data_6DRM # _entry.id 6DRM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6DRM pdb_00006drm 10.2210/pdb6drm/pdb WWPDB D_1000235044 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6DRM _pdbx_database_status.recvd_initial_deposition_date 2018-06-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ceccarelli, D.F.' 1 0000-0002-2674-9234 'Sicheri, F.' 2 0000-0002-9824-2117 'Cordes, S.' 3 0000-0002-3133-3655 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1000 _citation.page_last 1012.e6 _citation.title 'FAM105A/OTULINL Is a Pseudodeubiquitinase of the OTU-Class that Localizes to the ER Membrane.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2019.03.022 _citation.pdbx_database_id_PubMed 31056421 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ceccarelli, D.F.' 1 ? primary 'Ivantsiv, S.' 2 ? primary 'Mullin, A.A.' 3 ? primary 'Coyaud, E.' 4 ? primary 'Manczyk, N.' 5 ? primary 'Maisonneuve, P.' 6 ? primary 'Kurinov, I.' 7 ? primary 'Zhao, L.' 8 ? primary 'Go, C.' 9 ? primary 'Gingras, A.C.' 10 ? primary 'Raught, B.' 11 ? primary 'Cordes, S.' 12 ? primary 'Sicheri, F.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 101.940 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6DRM _cell.details ? _cell.formula_units_Z ? _cell.length_a 170.170 _cell.length_a_esd ? _cell.length_b 53.870 _cell.length_b_esd ? _cell.length_c 41.520 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6DRM _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Inactive ubiquitin thioesterase FAM105A' 32731.766 1 ? ? 'OTU domain residues 87-356' ? 2 water nat water 18.015 37 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGSNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEELFWRHHIKCVRQVRRDNYDALRSVLFQIFSQGISFPSWMKE KDIVKLPEKLLFSQGCNWIQQYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFSDAILEYKLYE ALKFIMLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDPLSFMMNHLNSVGDTCGLEQIDMFILGYSLEVKIKVFRLFKF NSRDFEVCYPEEPLRDWPEISLLTENDRHYHIPVF ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGSNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEELFWRHHIKCVRQVRRDNYDALRSVLFQIFSQGISFPSWMKE KDIVKLPEKLLFSQGCNWIQQYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFSDAILEYKLYE ALKFIMLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDPLSFMMNHLNSVGDTCGLEQIDMFILGYSLEVKIKVFRLFKF NSRDFEVCYPEEPLRDWPEISLLTENDRHYHIPVF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 ASN n 1 7 LEU n 1 8 SER n 1 9 VAL n 1 10 GLU n 1 11 ALA n 1 12 GLU n 1 13 VAL n 1 14 ASP n 1 15 LEU n 1 16 LEU n 1 17 SER n 1 18 TYR n 1 19 CYS n 1 20 ALA n 1 21 ARG n 1 22 GLU n 1 23 TRP n 1 24 LYS n 1 25 GLY n 1 26 GLU n 1 27 THR n 1 28 PRO n 1 29 ARG n 1 30 ASN n 1 31 LYS n 1 32 LEU n 1 33 MET n 1 34 ARG n 1 35 LYS n 1 36 ALA n 1 37 TYR n 1 38 GLU n 1 39 GLU n 1 40 LEU n 1 41 PHE n 1 42 TRP n 1 43 ARG n 1 44 HIS n 1 45 HIS n 1 46 ILE n 1 47 LYS n 1 48 CYS n 1 49 VAL n 1 50 ARG n 1 51 GLN n 1 52 VAL n 1 53 ARG n 1 54 ARG n 1 55 ASP n 1 56 ASN n 1 57 TYR n 1 58 ASP n 1 59 ALA n 1 60 LEU n 1 61 ARG n 1 62 SER n 1 63 VAL n 1 64 LEU n 1 65 PHE n 1 66 GLN n 1 67 ILE n 1 68 PHE n 1 69 SER n 1 70 GLN n 1 71 GLY n 1 72 ILE n 1 73 SER n 1 74 PHE n 1 75 PRO n 1 76 SER n 1 77 TRP n 1 78 MET n 1 79 LYS n 1 80 GLU n 1 81 LYS n 1 82 ASP n 1 83 ILE n 1 84 VAL n 1 85 LYS n 1 86 LEU n 1 87 PRO n 1 88 GLU n 1 89 LYS n 1 90 LEU n 1 91 LEU n 1 92 PHE n 1 93 SER n 1 94 GLN n 1 95 GLY n 1 96 CYS n 1 97 ASN n 1 98 TRP n 1 99 ILE n 1 100 GLN n 1 101 GLN n 1 102 TYR n 1 103 SER n 1 104 PHE n 1 105 GLY n 1 106 PRO n 1 107 GLU n 1 108 LYS n 1 109 TYR n 1 110 THR n 1 111 GLY n 1 112 SER n 1 113 ASN n 1 114 VAL n 1 115 PHE n 1 116 GLY n 1 117 LYS n 1 118 LEU n 1 119 ARG n 1 120 LYS n 1 121 TYR n 1 122 VAL n 1 123 GLU n 1 124 LEU n 1 125 LEU n 1 126 LYS n 1 127 THR n 1 128 GLN n 