 74 ? 2 73
#
_struct_ref_seq_dif.align_id 1
_struct_ref_seq_dif.pdbx_pdb_id_code 6DFL
_struct_ref_seq_dif.mon_id MSE
_struct_ref_seq_dif.pdbx_pdb_strand_id A
_struct_ref_seq_dif.seq_num 1
_struct_ref_seq_dif.pdbx_pdb_ins_code ?
_struct_ref_seq_dif.pdbx_seq_db_name UNP
_struct_ref_seq_dif.pdbx_seq_db_accession_code Q9HUF7
_struct_ref_seq_dif.db_mon_id ?
_struct_ref_seq_dif.pdbx_seq_db_seq_num ?
_struct_ref_seq_dif.details 'initiating methionine'
_struct_ref_seq_dif.pdbx_auth_seq_num 1
_struct_ref_seq_dif.pdbx_ordinal 1
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_and_software_defined_assembly
_pdbx_struct_assembly.method_details PISA
_pdbx_struct_assembly.oligomeric_details dimeric
_pdbx_struct_assembly.oligomeric_count 2
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 2300 ?
1 MORE -4 ?
1 'SSA (A^2)' 16530 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B,C
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration'
_pdbx_struct_assembly_auth_evidence.details ?
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 PRO A 8 ? TRP A 13 ? PRO A 8 TRP A 13 1 ? 6
HELX_P HELX_P2 AA2 ASP A 17 ? LEU A 25 ? ASP A 17 LEU A 25 1 ? 9
HELX_P HELX_P3 AA3 ALA A 75 ? ALA A 88 ? ALA A 75 ALA A 88 1 ? 14
HELX_P HELX_P4 AA4 LEU A 123 ? GLN A 128 ? LEU A 123 GLN A 128 1 ? 6
HELX_P HELX_P5 AA5 PRO A 136 ? ALA A 157 ? PRO A 136 ALA A 157 1 ? 22
HELX_P HELX_P6 AA6 TYR A 165 ? CYS A 167 ? TYR A 165 CYS A 167 5 ? 3
HELX_P HELX_P7 AA7 PRO A 199 ? SER A 213 ? PRO A 199 SER A 213 1 ? 15
HELX_P HELX_P8 AA8 THR A 220 ? ARG A 233 ? THR A 220 ARG A 233 1 ? 14
HELX_P HELX_P9 AA9 PRO A 235 ? GLU A 243 ? PRO A 235 GLU A 243 1 ? 9
HELX_P HELX_P10 AB1 GLU A 243 ? TYR A 258 ? GLU A 243 TYR A 258 1 ? 16
HELX_P HELX_P11 AB2 ILE B 2 ? GLY B 15 ? ILE B 3 GLY B 16 1 ? 14
HELX_P HELX_P12 AB3 LYS B 17 ? VAL B 21 ? LYS B 18 VAL B 22 5 ? 5
HELX_P HELX_P13 AB4 ASP B 34 ? PHE B 49 ? ASP B 35 PHE B 50 1 ? 16
HELX_P HELX_P14 AB5 PRO B 54 ? GLU B 59 ? PRO B 55 GLU B 60 1 ? 6
HELX_P HELX_P15 AB6 THR B 63 ? ASN B 72 ? THR B 64 ASN B 73 1 ? 10
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
_struct_conn.pdbx_role
covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ARG 2 N ? ? A MSE 1 A ARG 2 1_555 ? ? ? ? ? ? ? 1.327 ? ?
covale2 covale both ? A THR 92 C ? ? ? 1_555 A MSE 93 N ? ? A THR 92 A MSE 93 1_555 ? ? ? ? ? ? ? 1.333 ? ?
covale3 covale both ? A MSE 93 C ? ? ? 1_555 A THR 94 N ? ? A MSE 93 A THR 94 1_555 ? ? ? ? ? ? ? 1.320 ? ?
covale4 covale both ? A ARG 149 C ? ? ? 1_555 A MSE 150 N ? ? A ARG 149 A MSE 150 1_555 ? ? ? ? ? ? ? 1.331 ? ?
covale5 covale both ? A MSE 150 C ? ? ? 1_555 A VAL 151 N ? ? A MSE 150 A VAL 151 1_555 ? ? ? ? ? ? ? 1.331 ? ?
covale6 covale both ? A ASP 153 C ? ? ? 1_555 A MSE 154 N ? ? A ASP 153 A MSE 154 1_555 ? ? ? ? ? ? ? 1.327 ? ?
covale7 covale both ? A MSE 154 C ? ? ? 1_555 A HIS 155 N ? ? A MSE 154 A HIS 155 1_555 ? ? ? ? ? ? ? 1.335 ? ?
covale8 covale both ? A TRP 249 C ? ? ? 1_555 A MSE 250 N ? ? A TRP 249 A MSE 250 1_555 ? ? ? ? ? ? ? 1.336 ? ?
covale9 covale both ? A MSE 250 C ? ? ? 1_555 A GLU 251 N ? ? A MSE 250 A GLU 251 1_555 ? ? ? ? ? ? ? 1.328 ? ?
covale10 covale one ? B SER 35 OG ? ? ? 1_555 C G9S . P1 ? ? B SER 36 B G9S 101 1_555 ? ? ? ? ? ? ? 1.561 ? ?
covale11 covale both ? B VAL 42 C ? ? ? 1_555 B MSE 43 N ? ? B VAL 43 B MSE 44 1_555 ? ? ? ? ? ? ? 1.324 ? ?
covale12 covale both ? B MSE 43 C ? ? ? 1_555 B ALA 44 N ? ? B MSE 44 B ALA 45 1_555 ? ? ? ? ? ? ? 1.341 ? ?
#
_struct_conn_type.id covale
_struct_conn_type.criteria ?
_struct_conn_type.reference ?