1 129 TRP n 1 130 THR n 1 131 GLU n 1 132 PHE n 1 133 ASN n 1 134 GLY n 1 135 ILE n 1 136 ARG n 1 137 ASP n 1 138 TYR n 1 139 HIS n 1 140 LYS n 1 141 ARG n 1 142 GLY n 1 143 SER n 1 144 MET n 1 145 CYS n 1 146 ASN n 1 147 THR n 1 148 LEU n 1 149 PHE n 1 150 SER n 1 151 ASP n 1 152 ALA n 1 153 ILE n 1 154 LEU n 1 155 GLU n 1 156 TYR n 1 157 LYS n 1 158 LEU n 1 159 TYR n 1 160 GLU n 1 161 ALA n 1 162 LEU n 1 163 LYS n 1 164 PHE n 1 165 ILE n 1 166 MET n 1 167 LEU n 1 168 TYR n 1 169 GLN n 1 170 VAL n 1 171 THR n 1 172 GLU n 1 173 VAL n 1 174 TYR n 1 175 GLU n 1 176 GLN n 1 177 MET n 1 178 LYS n 1 179 THR n 1 180 LYS n 1 181 LYS n 1 182 VAL n 1 183 ILE n 1 184 PRO n 1 185 SER n 1 186 LEU n 1 187 PHE n 1 188 ARG n 1 189 LEU n 1 190 LEU n 1 191 PHE n 1 192 SER n 1 193 ARG n 1 194 GLU n 1 195 THR n 1 196 SER n 1 197 SER n 1 198 ASP n 1 199 PRO n 1 200 LEU n 1 201 SER n 1 202 PHE n 1 203 MET n 1 204 MET n 1 205 ASN n 1 206 HIS n 1 207 LEU n 1 208 ASN n 1 209 SER n 1 210 VAL n 1 211 GLY n 1 212 ASP n 1 213 THR n 1 214 CYS n 1 215 GLY n 1 216 LEU n 1 217 GLU n 1 218 GLN n 1 219 ILE n 1 220 ASP n 1 221 MET n 1 222 PHE n 1 223 ILE n 1 224 LEU n 1 225 GLY n 1 226 TYR n 1 227 SER n 1 228 LEU n 1 229 GLU n 1 230 VAL n 1 231 LYS n 1 232 ILE n 1 233 LYS n 1 234 VAL n 1 235 PHE n 1 236 ARG n 1 237 LEU n 1 238 PHE n 1 239 LYS n 1 240 PHE n 1 241 ASN n 1 242 SER n 1 243 ARG n 1 244 ASP n 1 245 PHE n 1 246 GLU n 1 247 VAL n 1 248 CYS n 1 249 TYR n 1 250 PRO n 1 251 GLU n 1 252 GLU n 1 253 PRO n 1 254 LEU n 1 255 ARG n 1 256 ASP n 1 257 TRP n 1 258 PRO n 1 259 GLU n 1 260 ILE n 1 261 SER n 1 262 LEU n 1 263 LEU n 1 264 THR n 1 265 GLU n 1 266 ASN n 1 267 ASP n 1 268 ARG n 1 269 HIS n 1 270 TYR n 1 271 HIS n 1 272 ILE n 1 273 PRO n 1 274 VAL n 1 275 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 275 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FAM105A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ProEx _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F105A_HUMAN _struct_ref.pdbx_db_accession Q9NUU6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEELFWRHHIKCVRQVRRDNYDALRSVLFQIFSQGISFPSWMKEKDIVK LPEKLLFSQGCNWIQQYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFSDAILEYKLYEALKFI MLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDPLSFMMNHLNSVGDTCGLEQIDMFILGYSLEVKIKVFRLFKFNSRDF EVCYPEEPLRDWPEISLLTENDRHYHIPVF ; _struct_ref.pdbx_align_begin 87 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6DRM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 275 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NUU6 _struct_ref_seq.db_align_beg 87 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 356 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 87 _struct_ref_seq.pdbx_auth_seq_align_end 356 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6DRM GLY A 1 ? UNP Q9NUU6 ? ? 'expression tag' 82 1 1 6DRM ALA A 2 ? UNP Q9NUU6 ? ? 'expression tag' 83 2 1 6DRM MET A 3 ? UNP Q9NUU6 ? ? 'expression tag' 84 3 1 6DRM GLY A 4 ? UNP Q9NUU6 ? ? 'expression tag' 85 4 1 6DRM SER A 5 ? UNP Q9NUU6 ? ? 'expression tag' 86 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6DRM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '6% PEG8000, 0.1M Tris-HCl pH 8.0, 150 mM NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 47.130 _reflns.entry_id 6DRM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.060 _reflns.d_resolution_low 39.906 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22648 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.709 _reflns.pdbx_Rmerge_I_obs 0.039 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.630 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.021 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.046 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.060 2.110 ? 