#
loop_
_pdbx_modification_feature.ordinal
_pdbx_modification_feature.label_comp_id
_pdbx_modification_feature.label_asym_id
_pdbx_modification_feature.label_seq_id
_pdbx_modification_feature.label_alt_id
_pdbx_modification_feature.modified_residue_label_comp_id
_pdbx_modification_feature.modified_residue_label_asym_id
_pdbx_modification_feature.modified_residue_label_seq_id
_pdbx_modification_feature.modified_residue_label_alt_id
_pdbx_modification_feature.auth_comp_id
_pdbx_modification_feature.auth_asym_id
_pdbx_modification_feature.auth_seq_id
_pdbx_modification_feature.PDB_ins_code
_pdbx_modification_feature.symmetry
_pdbx_modification_feature.modified_residue_auth_comp_id
_pdbx_modification_feature.modified_residue_auth_asym_id
_pdbx_modification_feature.modified_residue_auth_seq_id
_pdbx_modification_feature.modified_residue_PDB_ins_code
_pdbx_modification_feature.modified_residue_symmetry
_pdbx_modification_feature.comp_id_linking_atom
_pdbx_modification_feature.modified_residue_id_linking_atom
_pdbx_modification_feature.modified_residue_id
_pdbx_modification_feature.ref_pcm_id
_pdbx_modification_feature.ref_comp_id
_pdbx_modification_feature.type
_pdbx_modification_feature.category
1 MSE A 1 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification'
2 MSE A 93 ? . . . . MSE A 93 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification'
3 MSE A 150 ? . . . . MSE A 150 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification'
4 MSE A 154 ? . . . . MSE A 154 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification'
5 MSE A 250 ? . . . . MSE A 250 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification'
6 MSE B 43 ? . . . . MSE B 44 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification'
7 G9S C . ? SER B 35 ? G9S B 101 ? 1_555 SER B 36 ? 1_555 P1 OG SER 1 G9S None 'Covalent chemical modification'
#
loop_
_struct_mon_prot_cis.pdbx_id
_struct_mon_prot_cis.label_comp_id
_struct_mon_prot_cis.label_seq_id
_struct_mon_prot_cis.label_asym_id
_struct_mon_prot_cis.label_alt_id
_struct_mon_prot_cis.pdbx_PDB_ins_code
_struct_mon_prot_cis.auth_comp_id
_struct_mon_prot_cis.auth_seq_id
_struct_mon_prot_cis.auth_asym_id
_struct_mon_prot_cis.pdbx_label_comp_id_2
_struct_mon_prot_cis.pdbx_label_seq_id_2
_struct_mon_prot_cis.pdbx_label_asym_id_2
_struct_mon_prot_cis.pdbx_PDB_ins_code_2
_struct_mon_prot_cis.pdbx_auth_comp_id_2
_struct_mon_prot_cis.pdbx_auth_seq_id_2
_struct_mon_prot_cis.pdbx_auth_asym_id_2
_struct_mon_prot_cis.pdbx_PDB_model_num
_struct_mon_prot_cis.pdbx_omega_angle
1 GLU 7 A . ? GLU 7 A PRO 8 A ? PRO 8 A 1 6.79
2 ALA 118 A . ? ALA 118 A PRO 119 A ? PRO 119 A 1 0.01
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 5 ?
AA2 ? 3 ?
AA3 ? 2 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA1 3 4 ? anti-parallel
AA1 4 5 ? anti-parallel
AA2 1 2 ? anti-parallel
AA2 2 3 ? anti-parallel
AA3 1 2 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 ARG A 2 ? LEU A 5 ? ARG A 2 LEU A 5
AA1 2 ALA A 95 ? ARG A 101 ? ALA A 95 ARG A 101
AA1 3 HIS A 109 ? GLU A 115 ? HIS A 109 GLU A 115
AA1 4 TYR A 48 ? HIS A 53 ? TYR A 48 HIS A 53
AA1 5 ARG A 37 ? THR A 41 ? ARG A 37 THR A 41
AA2 1 THR A 120 ? ASP A 122 ? THR A 120 ASP A 122
AA2 2 PHE A 169 ? HIS A 172 ? PHE A 169 HIS A 172
AA2 3 LEU A 184 ? VAL A 186 ? LEU A 184 VAL A 186
AA3 1 VAL A 159 ? ASN A 160 ? VAL A 159 ASN A 160
AA3 2 GLN A 193 ? THR A 194 ? GLN A 193 THR A 194
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N ARG A 2 ? N ARG A 2 O GLU A 100 ? O GLU A 100
AA1 2 3 N ARG A 101 ? N ARG A 101 O HIS A 109 ? O HIS A 109
AA1 3 4 O THR A 114 ? O THR A 114 N PHE A 49 ? N PHE A 49
AA1 4 5 O VAL A 50 ? O VAL A 50 N LEU A 39 ? N LEU A 39
AA2 1 2 N VAL A 121 ? N VAL A 121 O LEU A 171 ? O LEU A 171
AA2 2 3 N LEU A 170 ? N LEU A 170 O SER A 185 ? O SER A 185
AA3 1 2 N ASN A 160 ? N ASN A 160 O GLN A 193 ? O GLN A 193
#
_struct_site.id AC1
_struct_site.pdbx_evidence_code Software
_struct_site.pdbx_auth_asym_id B
_struct_site.pdbx_auth_comp_id G9S
_struct_site.pdbx_auth_seq_id 101
_struct_site.pdbx_auth_ins_code ?
_struct_site.pdbx_num_residues 9
_struct_site.details 'binding site for residue G9S B 101'
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 9 TYR A 211 ? TYR A 211 . ? 1_555 ?
2 AC1 9 ARG A 221 ? ARG A 221 . ? 1_555 ?
3 AC1 9 LEU A 225 ? LEU A 225 . ? 1_555 ?
4 AC1 9 PHE A 227 ? PHE A 227 . ? 1_555 ?
5 AC1 9 LEU A 228 ? LEU A 228 . ? 1_555 ?
6 AC1 9 LEU A 247 ? LEU A 247 . ? 1_555 ?
7 AC1 9 MSE A 250 ? MSE A 250 . ? 1_555 ?
8 AC1 9 GLU A 251 ? GLU A 251 . ? 1_555 ?
9 AC1 9 SER B 35 ? SER B 36 . ? 1_555 ?
#
_pdbx_entry_details.entry_id 6DFL
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.has_ligand_of_interest ?