1.140 ? ? ? ? 1584 96.500 ? ? ? ? 1.032 ? ? ? ? ? ? ? ? 3.521 ? ? ? ? 1.217 ? ? 1 1 0.638 ? 2.110 2.170 ? 1.730 ? ? ? ? 1610 97.400 ? ? ? ? 0.723 ? ? ? ? ? ? ? ? 3.773 ? ? ? ? 0.842 ? ? 2 1 0.797 ? 2.170 2.230 ? 2.340 ? ? ? ? 1568 98.800 ? ? ? ? 0.540 ? ? ? ? ? ? ? ? 3.781 ? ? ? ? 0.629 ? ? 3 1 0.877 ? 2.230 2.300 ? 3.340 ? ? ? ? 1549 98.700 ? ? ? ? 0.395 ? ? ? ? ? ? ? ? 3.755 ? ? ? ? 0.462 ? ? 4 1 0.930 ? 2.300 2.380 ? 4.160 ? ? ? ? 1461 98.800 ? ? ? ? 0.308 ? ? ? ? ? ? ? ? 3.785 ? ? ? ? 0.359 ? ? 5 1 0.949 ? 2.380 2.460 ? 5.460 ? ? ? ? 1477 99.300 ? ? ? ? 0.227 ? ? ? ? ? ? ? ? 3.774 ? ? ? ? 0.265 ? ? 6 1 0.970 ? 2.460 2.560 ? 7.360 ? ? ? ? 1383 98.800 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 3.785 ? ? ? ? 0.205 ? ? 7 1 0.981 ? 2.560 2.660 ? 9.430 ? ? ? ? 1335 99.300 ? ? ? ? 0.131 ? ? ? ? ? ? ? ? 3.769 ? ? ? ? 0.153 ? ? 8 1 0.989 ? 2.660 2.780 ? 12.480 ? ? ? ? 1303 99.400 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 3.764 ? ? ? ? 0.116 ? ? 9 1 0.993 ? 2.780 2.910 ? 15.880 ? ? ? ? 1226 99.400 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 3.762 ? ? ? ? 0.088 ? ? 10 1 0.996 ? 2.910 3.070 ? 20.990 ? ? ? ? 1170 99.100 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 3.757 ? ? ? ? 0.061 ? ? 11 1 0.998 ? 3.070 3.260 ? 26.480 ? ? ? ? 1119 98.900 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 3.725 ? ? ? ? 0.047 ? ? 12 1 0.998 ? 3.260 3.480 ? 33.070 ? ? ? ? 1061 98.900 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 3.691 ? ? ? ? 0.038 ? ? 13 1 0.999 ? 3.480 3.760 ? 41.040 ? ? ? ? 976 99.600 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 3.675 ? ? ? ? 0.030 ? ? 14 1 0.999 ? 3.760 4.120 ? 43.370 ? ? ? ? 908 99.300 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 3.584 ? ? ? ? 0.027 ? ? 15 1 0.999 ? 4.120 4.610 ? 48.670 ? ? ? ? 821 99.600 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 3.555 ? ? ? ? 0.026 ? ? 16 1 0.999 ? 4.610 5.320 ? 48.780 ? ? ? ? 730 99.300 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 3.571 ? ? ? ? 0.027 ? ? 17 1 0.999 ? 5.320 6.510 ? 48.140 ? ? ? ? 609 99.500 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 3.645 ? ? ? ? 0.024 ? ? 18 1 0.999 ? 6.510 9.210 ? 52.350 ? ? ? ? 488 99.400 ? ? ? ? 0.017 ? ? ? ? ? ? ? ? 3.627 ? ? ? ? 0.020 ? ? 19 1 0.999 ? 9.210 39.906 ? 52.260 ? ? ? ? 270 94.400 ? ? ? ? 0.025 ? ? ? ? ? ? ? ? 3.237 ? ? ? ? 0.031 ? ? 20 1 0.997 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 160.540 _refine.B_iso_mean 68.6007 _refine.B_iso_min 34.800 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6DRM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0600 _refine.ls_d_res_low 39.9060 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22642 _refine.ls_number_reflns_R_free 1110 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.8200 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2075 _refine.ls_R_factor_R_free 0.2272 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2064 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4KSJ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.2000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.0600 _refine_hist.d_res_low 39.9060 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 2270 _refine_hist.pdbx_number_residues_total 270 _refine_hist.pdbx_B_iso_mean_solvent 54.83 _refine_hist.pdbx_number_atoms_protein 2233 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0600 2.1538 2727 . 131 2596 97.0000 . . . 0.3663 0.0000 0.3365 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.1538 2.2673 2799 . 149 2650 99.0000 . . . 0.2914 0.0000 0.2864 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.2673 2.4093 2810 . 131 2679 99.0000 . . . 0.2862 0.0000 0.2499 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.4093 2.5953 2835 . 125 2710 99.0000 . . . 