_pdbx_entry_details.has_protein_modification Y
#
_pdbx_validate_close_contact.id 1
_pdbx_validate_close_contact.PDB_model_num 1
_pdbx_validate_close_contact.auth_atom_id_1 OH
_pdbx_validate_close_contact.auth_asym_id_1 A
_pdbx_validate_close_contact.auth_comp_id_1 TYR
_pdbx_validate_close_contact.auth_seq_id_1 98
_pdbx_validate_close_contact.PDB_ins_code_1 ?
_pdbx_validate_close_contact.label_alt_id_1 ?
_pdbx_validate_close_contact.auth_atom_id_2 OE2
_pdbx_validate_close_contact.auth_asym_id_2 A
_pdbx_validate_close_contact.auth_comp_id_2 GLU
_pdbx_validate_close_contact.auth_seq_id_2 100
_pdbx_validate_close_contact.PDB_ins_code_2 ?
_pdbx_validate_close_contact.label_alt_id_2 ?
_pdbx_validate_close_contact.dist 2.12
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 ASN A 14 ? ? -64.76 -75.38
2 1 TYR A 30 ? ? -126.01 -135.00
3 1 GLU A 32 ? ? -118.33 52.58
4 1 GLU A 34 ? ? 54.19 85.77
5 1 ARG A 37 ? ? -173.22 138.99
6 1 ARG A 107 ? ? -102.40 77.16
7 1 GLN A 128 ? ? -24.96 -51.14
8 1 ARG A 133 ? ? -116.18 73.85
9 1 ARG A 162 ? ? 87.45 -21.22
10 1 ILE A 187 ? ? -128.09 -166.23
11 1 ASP A 188 ? ? 35.65 87.49
12 1 SER B 36 ? ? -19.03 -69.92
#
loop_
_pdbx_struct_mod_residue.id
_pdbx_struct_mod_residue.label_asym_id
_pdbx_struct_mod_residue.label_comp_id
_pdbx_struct_mod_residue.label_seq_id
_pdbx_struct_mod_residue.auth_asym_id
_pdbx_struct_mod_residue.auth_comp_id
_pdbx_struct_mod_residue.auth_seq_id
_pdbx_struct_mod_residue.PDB_ins_code
_pdbx_struct_mod_residue.parent_comp_id
_pdbx_struct_mod_residue.details
1 A MSE 93 A MSE 93 ? MET 'modified residue'
2 A MSE 150 A MSE 150 ? MET 'modified residue'
3 A MSE 154 A MSE 154 ? MET 'modified residue'
4 A MSE 250 A MSE 250 ? MET 'modified residue'
5 B MSE 43 B MSE 44 ? MET 'modified residue'
#
_phasing.method SAD
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A GLY 55 ? A GLY 55
2 1 Y 1 A ILE 56 ? A ILE 56
3 1 Y 1 A GLY 57 ? A GLY 57
4 1 Y 1 A TRP 58 ? A TRP 58
5 1 Y 1 A GLY 59 ? A GLY 59
6 1 Y 1 A GLU 60 ? A GLU 60
7 1 Y 1 A ILE 61 ? A ILE 61
8 1 Y 1 A ALA 62 ? A ALA 62
9 1 Y 1 A LYS 63 ? A LYS 63
10 1 Y 1 A ASN 64 ? A ASN 64
11 1 Y 1 A LEU 65 ? A LEU 65
12 1 Y 1 A LEU 66 ? A LEU 66
13 1 Y 1 A THR 67 ? A THR 67
14 1 Y 1 A ALA 68 ? A ALA 68
15 1 Y 1 A LYS 69 ? A LYS 69
16 1 Y 1 A LEU 70 ? A LEU 70
17 1 Y 1 A PRO 71 ? A PRO 71
18 1 Y 1 A VAL 72 ? A VAL 72
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
ALA N N N N 1
ALA CA C N S 2
ALA C C N N 3
ALA O O N N 4
ALA CB C N N 5
ALA OXT O N N 6
ALA H H N N 7
ALA H2 H N N 8
ALA HA H N N 9
ALA HB1 H N N 10
ALA HB2 H N N 11
ALA HB3 H N N 12
ALA HXT H N N 13
ARG N N N N 14
ARG CA C N S 15
ARG C C N N 16
ARG O O N N 17
ARG CB C N N 18
ARG CG C N N 19
ARG CD C N N 20
ARG NE N N N 21
ARG CZ C N N 22
ARG NH1 N N N 23
ARG NH2 N N N 24
ARG OXT O N N 25
ARG H H N N 26
ARG H2 H N N 27
ARG HA H N N 28
ARG HB2 H N N 29
ARG HB3 H N N 30
ARG HG2 H N N 31
ARG HG3 H N N 32
ARG HD2 H N N 33
ARG HD3 H N N 34
ARG HE H N N 35
ARG HH11 H N N 36
ARG HH12 H N N 37
ARG HH21 H N N 38
ARG HH22 H N N 39
ARG HXT H N N 40
ASN N N N N 41
ASN CA C N S 42
ASN C C N N 43
ASN O O N N 44
ASN CB C N N 45
ASN CG C N N 46
ASN OD1 O N N 47
ASN ND2 N N N 48
ASN OXT O N N 49
ASN H H N N 50
ASN H2 H N N 51
ASN HA H N N 52
ASN HB2 H N N 53
ASN HB3 H N N 54
ASN HD21 H N N 55
ASN HD22 H N N 56
ASN HXT H N N 57
ASP N N N N 58
ASP CA C N S 59
ASP C C N N 60
ASP O O N N 61
ASP CB C N N 62
ASP CG C N N 63
ASP OD1 O N N 64
ASP OD2 O N N 65
ASP OXT O N N 66
ASP H H N N 67
ASP H2 H N N 68
ASP HA H N N 69
ASP HB2 H N N 70
ASP HB3 H N N 71
ASP HD2 H N N 72
ASP HXT H N N 73
CYS N N N N 74
CYS CA C N R 75
CYS C C N N 76
CYS O O N N 77
CYS CB C N N 78
CYS SG S N N 79
CYS OXT O N N 80
CYS H H N N 81
CYS H2 H N N 82
CYS HA H N N 83
CYS HB2 H N N 84
CYS HB3 H N N 85
CYS HG H N N 86
CYS HXT H N N 87
G9S C1 C N N 88
G9S C2 C N N 89
G9S C3 C N N 90
G9S C4 C N N 91
G9S C5 C N N 92
G9S C6 C N N 93
G9S C7 C N N 94
G9S C8 C N N 95
G9S C10 C N N 96
G9S C11 C N N 97
G9S C12 C N N 98
G9S C13 C N N 99
G9S C14 C N N 100
G9S C15 C N N 101
G9S C16 C N N 102
G9S N2 N N N 103
G9S C19 C N N 104
G9S C20 C N N 105
G9S C21 C N N 106
G9S C22 C N N 107
G9S C23 C N N 108
G9S C24 C N N 109
G9S C25 C N N 110
G9S C26 C N N 111
G9S C27 C N N 112
G9S C28 C N N 113
G9S C29 C N N 114
G9S C30 C N S 115
G9S N3 N N N 116
G9S O2 O N N 117
G9S O3 O N N 118
G9S O4 O N N 119
G9S O5 O N N 120
G9S O6 O N N 121
G9S O8 O N N 122
G9S O9 O N N 123
G9S P1 P N N 124
G9S S1 S N N 125
G9S O1 O N N 126
G9S H1 H N N 127
G9S H2 H N N 128
G9S H3 H N N 129
G9S H4 H N N 130
G9S H5 H N N 131
G9S H6 H N N 132
G9S H7 H N N 133
G9S H8 H N N 134
G9S H9 H N N 135
G9S H10 H N N 136
G9S H11 H N N 137
G9S H12 H N N 138
G9S H13 H N N 139
G9S H14 H N N 140
G9S H15 H N N 141
G9S H16 H N N 142
G9S H17 H N N 143
G9S H18 H N N 144
G9S H19 H N N 145
G9S H20 H N N 146
G9S H21 H N N 147
G9S H22 H N N 148
G9S H23 H N N 149
G9S H24 H N N 150
G9S H25 H N N 151
G9S H26 H N N 152
G9S H27 H N N 153
G9S H28 H N N 154
G9S H29 H N N 155
G9S H30 H N N 156
G9S H31 H N N 157
G9S H32 H N N 158
G9S H33 H N N 159
G9S H34 H N N 160
G9S H35 H N N 161
G9S H36 H N N 162
G9S H37 H N N 163
G9S H38 H N N 164
G9S H39 H N N 165
G9S H40 H N N 166
G9S H41 H N N 167
G9S H42 H N N 168
G9S H43 H N N 169
G9S H44 H N N 170
G9S H45 H N N 171
G9S H46 H N N 172
G9S H47 H N N 173
G9S H48 H N N 174
G9S H49 H N N 175
G9S H50 H N N 176
G9S H51 H N N 177
G9S H52 H N N 178
G9S H53 H N N 179
GLN N N N N 180
GLN CA C N S 181
GLN C C N N 182
GLN O O N N 183
GLN CB C N N 184
GLN CG C N N 185
GLN CD C N N 186
GLN OE1 O N N 187
GLN NE2 N N N 188
GLN OXT O N N 189
GLN H H N N 190
GLN H2 H N N 191
GLN HA H N N 192
GLN HB2 H N N 193
GLN HB3 H N N 194
GLN HG2 H N N 195
GLN HG3 H N N 196
GLN HE21 H N N 197
GLN HE22 H N N 198
GLN HXT H N N 199
GLU N N N N 200
GLU CA C N S 201
GLU C C N N 202
GLU O O N N 203
GLU CB C N N 204
GLU CG C N N 205
GLU CD C N N 206
GLU OE1 O N N 207
GLU OE2 O N N 208
GLU OXT O N N 209
GLU H H N N 210
GLU H2 H N N 211
GLU HA H N N 212
GLU HB2 H N N 213
GLU HB3 H N N 214
GLU HG2 H N N 215
GLU HG3 H N N 216
GLU HE2 H N N 217
GLU HXT H N N 218
GLY N N N N 219
GLY CA C N N 220
GLY C C N N 221
GLY O O N N 222
GLY OXT O N N 223
GLY H H N N 224
GLY H2 H N N 225
GLY HA2 H N N 226
GLY HA3 H N N 227
GLY HXT H N N 228
HIS N N N N 229
HIS CA C N S 230
HIS C C N N 231
HIS O O N N 232
HIS CB C N N 233
HIS CG C Y N 234
HIS ND1 N Y N 235
HIS CD2 C Y N 236
HIS CE1 C Y N 237
HIS NE2 N Y N 238
HIS OXT O N N 239
HIS H H N N 240
HIS H2 H N N 241
HIS HA H N N 242
HIS HB2 H N N 243
HIS HB3 H N N 244
HIS HD1 H N N 245
HIS HD2 H N N 246
HIS HE1 H N N 247
HIS HE2 H N N 248
HIS HXT H N N 249
ILE N N N N 250
ILE CA C N S 251
ILE C C N N 252
ILE O O N N 253
ILE CB C N S 254
ILE CG1 C N N 255
ILE CG2 C N N 256
ILE CD1 C N N 257
ILE OXT O N N 258
ILE H H N N 259
ILE H2 H N N 260
ILE HA H N N 261
ILE HB H N N 262
ILE HG12 H N N 263
ILE HG13 H N N 264
ILE HG21 H N N 265
ILE HG22 H N N 266
ILE HG23 H N N 267
ILE HD11 H N N 268
ILE HD12 H N N 269
ILE HD13 H N N 270
ILE HXT H N N 271
LEU N N N N 272
LEU CA C N S 273
LEU C C N N 274
LEU O O N N 275
LEU CB C N N 276
LEU CG C N N 277
LEU CD1 C N N 278
LEU CD2 C N N 279
LEU OXT O N N 280
LEU H H N N 281
LEU H2 H N N 282
LEU HA H N N 283
LEU HB2 H N N 284
LEU HB3 H N N 285
LEU HG H N N 286
LEU HD11 H N N 287
LEU HD12 H N N 288