0.2684 0.0000 0.2442 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.5953 2.8564 2836 . 125 2711 99.0000 . . . 0.2446 0.0000 0.2388 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.8564 3.2696 2830 . 131 2699 99.0000 . . . 0.2645 0.0000 0.2421 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 3.2696 4.1187 2883 . 159 2724 99.0000 . . . 0.2424 0.0000 0.2011 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 4.1187 39.9131 2922 . 159 2763 99.0000 . . . 0.1769 0.0000 0.1609 . . . . . . 8 . . . # _struct.entry_id 6DRM _struct.title 'OTU domain of Fam105A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6DRM _struct_keywords.text 'Fam105A, OTUpseu, deubiquitinase, OTU domain, pseudo-enzyme, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 15 ? TRP A 23 ? LEU A 96 TRP A 104 1 ? 9 HELX_P HELX_P2 AA2 THR A 27 ? HIS A 45 ? THR A 108 HIS A 126 1 ? 19 HELX_P HELX_P3 AA3 TYR A 57 ? GLY A 71 ? TYR A 138 GLY A 152 1 ? 15 HELX_P HELX_P4 AA4 SER A 76 ? LYS A 81 ? SER A 157 LYS A 162 1 ? 6 HELX_P HELX_P5 AA5 ASP A 82 ? VAL A 84 ? ASP A 163 VAL A 165 5 ? 3 HELX_P HELX_P6 AA6 LYS A 85 ? GLN A 94 ? LYS A 166 GLN A 175 1 ? 10 HELX_P HELX_P7 AA7 GLY A 95 ? GLN A 100 ? GLY A 176 GLN A 181 1 ? 6 HELX_P HELX_P8 AA8 PHE A 104 ? LYS A 108 ? PHE A 185 LYS A 189 5 ? 5 HELX_P HELX_P9 AA9 ASN A 113 ? GLY A 134 ? ASN A 194 GLY A 215 1 ? 22 HELX_P HELX_P10 AB1 ASP A 137 ? PHE A 149 ? ASP A 218 PHE A 230 1 ? 13 HELX_P HELX_P11 AB2 ASP A 151 ? THR A 179 ? ASP A 232 THR A 260 1 ? 29 HELX_P HELX_P12 AB3 PRO A 184 ? ARG A 193 ? PRO A 265 ARG A 274 1 ? 10 HELX_P HELX_P13 AB4 GLU A 194 ? SER A 197 ? GLU A 275 SER A 278 5 ? 4 HELX_P HELX_P14 AB5 ASP A 198 ? HIS A 206 ? ASP A 279 HIS A 287 1 ? 9 HELX_P HELX_P15 AB6 LEU A 207 ? VAL A 210 ? LEU A 288 VAL A 291 5 ? 4 HELX_P HELX_P16 AB7 GLU A 217 ? GLU A 229 ? GLU A 298 GLU A 310 1 ? 13 HELX_P HELX_P17 AB8 PHE A 238 ? PHE A 240 ? PHE A 319 PHE A 321 5 ? 3 HELX_P HELX_P18 AB9 SER A 242 ? ASP A 244 ? SER A 323 ASP A 325 5 ? 3 HELX_P HELX_P19 AC1 GLU A 252 ? ASP A 256 ? GLU A 333 ASP A 337 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 249 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 330 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 250 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 331 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.89 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 13 ? ASP A 14 ? VAL A 94 ASP A 95 AA1 2 CYS A 48 ? ARG A 50 ? CYS A 129 ARG A 131 AA1 3 TYR A 270 ? VAL A 274 ? TYR A 351 VAL A 355 AA1 4 GLU A 259 ? THR A 264 ? GLU A 340 THR A 345 AA1 5 LYS A 231 ? ARG A 236 ? LYS A 312 ARG A 317 AA1 6 GLU A 246 ? TYR A 249 ? GLU A 327 TYR A 330 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 13 ? N VAL A 94 O VAL A 49 ? O VAL A 130 AA1 2 3 N ARG A 50 ? N ARG A 131 O ILE A 272 ? O ILE A 353 AA1 3 4 O HIS A 271 ? O HIS A 352 N LEU A 263 ? N LEU A 344 AA1 4 5 O ILE A 260 ? O ILE A 341 N LYS A 233 ? N LYS A 314 AA1 5 6 N VAL A 234 ? N VAL A 315 O VAL A 247 ? O VAL A 328 # _atom_sites.entry_id 6DRM _atom_sites.fract_transf_matrix[1][1] 0.005876 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001243 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018563 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024617 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 82 ? ? ? A . n A 1 2 ALA 2 83 ? ? ? A . n A 1 3 MET 3 84 ? ? ? A . n A 1 4 GLY 4 85 ? ? ? A . n A 1 5 SER 5 86 ? ? ? A . n A 1 6 ASN 6 87 87 ASN ASN A . n A 1 7 LEU 7 88 88 LEU LEU A . n A 1 8 SER 8 89 89 SER SER A . n A 1 9 VAL 9 90 90 VAL VAL A . n A 1 10 GLU 10 91 91 GLU GLU A . n A 1 11 ALA 11 92 92 ALA ALA A . n A 1 12 GLU 12 93 93 GLU GLU A . n A 1 13 VAL 13 94 94 VAL VAL A . n A 1 14 ASP 14 95 95 ASP ASP A . n A 1 15 LEU 15 96 96 LEU LEU A . n A 1 16 LEU 16 97 97 LEU LEU A . n A 1 17 SER 17 98 98 SER SER A . n A 1 18 TYR 18 99 99 TYR TYR A . n A 1 19 CYS 19 100 100 CYS CYS A . n A 1 20 ALA 20 101 101 ALA ALA A . n A 1 21 ARG 21 102 102 ARG ARG A . n A 1 22 GLU 22 103 103 GLU GLU A . n A 1 23 TRP 23 104 104 TRP TRP A . n A 1 24 LYS 24 105 105 LYS LYS A . n A 1 25 GLY 25 106 106 GLY GLY A . n A 1 26 GLU 26 107 107 GLU GLU A . n A 1 27 THR 27 108 108 THR THR A . n A 1 28 PRO 28 109 109 PRO PRO A . n A 1 29 ARG 29 110 110 ARG ARG A . n A 1 30 ASN 30 111 111 ASN ASN A . n A 1 31 LYS 31 112 112 LYS LYS A . n A 1 32 LEU 32 113 113 LEU LEU A . n A 1 33 MET 33 114 114 MET MET A . n A 1 34 ARG 34 115 115 ARG ARG A . n A 1 35 LYS 35 116 116 LYS LYS A . n A 1 36 ALA 36 117 117 ALA ALA A . n A 1 37 TYR 37 118 118 TYR TYR A . n A 1 38 GLU 38 119 119 GLU GLU A . n A 1 39 GLU 39 120 120 GLU GLU A . n A 1 40 LEU 40 121 121 LEU LEU A . n A 1 41 PHE 41 122 122 PHE PHE A . n A 1 42 TRP 42 123 123 TRP TRP A . n A 1 43 ARG 43 124 124 ARG ARG A . n A 1 44 HIS 44 125 125 HIS HIS A . n A 1 45 HIS 45 126 126 HIS HIS A . n A 1 46 ILE 46 127 127 ILE ILE A . n A 1 47 LYS 47 128 128 LYS LYS A . n A 1 48 CYS 48 129 129 CYS CYS A . n A 1 49 VAL 49 130 130 VAL VAL A . n A 1 50 ARG 50 131 131 ARG ARG A . n A 1 51 GLN 51 132 132 GLN GLN A . n A 1 52 VAL 52 133 133 VAL VAL A . n A 1 53 ARG 53 134 134 ARG ARG A . n A 1 54 ARG 54 135 135 ARG ARG A . n A 1 55 ASP 55 136 136 ASP ASP A . n A 1 56 ASN 56 137 137 ASN ASN A . n A 1 57 TYR 57 138 138 TYR TYR A . n A 1 58 ASP 58 139 139 ASP ASP A . n A 1 59 ALA 59 140 140 ALA ALA A . n A 1 60 LEU 60 141 141 LEU LEU A . n A 1 61 ARG 61 142 142 ARG ARG A . n A 1 62 SER 62 143 143 SER SER A . n A 1 63 VAL 63 144 144 VAL VAL A . n A 1 64 LEU 64 145 145 LEU LEU A . n A 1 65 PHE 65 146 146 PHE PHE A . n A 1 66 GLN 66 147 147 GLN GLN A . n A 1 67 ILE 67 148 148 ILE ILE A . n A 1 68 PHE 68 149 149 PHE PHE A . n A 1 69 SER 69 150 150 SER SER A . n A 1 70 GLN 70 151 151 GLN GLN A . n A 1 71 GLY 71 152 152 GLY GLY A . n A 1 72 ILE 72 153 153 ILE ILE A . n A 1 73 SER 73 154 154 SER SER A . n A 1 74 PHE 74 155 155 PHE PHE A . n A 1 75 PRO 75 156 156 PRO PRO A . n A 1 76 SER 76 157 157 SER SER A . n A 1 77 TRP 77 158 158 TRP TRP A . n A 1 78 MET 78 159 159 MET MET A . n A 1 79 LYS 79 160 160 LYS LYS A . n A 1 80 GLU 80 161 161 GLU GLU A . n A 1 81 LYS 81 162 162 LYS LYS A . n A 1 82 ASP 82 163 163 ASP ASP A . n A 1 83 ILE 83 164 164 ILE ILE A . n A 1 84 VAL 84 165 165 VAL VAL A . n A 1 85 LYS 85 166 166 LYS LYS A . n A 1 86 LEU 86 167 167 LEU LEU A . n A 1 87 PRO 87 168 168 PRO PRO A . n A 1 88 GLU 88 169 169 GLU GLU A . n A 1 89 LYS 89 170 170 LYS LYS A . n A 1 90 LEU 90 171 171 LEU LEU A . n A 1 91 LEU 91 172 172 LEU LEU A . n A 1 92 PHE 92 173 173 PHE PHE A . n A 1 93 SER 93 174 174 SER SER A . n A 1 94 GLN 94 175 175 GLN GLN A . n A 1 95 GLY 95 176 176 GLY GLY A . n A 1 96 CYS 96 177 177 CYS CYS A . n A 1 97 ASN 97 178 178 ASN ASN A . n A 1 98 TRP 98 179 179 TRP TRP A . n A 1 99 ILE 99 180 180 ILE ILE A . n A 1 100 GLN 100 181 181 GLN GLN A . n A 1 101 GLN 101 182 182 GLN GLN A . n A 1 102 TYR 102 183 183 TYR TYR A . n A 1 103 SER 103 184 184 SER SER A . n A 1 104 PHE 104 185 185 PHE PHE A . n A 1 105 GLY 105 186 186 GLY GLY A . n A 1 106 PRO 106 187 187 PRO PRO A . n A 1 107 GLU 107 188 188 GLU GLU A . n A 1 108 LYS 108 189 189 LYS LYS A . n A 1 109 TYR 109 190 190 TYR TYR A . n A 1 110 THR 110 191 191 THR THR A . n A 1 111 GLY 111 192 192 GLY GLY A . n A 1 112 SER 112 193 193 SER SER A . n A 1 113 ASN 113 194 194 ASN ASN A . n A 1 114 VAL 114 195 195 VAL VAL A . n A 1 115 PHE 115 196 196 PHE PHE A . n A 1 116 GLY 116 197 197 GLY GLY A . n A 1 117 LYS 117 198 198 LYS LYS A . n A 1 118 LEU 118 199 199 LEU LEU A . n A 1 119 ARG 119 200 200 ARG ARG A . n A 1 120 LYS 120 201 201 