LEU HD13 H N N 289
LEU HD21 H N N 290
LEU HD22 H N N 291
LEU HD23 H N N 292
LEU HXT H N N 293
LYS N N N N 294
LYS CA C N S 295
LYS C C N N 296
LYS O O N N 297
LYS CB C N N 298
LYS CG C N N 299
LYS CD C N N 300
LYS CE C N N 301
LYS NZ N N N 302
LYS OXT O N N 303
LYS H H N N 304
LYS H2 H N N 305
LYS HA H N N 306
LYS HB2 H N N 307
LYS HB3 H N N 308
LYS HG2 H N N 309
LYS HG3 H N N 310
LYS HD2 H N N 311
LYS HD3 H N N 312
LYS HE2 H N N 313
LYS HE3 H N N 314
LYS HZ1 H N N 315
LYS HZ2 H N N 316
LYS HZ3 H N N 317
LYS HXT H N N 318
MSE N N N N 319
MSE CA C N S 320
MSE C C N N 321
MSE O O N N 322
MSE OXT O N N 323
MSE CB C N N 324
MSE CG C N N 325
MSE SE SE N N 326
MSE CE C N N 327
MSE H H N N 328
MSE H2 H N N 329
MSE HA H N N 330
MSE HXT H N N 331
MSE HB2 H N N 332
MSE HB3 H N N 333
MSE HG2 H N N 334
MSE HG3 H N N 335
MSE HE1 H N N 336
MSE HE2 H N N 337
MSE HE3 H N N 338
PHE N N N N 339
PHE CA C N S 340
PHE C C N N 341
PHE O O N N 342
PHE CB C N N 343
PHE CG C Y N 344
PHE CD1 C Y N 345
PHE CD2 C Y N 346
PHE CE1 C Y N 347
PHE CE2 C Y N 348
PHE CZ C Y N 349
PHE OXT O N N 350
PHE H H N N 351
PHE H2 H N N 352
PHE HA H N N 353
PHE HB2 H N N 354
PHE HB3 H N N 355
PHE HD1 H N N 356
PHE HD2 H N N 357
PHE HE1 H N N 358
PHE HE2 H N N 359
PHE HZ H N N 360
PHE HXT H N N 361
PRO N N N N 362
PRO CA C N S 363
PRO C C N N 364
PRO O O N N 365
PRO CB C N N 366
PRO CG C N N 367
PRO CD C N N 368
PRO OXT O N N 369
PRO H H N N 370
PRO HA H N N 371
PRO HB2 H N N 372
PRO HB3 H N N 373
PRO HG2 H N N 374
PRO HG3 H N N 375
PRO HD2 H N N 376
PRO HD3 H N N 377
PRO HXT H N N 378
SER N N N N 379
SER CA C N S 380
SER C C N N 381
SER O O N N 382
SER CB C N N 383
SER OG O N N 384
SER OXT O N N 385
SER H H N N 386
SER H2 H N N 387
SER HA H N N 388
SER HB2 H N N 389
SER HB3 H N N 390
SER HG H N N 391
SER HXT H N N 392
THR N N N N 393
THR CA C N S 394
THR C C N N 395
THR O O N N 396
THR CB C N R 397
THR OG1 O N N 398
THR CG2 C N N 399
THR OXT O N N 400
THR H H N N 401
THR H2 H N N 402
THR HA H N N 403
THR HB H N N 404
THR HG1 H N N 405
THR HG21 H N N 406
THR HG22 H N N 407
THR HG23 H N N 408
THR HXT H N N 409
TRP N N N N 410
TRP CA C N S 411
TRP C C N N 412
TRP O O N N 413
TRP CB C N N 414
TRP CG C Y N 415
TRP CD1 C Y N 416
TRP CD2 C Y N 417
TRP NE1 N Y N 418
TRP CE2 C Y N 419
TRP CE3 C Y N 420
TRP CZ2 C Y N 421
TRP CZ3 C Y N 422
TRP CH2 C Y N 423
TRP OXT O N N 424
TRP H H N N 425
TRP H2 H N N 426
TRP HA H N N 427
TRP HB2 H N N 428
TRP HB3 H N N 429
TRP HD1 H N N 430
TRP HE1 H N N 431
TRP HE3 H N N 432
TRP HZ2 H N N 433
TRP HZ3 H N N 434
TRP HH2 H N N 435
TRP HXT H N N 436
TYR N N N N 437
TYR CA C N S 438
TYR C C N N 439
TYR O O N N 440
TYR CB C N N 441
TYR CG C Y N 442
TYR CD1 C Y N 443
TYR CD2 C Y N 444
TYR CE1 C Y N 445
TYR CE2 C Y N 446
TYR CZ C Y N 447
TYR OH O N N 448
TYR OXT O N N 449
TYR H H N N 450
TYR H2 H N N 451
TYR HA H N N 452
TYR HB2 H N N 453
TYR HB3 H N N 454
TYR HD1 H N N 455
TYR HD2 H N N 456
TYR HE1 H N N 457
TYR HE2 H N N 458
TYR HH H N N 459
TYR HXT H N N 460
VAL N N N N 461
VAL CA C N S 462
VAL C C N N 463
VAL O O N N 464
VAL CB C N N 465
VAL CG1 C N N 466
VAL CG2 C N N 467
VAL OXT O N N 468
VAL H H N N 469
VAL H2 H N N 470
VAL HA H N N 471
VAL HB H N N 472
VAL HG11 H N N 473
VAL HG12 H N N 474
VAL HG13 H N N 475
VAL HG21 H N N 476
VAL HG22 H N N 477
VAL HG23 H N N 478
VAL HXT H N N 479
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
ALA N CA sing N N 1
ALA N H sing N N 2
ALA N H2 sing N N 3
ALA CA C sing N N 4
ALA CA CB sing N N 5
ALA CA HA sing N N 6
ALA C O doub N N 7
ALA C OXT sing N N 8
ALA CB HB1 sing N N 9
ALA CB HB2 sing N N 10
ALA CB HB3 sing N N 11
ALA OXT HXT sing N N 12
ARG N CA sing N N 13