LYS LYS A . n A 1 121 TYR 121 202 202 TYR TYR A . n A 1 122 VAL 122 203 203 VAL VAL A . n A 1 123 GLU 123 204 204 GLU GLU A . n A 1 124 LEU 124 205 205 LEU LEU A . n A 1 125 LEU 125 206 206 LEU LEU A . n A 1 126 LYS 126 207 207 LYS LYS A . n A 1 127 THR 127 208 208 THR THR A . n A 1 128 GLN 128 209 209 GLN GLN A . n A 1 129 TRP 129 210 210 TRP TRP A . n A 1 130 THR 130 211 211 THR THR A . n A 1 131 GLU 131 212 212 GLU GLU A . n A 1 132 PHE 132 213 213 PHE PHE A . n A 1 133 ASN 133 214 214 ASN ASN A . n A 1 134 GLY 134 215 215 GLY GLY A . n A 1 135 ILE 135 216 216 ILE ILE A . n A 1 136 ARG 136 217 217 ARG ARG A . n A 1 137 ASP 137 218 218 ASP ASP A . n A 1 138 TYR 138 219 219 TYR TYR A . n A 1 139 HIS 139 220 220 HIS HIS A . n A 1 140 LYS 140 221 221 LYS LYS A . n A 1 141 ARG 141 222 222 ARG ARG A . n A 1 142 GLY 142 223 223 GLY GLY A . n A 1 143 SER 143 224 224 SER SER A . n A 1 144 MET 144 225 225 MET MET A . n A 1 145 CYS 145 226 226 CYS CYS A . n A 1 146 ASN 146 227 227 ASN ASN A . n A 1 147 THR 147 228 228 THR THR A . n A 1 148 LEU 148 229 229 LEU LEU A . n A 1 149 PHE 149 230 230 PHE PHE A . n A 1 150 SER 150 231 231 SER SER A . n A 1 151 ASP 151 232 232 ASP ASP A . n A 1 152 ALA 152 233 233 ALA ALA A . n A 1 153 ILE 153 234 234 ILE ILE A . n A 1 154 LEU 154 235 235 LEU LEU A . n A 1 155 GLU 155 236 236 GLU GLU A . n A 1 156 TYR 156 237 237 TYR TYR A . n A 1 157 LYS 157 238 238 LYS LYS A . n A 1 158 LEU 158 239 239 LEU LEU A . n A 1 159 TYR 159 240 240 TYR TYR A . n A 1 160 GLU 160 241 241 GLU GLU A . n A 1 161 ALA 161 242 242 ALA ALA A . n A 1 162 LEU 162 243 243 LEU LEU A . n A 1 163 LYS 163 244 244 LYS LYS A . n A 1 164 PHE 164 245 245 PHE PHE A . n A 1 165 ILE 165 246 246 ILE ILE A . n A 1 166 MET 166 247 247 MET MET A . n A 1 167 LEU 167 248 248 LEU LEU A . n A 1 168 TYR 168 249 249 TYR TYR A . n A 1 169 GLN 169 250 250 GLN GLN A . n A 1 170 VAL 170 251 251 VAL VAL A . n A 1 171 THR 171 252 252 THR THR A . n A 1 172 GLU 172 253 253 GLU GLU A . n A 1 173 VAL 173 254 254 VAL VAL A . n A 1 174 TYR 174 255 255 TYR TYR A . n A 1 175 GLU 175 256 256 GLU GLU A . n A 1 176 GLN 176 257 257 GLN GLN A . n A 1 177 MET 177 258 258 MET MET A . n A 1 178 LYS 178 259 259 LYS LYS A . n A 1 179 THR 179 260 260 THR THR A . n A 1 180 LYS 180 261 261 LYS LYS A . n A 1 181 LYS 181 262 262 LYS LYS A . n A 1 182 VAL 182 263 263 VAL VAL A . n A 1 183 ILE 183 264 264 ILE ILE A . n A 1 184 PRO 184 265 265 PRO PRO A . n A 1 185 SER 185 266 266 SER SER A . n A 1 186 LEU 186 267 267 LEU LEU A . n A 1 187 PHE 187 268 268 PHE PHE A . n A 1 188 ARG 188 269 269 ARG ARG A . n A 1 189 LEU 189 270 270 LEU LEU A . n A 1 190 LEU 190 271 271 LEU LEU A . n A 1 191 PHE 191 272 272 PHE PHE A . n A 1 192 SER 192 273 273 SER SER A . n A 1 193 ARG 193 274 274 ARG ARG A . n A 1 194 GLU 194 275 275 GLU GLU A . n A 1 195 THR 195 276 276 THR THR A . n A 1 196 SER 196 277 277 SER SER A . n A 1 197 SER 197 278 278 SER SER A . n A 1 198 ASP 198 279 279 ASP ASP A . n A 1 199 PRO 199 280 280 PRO PRO A . n A 1 200 LEU 200 281 281 LEU LEU A . n A 1 201 SER 201 282 282 SER SER A . n A 1 202 PHE 202 283 283 PHE PHE A . n A 1 203 MET 203 284 284 MET MET A . n A 1 204 MET 204 285 285 MET MET A . n A 1 205 ASN 205 286 286 ASN ASN A . n A 1 206 HIS 206 287 287 HIS HIS A . n A 1 207 LEU 207 288 288 LEU LEU A . n A 1 208 ASN 208 289 289 ASN ASN A . n A 1 209 SER 209 290 290 SER SER A . n A 1 210 VAL 210 291 291 VAL VAL A . n A 1 211 GLY 211 292 292 GLY GLY A . n A 1 212 ASP 212 293 293 ASP ASP A . n A 1 213 THR 213 294 294 THR THR A . n A 1 214 CYS 214 295 295 CYS CYS A . n A 1 215 GLY 215 296 296 GLY GLY A . n A 1 216 LEU 216 297 297 LEU LEU A . n A 1 217 GLU 217 298 298 GLU GLU A . n A 1 218 GLN 218 299 299 GLN GLN A . n A 1 219 ILE 219 300 300 ILE ILE A . n A 1 220 ASP 