ARG N H sing N N 14
ARG N H2 sing N N 15
ARG CA C sing N N 16
ARG CA CB sing N N 17
ARG CA HA sing N N 18
ARG C O doub N N 19
ARG C OXT sing N N 20
ARG CB CG sing N N 21
ARG CB HB2 sing N N 22
ARG CB HB3 sing N N 23
ARG CG CD sing N N 24
ARG CG HG2 sing N N 25
ARG CG HG3 sing N N 26
ARG CD NE sing N N 27
ARG CD HD2 sing N N 28
ARG CD HD3 sing N N 29
ARG NE CZ sing N N 30
ARG NE HE sing N N 31
ARG CZ NH1 sing N N 32
ARG CZ NH2 doub N N 33
ARG NH1 HH11 sing N N 34
ARG NH1 HH12 sing N N 35
ARG NH2 HH21 sing N N 36
ARG NH2 HH22 sing N N 37
ARG OXT HXT sing N N 38
ASN N CA sing N N 39
ASN N H sing N N 40
ASN N H2 sing N N 41
ASN CA C sing N N 42
ASN CA CB sing N N 43
ASN CA HA sing N N 44
ASN C O doub N N 45
ASN C OXT sing N N 46
ASN CB CG sing N N 47
ASN CB HB2 sing N N 48
ASN CB HB3 sing N N 49
ASN CG OD1 doub N N 50
ASN CG ND2 sing N N 51
ASN ND2 HD21 sing N N 52
ASN ND2 HD22 sing N N 53
ASN OXT HXT sing N N 54
ASP N CA sing N N 55
ASP N H sing N N 56
ASP N H2 sing N N 57
ASP CA C sing N N 58
ASP CA CB sing N N 59
ASP CA HA sing N N 60
ASP C O doub N N 61
ASP C OXT sing N N 62
ASP CB CG sing N N 63
ASP CB HB2 sing N N 64
ASP CB HB3 sing N N 65
ASP CG OD1 doub N N 66
ASP CG OD2 sing N N 67
ASP OD2 HD2 sing N N 68
ASP OXT HXT sing N N 69
CYS N CA sing N N 70
CYS N H sing N N 71
CYS N H2 sing N N 72
CYS CA C sing N N 73
CYS CA CB sing N N 74
CYS CA HA sing N N 75
CYS C O doub N N 76
CYS C OXT sing N N 77
CYS CB SG sing N N 78
CYS CB HB2 sing N N 79
CYS CB HB3 sing N N 80
CYS SG HG sing N N 81
CYS OXT HXT sing N N 82
G9S O9 P1 doub N N 83
G9S P1 O8 sing N N 84
G9S P1 O6 sing N N 85
G9S O6 C7 sing N N 86
G9S C7 C6 sing N N 87
G9S C20 C6 sing N N 88
G9S C6 C8 sing N N 89
G9S C6 C30 sing N N 90
G9S C30 O5 sing N N 91
G9S C30 C5 sing N N 92
G9S O4 C5 doub N N 93
G9S C5 N3 sing N N 94
G9S N3 C4 sing N N 95
G9S O2 C2 doub N N 96
G9S C4 C3 sing N N 97
G9S C2 C3 sing N N 98
G9S C2 N2 sing N N 99
G9S C1 N2 sing N N 100
G9S C1 C19 sing N N 101
G9S C19 S1 sing N N 102
G9S O3 C10 doub N N 103
G9S C10 S1 sing N N 104
G9S C10 C11 sing N N 105
G9S C14 C13 sing N N 106
G9S C14 C15 sing N N 107
G9S C11 C12 sing N N 108
G9S C13 C12 sing N N 109
G9S C15 C16 sing N N 110
G9S C16 C21 sing N N 111
G9S C21 C22 sing N N 112
G9S C22 C23 sing N N 113
G9S C24 C23 sing N N 114
G9S C24 C25 sing N N 115
G9S C26 C25 sing N N 116
G9S C26 C27 sing N N 117
G9S C28 C27 sing N N 118
G9S C28 C29 sing N N 119
G9S P1 O1 sing N N 120
G9S C1 H1 sing N N 121
G9S C1 H2 sing N N 122
G9S C3 H3 sing N N 123
G9S C3 H4 sing N N 124
G9S C4 H5 sing N N 125
G9S C4 H6 sing N N 126
G9S C7 H7 sing N N 127
G9S C7 H8 sing N N 128
G9S C8 H9 sing N N 129
G9S C8 H10 sing N N 130
G9S C8 H11 sing N N 131
G9S C11 H12 sing N N 132
G9S C11 H13 sing N N 133
G9S C12 H14 sing N N 134
G9S C12 H15 sing N N 135
G9S C13 H16 sing N N 136
G9S C13 H17 sing N N 137
G9S C14 H18 sing N N 138
G9S C14 H19 sing N N 139
G9S C15 H20 sing N N 140
G9S C15 H21 sing N N 141
G9S C16 H22 sing N N 142
G9S C16 H23 sing N N 143
G9S N2 H24 sing N N 144
G9S C19 H25 sing N N 145
G9S C19 H26 sing N N 146
G9S C20 H27 sing N N 147
G9S C20 H28 sing N N 148
G9S C20 H29 sing N N 149
G9S C21 H30 sing N N 150
G9S C21 H31 sing N N 151
G9S C22 H32 sing N N 152
G9S C22 H33 sing N N 153
G9S C23 H34 sing N N 154
G9S C24 H35 sing N N 155
G9S C25 H36 sing N N 156
G9S C25 H37 sing N N 157
G9S C26 H38 sing N N 158
G9S C27 H39 sing N N 159
G9S C28 H40 sing N N 160
G9S C28 H41 sing N N 161
G9S C29 H42 sing N N 162
G9S C29 H43 sing N N 163
G9S C29 H44 sing N N 164
G9S C30 H45 sing N N 165
G9S N3 H46 sing N N 166
G9S O5 H47 sing N N 167
G9S O8 H48 sing N N 168
G9S O1 H49 sing N N 169
G9S C23 H50 sing N N 170
G9S C24 H51 sing N N 171
G9S C26 H52 sing N N 172
G9S C27 H53 sing N N 173
GLN N CA sing N N 174
GLN N H sing N N 175
GLN N H2 sing N N 176
GLN CA C sing N N 177
GLN CA CB sing N N 178
GLN CA HA sing N N 179
GLN C O doub N N 180
GLN C OXT sing N N 181
GLN CB CG sing N N 182
GLN CB HB2 sing N N 183
GLN CB HB3 sing N N 184
GLN CG CD sing N N 185
GLN CG HG2 sing N N 186
GLN CG HG3 sing N N 187
GLN CD OE1 doub N N 188
GLN CD NE2 sing N N 189
GLN NE2 HE21 sing N N 190
GLN NE2 HE22 sing N N 191
GLN OXT HXT sing N N 192
GLU N CA sing N N 193
GLU N H sing N N 194
GLU N H2 sing N N 195
GLU CA C sing N N 196
GLU CA CB sing N N 197
GLU CA HA sing N N 198
GLU C O doub N N 199
GLU C OXT sing N N 200
GLU CB CG sing N N 201
GLU CB HB2 sing N N 202
GLU CB HB3 sing N N 203
GLU CG CD sing N N 204
GLU CG HG2 sing N N 205
GLU CG HG3 sing N N 206
GLU CD OE1 doub N N 207
GLU CD OE2 sing N N 208
GLU OE2 HE2 sing N N 209
GLU OXT HXT sing N N 210
GLY N CA sing N N 211
GLY N H sing N N 212
GLY N H2 sing N N 213
GLY CA C sing N N 214
GLY CA HA2 sing N N 215
GLY CA HA3 sing N N 216
GLY C O doub N N 217
GLY C OXT sing N N 218
GLY OXT HXT sing N N 219
HIS N CA sing N N 220
HIS N H sing N N 221
HIS N H2 sing N N 222
HIS CA C sing N N 223
HIS CA CB sing N N 224
HIS CA HA sing N N 225
HIS C O doub N N 226
HIS C OXT sing N N 227
HIS CB CG sing N N 228
HIS CB HB2 sing N N 229
HIS CB HB3 sing N N 230
HIS CG ND1 sing Y N 231
HIS CG CD2 doub Y N 232
HIS ND1 CE1 doub Y N 233
HIS ND1 HD1 sing N N 234
HIS CD2 NE2 sing Y N 235
HIS CD2 HD2 sing N N 236
HIS CE1 NE2 sing Y N 237
HIS CE1 HE1 sing N N 238
HIS NE2 HE2 sing N N 239
HIS OXT HXT sing N N 240
ILE N CA sing N N 241
ILE N H sing N N 242
ILE N H2 sing N N 243
ILE CA C sing N N 244
ILE CA CB sing N N 245
ILE CA HA sing N N 246
ILE C O doub N N 247
ILE C OXT sing N N 248
ILE CB CG1 sing N N 249
ILE CB CG2 sing N N 250
ILE CB HB sing N N 251
ILE CG1 CD1 sing N N 252
ILE CG1 HG12 sing N N 253
ILE CG1 HG13 sing N N 254
ILE CG2 HG21 sing N N 255
ILE CG2 HG22 sing N N 256
ILE CG2 HG23 sing N N 257
ILE CD1 HD11 sing N N 258
ILE CD1 HD12 sing N N 259
ILE CD1 HD13 sing N N 260
ILE OXT HXT sing N N 261
LEU N CA sing N N 262
LEU N H sing N N 263
LEU N H2 sing N N 264
LEU CA C sing N N 265
LEU CA CB sing N N 266
LEU CA HA sing N N 267
LEU C O doub N N 268
LEU C OXT sing N N 269
LEU CB CG sing N N 270
LEU CB HB2 sing N N 271
LEU CB HB3 sing N N 272
LEU CG CD1 sing N N 273
LEU CG CD2 sing N N 274
LEU CG HG sing N N 275
LEU CD1 HD11 sing N N 276
LEU CD1 HD12 sing N N 277
LEU CD1 HD13 sing N N 278
LEU CD2 HD21 sing N N 279
LEU CD2 HD22 sing N N 280
LEU CD2 HD23 sing N N 281
LEU OXT HXT sing N N 282
LYS N CA sing N N 283
LYS N H sing N N 284
LYS N H2 sing N N 285
LYS CA C sing N N 286
LYS CA CB sing N N 287
LYS CA HA sing N N 288
LYS C O doub N N 289
LYS C OXT sing N N 290
LYS CB CG sing N N 291
LYS CB HB2 sing N N 292
LYS CB HB3 sing N N 293
LYS CG CD sing N N 294
LYS CG HG2 sing N N 295
LYS CG HG3 sing N N 296
LYS CD CE sing N N 297
LYS CD HD2 sing N N 298
LYS CD HD3 sing N N 299
LYS CE NZ sing N N 300
LYS CE HE2 sing N N 301
LYS CE HE3 sing N N 302
LYS NZ HZ1 sing N N 303
LYS NZ HZ2 sing N N 304
LYS NZ HZ3 sing N N 305
LYS OXT HXT sing N N 306
MSE N CA sing N N 307
MSE N H sing N N 308
MSE N H2 sing N N 309
MSE CA C sing N N 310
MSE CA CB sing N N 311
MSE CA HA sing N N 312
MSE C O doub N N 313
MSE C OXT sing N N 314
MSE OXT HXT sing N N 315
MSE CB CG sing N N 316
MSE CB HB2 sing N N 317
MSE CB HB3 sing N N 318
MSE CG SE sing N N 319
MSE CG HG2 sing N N 320
MSE CG HG3 sing N N 321
MSE SE CE sing N N 322
MSE CE HE1 sing N N 323
MSE CE HE2 sing N N 324
MSE CE HE3 sing N N 325
PHE N CA sing N N 326
PHE N H sing N N 327
PHE N H2 sing N N 328
PHE CA C sing N N 329
PHE CA CB sing N N 330
PHE CA HA sing N N 331
PHE C O doub N N 332
PHE C OXT sing N N 333
PHE CB CG sing N N 334
PHE CB HB2 sing N N 335
PHE CB HB3 sing N N 336
PHE CG CD1 doub Y N 337
PHE CG CD2 sing Y N 338
PHE CD1 CE1 sing Y N 339
PHE CD1 HD1 sing N N 340
PHE CD2 CE2 doub Y N 341
PHE CD2 HD2 sing N N 342
PHE CE1 CZ doub Y N 343
PHE CE1 HE1 sing N N 344
PHE CE2 CZ sing Y N 345
PHE CE2 HE2 sing N N 346
PHE CZ HZ sing N N 347
PHE OXT HXT sing N N 348
PRO N CA sing N N 349
PRO N CD sing N N 350
PRO N H sing N N 351
PRO CA C sing N N 352
PRO CA CB sing N N 353
PRO CA HA sing N N 354
PRO C O doub N N 355
PRO C OXT sing N N 356
PRO CB CG sing N N 357
PRO CB HB2 sing N N 358
PRO CB HB3 sing N N 359
PRO CG CD sing N N 360
PRO CG HG2 sing N N 361
PRO CG HG3 sing N N 362
PRO CD HD2 sing N N 363
PRO CD HD3 sing N N 364
PRO OXT HXT sing N N 365
SER N CA sing N N 366
SER N H sing N N 367
SER N H2 sing N N 368
SER CA C sing N N 369
SER CA CB sing N N 370
SER CA HA sing N N 371
SER C O doub N N 372
SER C OXT sing N N 373
SER CB OG sing N N 374
SER CB HB2 sing N N 375
SER CB HB3 sing N N 376
SER OG HG sing N N 377
SER OXT HXT sing N N 378
THR N CA sing N N 379
THR N H sing N N 380
THR N H2 sing N N 381
THR CA C sing N N 382
THR CA CB sing N N 383
THR CA HA sing N N 384
THR C O doub N N 385
THR C OXT sing N N 386
THR CB OG1 sing N N 387
THR CB CG2 sing N N 388
THR CB HB sing N N 389
THR OG1 HG1 sing N N 390
THR CG2 HG21 sing N N 391
THR CG2 HG22 sing N N 392
THR CG2 HG23 sing N N 393
THR OXT HXT sing N N 394
TRP N CA sing N N 395
TRP N H sing N N 396
TRP N H2 sing N N 397
TRP CA C sing N N 398
TRP CA CB sing N N 399
TRP CA HA sing N N 400
TRP C O doub N N 401
TRP C OXT sing N N 402
TRP CB CG sing N N 403
TRP CB HB2 sing N N 404
TRP CB HB3 sing N N 405
TRP CG CD1 doub Y N 406
TRP CG CD2 sing Y N 407
TRP CD1 NE1 sing Y N 408
TRP CD1 HD1 sing N N 409
TRP CD2 CE2 doub Y N 410
TRP CD2 CE3 sing Y N 411
TRP NE1 CE2 sing Y N 412
TRP NE1 HE1 sing N N 413
TRP CE2 CZ2 sing Y N 414
TRP CE3 CZ3 doub Y N 415
TRP CE3 HE3 sing N N 416
TRP CZ2 CH2 doub Y N 417
TRP CZ2 HZ2 sing N N 418
TRP CZ3 CH2 sing Y N 419
TRP CZ3 HZ3 sing N N 420
TRP CH2 HH2 sing N N 421
TRP OXT HXT sing N N 422
TYR N CA sing N N 423
TYR N H sing N N 424
TYR N H2 sing N N 425
TYR CA C sing N N 426
TYR CA CB sing N N 427
TYR CA HA sing N N 428
TYR C O doub N N 429
TYR C OXT sing N N 430
TYR CB CG sing N N 431
TYR CB HB2 sing N N 432
TYR CB HB3 sing N N 433
TYR CG CD1 doub Y N 434
TYR CG CD2 sing Y N 435
TYR CD1 CE1 sing Y N 436
TYR CD1 HD1 sing N N 437
TYR CD2 CE2 doub Y N 438
TYR CD2 HD2 sing N N 439
TYR CE1 CZ doub Y N 440
TYR CE1 HE1 sing N N 441
TYR CE2 CZ sing Y N 442
TYR CE2 HE2 sing N N 443
TYR CZ OH sing N N 444
TYR OH HH sing N N 445
TYR OXT HXT sing N N 446
VAL N CA sing N N 447
VAL N H sing N N 448
VAL N H2 sing N N 449
VAL CA C sing N N 450
VAL CA CB sing N N 451
VAL CA HA sing N N 452
VAL C O doub N N 453
VAL C OXT sing N N 454
VAL CB CG1 sing N N 455
VAL CB CG2 sing N N 456
VAL CB HB sing N N 457
VAL CG1 HG11 sing N N 458
VAL CG1 HG12 sing N N 459
VAL CG1 HG13 sing N N 460
VAL CG2 HG21 sing N N 461
VAL CG2 HG22 sing N N 462
VAL CG2 HG23 sing N N 463
VAL OXT HXT sing N N 464
#
_atom_sites.entry_id 6DFL
_atom_sites.fract_transf_matrix[1][1] 0.010867
_atom_sites.fract_transf_matrix[1][2] 0.006274
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.012548
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.010083
_atom_sites.fract_transf_vector[1] 0.000000
_atom_sites.fract_transf_vector[2] 0.000000
_atom_sites.fract_transf_vector[3] 0.000000
#
loop_
_atom_type.symbol
C
N
O
P
S
SE
#
loop_