220 301 301 ASP ASP A . n A 1 221 MET 221 302 302 MET MET A . n A 1 222 PHE 222 303 303 PHE PHE A . n A 1 223 ILE 223 304 304 ILE ILE A . n A 1 224 LEU 224 305 305 LEU LEU A . n A 1 225 GLY 225 306 306 GLY GLY A . n A 1 226 TYR 226 307 307 TYR TYR A . n A 1 227 SER 227 308 308 SER SER A . n A 1 228 LEU 228 309 309 LEU LEU A . n A 1 229 GLU 229 310 310 GLU GLU A . n A 1 230 VAL 230 311 311 VAL VAL A . n A 1 231 LYS 231 312 312 LYS LYS A . n A 1 232 ILE 232 313 313 ILE ILE A . n A 1 233 LYS 233 314 314 LYS LYS A . n A 1 234 VAL 234 315 315 VAL VAL A . n A 1 235 PHE 235 316 316 PHE PHE A . n A 1 236 ARG 236 317 317 ARG ARG A . n A 1 237 LEU 237 318 318 LEU LEU A . n A 1 238 PHE 238 319 319 PHE PHE A . n A 1 239 LYS 239 320 320 LYS LYS A . n A 1 240 PHE 240 321 321 PHE PHE A . n A 1 241 ASN 241 322 322 ASN ASN A . n A 1 242 SER 242 323 323 SER SER A . n A 1 243 ARG 243 324 324 ARG ARG A . n A 1 244 ASP 244 325 325 ASP ASP A . n A 1 245 PHE 245 326 326 PHE PHE A . n A 1 246 GLU 246 327 327 GLU GLU A . n A 1 247 VAL 247 328 328 VAL VAL A . n A 1 248 CYS 248 329 329 CYS CYS A . n A 1 249 TYR 249 330 330 TYR TYR A . n A 1 250 PRO 250 331 331 PRO PRO A . n A 1 251 GLU 251 332 332 GLU GLU A . n A 1 252 GLU 252 333 333 GLU GLU A . n A 1 253 PRO 253 334 334 PRO PRO A . n A 1 254 LEU 254 335 335 LEU LEU A . n A 1 255 ARG 255 336 336 ARG ARG A . n A 1 256 ASP 256 337 337 ASP ASP A . n A 1 257 TRP 257 338 338 TRP TRP A . n A 1 258 PRO 258 339 339 PRO PRO A . n A 1 259 GLU 259 340 340 GLU GLU A . n A 1 260 ILE 260 341 341 ILE ILE A . n A 1 261 SER 261 342 342 SER SER A . n A 1 262 LEU 262 343 343 LEU LEU A . n A 1 263 LEU 263 344 344 LEU LEU A . n A 1 264 THR 264 345 345 THR THR A . n A 1 265 GLU 265 346 346 GLU GLU A . n A 1 266 ASN 266 347 347 ASN ASN A . n A 1 267 ASP 267 348 348 ASP ASP A . n A 1 268 ARG 268 349 349 ARG ARG A . n A 1 269 HIS 269 350 350 HIS HIS A . n A 1 270 TYR 270 351 351 TYR TYR A . n A 1 271 HIS 271 352 352 HIS HIS A . n A 1 272 ILE 272 353 353 ILE ILE A . n A 1 273 PRO 273 354 354 PRO PRO A . n A 1 274 VAL 274 355 355 VAL VAL A . n A 1 275 PHE 275 356 356 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 32 HOH HOH A . B 2 HOH 2 402 21 HOH HOH A . B 2 HOH 3 403 11 HOH HOH A . B 2 HOH 4 404 2 HOH HOH A . B 2 HOH 5 405 15 HOH HOH A . B 2 HOH 6 406 5 HOH HOH A . B 2 HOH 7 407 4 HOH HOH A . B 2 HOH 8 408 9 HOH HOH A . B 2 HOH 9 409 17 HOH HOH A . B 2 HOH 10 410 12 HOH HOH A . B 2 HOH 11 411 29 HOH HOH A . B 2 HOH 12 412 33 HOH HOH A . B 2 HOH 13 413 34 HOH HOH A . B 2 HOH 14 414 7 HOH HOH A . B 2 HOH 15 415 13 HOH HOH A . B 2 HOH 16 416 10 HOH HOH A . B 2 HOH 17 417 37 HOH HOH A . B 2 HOH 18 418 31 HOH HOH A . B 2 HOH 19 419 30 HOH HOH A . B 2 HOH 20 420 36 HOH HOH A . B 2 HOH 21 421 25 HOH HOH A . B 2 HOH 22 422 20 HOH HOH A . B 2 HOH 23 423 35 HOH HOH A . B 2 HOH 24 424 18 HOH HOH A . B 2 HOH 25 425 26 HOH HOH A . B 2 HOH 26 426 8 HOH HOH A . B 2 HOH 27 427 14 HOH HOH A . B 2 HOH 28 428 3 HOH HOH A . B 2 HOH 29 429 28 HOH HOH A . B 2 HOH 30 430 1 HOH HOH A . B 2 HOH 31 431 19 HOH HOH A . B 2 HOH 32 432 23 HOH HOH A . B 2 HOH 33 433 6 HOH HOH A . B 2 HOH 34 434 16 HOH HOH A . B 2 HOH 35 435 24 HOH HOH A . B 2 HOH 36 436 22 HOH HOH A . B 2 HOH 37 437 27 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12580 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-08 2 'Structure model' 1 1 2019-05-22 3 'Structure model' 1 2 2019-11-13 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' diffrn_source 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.type' 2 3 'Structure model' '_citation.journal_id_CSD' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation.pdbx_database_id_PubMed' 6 3 'Structure model' '_citation.title' 7 3 'Structure model' '_citation_author.name' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -47.0460 -3.5498 11.2642 0.5696 0.5708 0.4700 0.0056 0.1012 -0.0181 8.3606 4.2462 4.8829 0.7493 0.6285 -0.8968 -0.0126 0.0903 -0.0671 -0.8715 0.5039 0.6074 0.3831 -0.6545 -0.4593 'X-RAY DIFFRACTION' 2 ? refined -17.5091 -2.8035 3.2753 0.3265 0.5392 0.3072 0.0553 -0.0610 -0.0419 6.6509 3.5857 2.6755 2.1222 -0.1014 -0.4602 0.0690 -0.0706 0.0210 -0.4149 -0.1088 -0.4249 0.1622 -0.0650 0.6774 'X-RAY DIFFRACTION' 3 ? refined -21.7717 2.2945 -1.3281 0.3522 0.5037 0.3997 -0.0339 0.0050 -0.1358 2.5067 2.1040 4.0838 0.1479 -0.2955 -1.6116 0.0897 0.0148 -0.1097 -0.3420 -0.0106 -0.0606 -0.0522 0.0169 0.3722 'X-RAY DIFFRACTION' 4 ? refined -37.9321 -1.8048 -1.3408 0.4170 0.5153 0.5161 -0.0619 -0.0268 -0.0426 6.9511 4.0700 3.7956 -1.0191 -3.2200 -1.8132 0.1225 0.3031 -0.2451 0.5381 0.1389 0.2750 -0.1272 -0.1051 -0.4088 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 87 A 125 ;chain 'A' and (resid 87 through 125 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 126 A 214 ;chain 'A' and (resid 126 through 214 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 215 A 309 ;chain 'A' and (resid 215 through 309 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 310 A 356 ;chain 'A' and (resid 310 through 356 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20170923 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 20170923 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.2 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 333 ? ? O A HOH 401 ? ? 2.07 2 1 OE1 A GLU 188 ? ? NZ A LYS 198 ? ? 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 135 ? ? -121.30 -58.64 2 1 HIS A 287 ? ? -130.37 -56.59 3 1 ASP A 293 ? ? -103.12 -63.12 4 1 ASP A 325 ? ? -89.27 47.83 5 1 GLU A 333 ? ? -109.49 78.38 6 1 ASN A 347 ? ? -152.91 15.86 7 1 ASP A 348 ? ? 58.95 13.98 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 102 ? CG ? A ARG 21 CG 2 1 Y 1 A ARG 102 ? CD ? A ARG 21 CD 3 1 Y 1 A ARG 102 ? NE ? A ARG 21 NE 4 1 Y 1 A ARG 102 ? CZ ? A ARG 21 CZ 5 1 Y 1 A ARG 102 ? NH1 ? A ARG 21 NH1 6 1 Y 1 A ARG 102 ? NH2 ? A ARG 21 NH2 7 1 Y 1 A LYS 105 ? CG ? A LYS 24 CG 8 1 Y 1 A LYS 105 ? CD ? A LYS 24 CD 9 1 Y 1 A LYS 105 ? CE ? A LYS 24 CE 10 1 Y 1 A LYS 105 ? NZ ? A LYS 24 NZ 11 1 Y 1 A ARG 110 ? CG ? A ARG 29 CG 12 1 Y 1 A ARG 110 ? CD ? A ARG 29 CD 13 1 Y 1 A ARG 110 ? NE ? A ARG 29 NE 14 1 Y 1 A ARG 110 ? CZ ? A ARG 29 CZ 15 1 Y 1 A ARG 110 ? NH1 ? A ARG 29 NH1 16 1 Y 1 A ARG 110 ? NH2 ? A ARG 29 NH2 17 1 Y 1 A LYS 112 ? CG ? A LYS 31 CG 18 1 Y 1 A LYS 112 ? CD ? A LYS 31 CD 19 1 Y 1 A LYS 112 ? CE ? A LYS 31 CE 20 1 Y 1 A LYS 112 ? NZ ? A LYS 31 NZ 21 1 Y 1 A LYS 160 ? CG ? A LYS 79 CG 22 1 Y 1 A LYS 160 ? CD ? A LYS 79 CD 23 1 Y 1 A LYS 160 ? CE ? A LYS 79 CE 24 1 Y 1 A LYS 160 ? NZ ? A LYS 79 NZ 25 1 Y 1 A LYS 166 ? CG ? A LYS 85 CG 26 1 Y 1 A LYS 166 ? CD ? A LYS 85 CD 27 1 Y 1 A LYS 166 ? CE ? A LYS 85 CE 28 1 Y 1 A LYS 166 ? NZ ? A LYS 85 NZ 29 1 Y 1 A ARG 217 ? CG ? A ARG 136 CG 30 1 Y 1 A ARG 217 ? CD ? A ARG 136 CD 31 1 Y 1 A ARG 217 ? NE ? A ARG 136 NE 32 1 Y 1 A ARG 217 ? CZ ? A ARG 136 CZ 33 1 Y 1 A ARG 217 ? NH1 ? A ARG 136 NH1 34 1 Y 1 A ARG 217 ? NH2 ? A ARG 136 NH2 35 1 Y 1 A LEU 335 ? CG ? A LEU 254 CG 36 1 Y 1 A LEU 335 ? CD1 ? A LEU 254 CD1 37 1 Y 1 A LEU 335 ? CD2 ? A LEU 254 CD2 38 1 Y 1 A ARG 336 ? CG ? A ARG 255 CG 39 1 Y 1 A ARG 336 ? CD ? A ARG 255 CD 40 1 Y 1 A ARG 336 ? NE ? A ARG 255 NE 41 1 Y 1 A ARG 336 ? CZ ? A ARG 255 CZ 42 1 Y 1 A ARG 336 ? NH1 ? A ARG 255 NH1 43 1 Y 1 A ARG 336 ? NH2 ? A ARG 255 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 82 ? A GLY 1 2 1 Y 1 A ALA 83 ? A ALA 2 3 1 Y 1 A MET 84 ? A MET 3 4 1 Y 1 A GLY 85 ? A GLY 4 5 1 Y 1 A SER 86 ? A SER 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4KSJ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #