data_6DXR # _entry.id 6DXR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6DXR pdb_00006dxr 10.2210/pdb6dxr/pdb WWPDB D_1000235373 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6DXR _pdbx_database_status.recvd_initial_deposition_date 2018-06-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'McPherson, A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Lipid Res.' _citation.journal_id_ASTM JLPRAW _citation.journal_id_CSD 0484 _citation.journal_id_ISSN 1539-7262 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 400 _citation.page_last 411 _citation.title 'The structure of human apolipoprotein C-1 in four different crystal forms.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1194/jlr.M089441 _citation.pdbx_database_id_PubMed 30559175 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McPherson, A.' 1 ? primary 'Larson, S.B.' 2 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 94.14 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6DXR _cell.details ? _cell.formula_units_Z ? _cell.length_a 27.889 _cell.length_a_esd ? _cell.length_b 46.472 _cell.length_b_esd ? _cell.length_c 34.088 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6DXR _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Apolipoprotein C-I' 9344.909 2 ? ? ? ? 2 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 2 ? ? ? ? 3 water nat water 18.015 24 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ApoC-I,Apolipoprotein C1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLK IDS ; _entity_poly.pdbx_seq_one_letter_code_can ;MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLK IDS ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 LEU n 1 4 PHE n 1 5 LEU n 1 6 SER n 1 7 LEU n 1 8 PRO n 1 9 VAL n 1 10 LEU n 1 11 VAL n 1 12 VAL n 1 13 VAL n 1 14 LEU n 1 15 SER n 1 16 ILE n 1 17 VAL n 1 18 LEU n 1 19 GLU n 1 20 GLY n 1 21 PRO n 1 22 ALA n 1 23 PRO n 1 24 ALA n 1 25 GLN n 1 26 GLY n 1 27 THR n 1 28 PRO n 1 29 ASP n 1 30 VAL n 1 31 SER n 1 32 SER n 1 33 ALA n 1 34 LEU n 1 35 ASP n 1 36 LYS n 1 37 LEU n 1 38 LYS n 1 39 GLU n 1 40 PHE n 1 41 GLY n 1 42 ASN n 1 43 THR n 1 44 LEU n 1 45 GLU n 1 46 ASP n 1 47 LYS n 1 48 ALA n 1 49 ARG n 1 50 GLU n 1 51 LEU n 1 52 ILE n 1 53 SER n 1 54 ARG n 1 55 ILE n 1 56 LYS n 1 57 GLN n 1 58 SER n 1 59 GLU n 1 60 LEU n 1 61 SER n 1 62 ALA n 1 63 LYS n 1 64 MET n 1 65 ARG n 1 66 GLU n 1 67 TRP n 1 68 PHE n 1 69 SER n 1 70 GLU n 1 71 THR n 1 72 PHE n 1 73 GLN n 1 74 LYS n 1 75 VAL n 1 76 LYS n 1 77 GLU n 1 78 LYS n 1 79 LEU n 1 80 LYS n 1 81 ILE n 1 82 ASP n 1 83 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 83 _entity_src_nat.common_name Human _entity_src_nat.pdbx_organism_scientific 'Homo sapiens' _entity_src_nat.pdbx_ncbi_taxonomy_id 9606 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APOC1_HUMAN _struct_ref.pdbx_db_accession P02654 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLK IDS ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6DXR A 1 ? 83 ? P02654 1 ? 83 ? -25 57 2 1 6DXR B 1 ? 83 ? P02654 1 ? 83 ? -25 57 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6DXR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 25 _exptl_crystal.description 'thin laths' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG' _exptl_crystal_grow.pdbx_pH_range '5.5 -6.5' # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.diffrn_id 1 _diffrn_detector.type SDMS _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 1992-06-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Supper _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6DXR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 34.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5912 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rmerge_I_obs .144 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value .144 _reflns.pdbx_netI_over_av_sigmaI 4.5 _reflns.pdbx_netI_over_sigmaI 4.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all .152 _reflns.pdbx_Rpim_I_all .079 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half .996 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.10 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 406 _reflns_shell.percent_possible_all 97.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs .656 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.7 _reflns_shell.pdbx_Rsym_value .656 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all .842 _reflns_shell.pdbx_Rpim_I_all .417 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half .567 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 2.84 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -1.41 _refine.aniso_B[2][2] -0.77 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -1.84 _refine.B_iso_max ? _refine.B_iso_mean 46.393 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.899 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6DXR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 34.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5585 _refine.ls_number_reflns_R_free 301 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.94 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.24110 _refine.ls_R_factor_R_free 0.28747 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23875 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1ROP _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.343 _refine.pdbx_overall_ESU_R_Free 0.239 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.706 _refine.overall_SU_ML 0.212 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 880 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 920 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 34.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.020 913 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 924 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.157 2.000 1214 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.625 3.000 2155 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.210 5.000 109 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.680 25.122 41 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.148 15.000 206 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.052 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.060 0.200 136 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 949 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.000 0.020 173 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.322 3.895 430 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.060 3.874 429 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.849 5.769 535 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.868 5.787 536 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 8.138 4.952 483 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 8.130 4.955 484 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 12.540 7.034 678 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 16.082 73.031 3553 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 16.080 73.038 3554 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_R_work 378 _refine_ls_shell.percent_reflns_obs 96.17 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.410 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.480 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6DXR _struct.title 'Structure of the Monoclinic-2 (Monocl-2) Crystal Form of Human Apolipoprotein C1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6DXR _struct_keywords.text 'lipoprotein particles, lipids, alpha helix, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 31 ? LEU A 79 ? SER A 5 LEU A 53 1 ? 49 HELX_P HELX_P2 AA2 ASP B 29 ? ILE B 81 ? ASP B 3 ILE B 55 1 ? 53 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MPD 101 ? 3 'binding site for residue MPD A 101' AC2 Software A MPD 102 ? 2 'binding site for residue MPD A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLU A 50 ? GLU A 24 . ? 1_555 ? 2 AC1 3 ARG A 54 ? ARG A 28 . ? 1_555 ? 3 AC1 3 TRP B 67 ? TRP B 41 . ? 1_555 ? 4 AC2 2 HOH E . ? HOH A 203 . ? 1_555 ? 5 AC2 2 LYS B 47 ? LYS B 21 . ? 1_655 ? # _atom_sites.entry_id 6DXR _atom_sites.fract_transf_matrix[1][1] 0.035856 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002598 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021518 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029413 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -25 ? ? ? A . n A 1 2 ARG 2 -24 ? ? ? A . n A 1 3 LEU 3 -23 ? ? ? A . n A 1 4 PHE 4 -22 ? ? ? A . n A 1 5 LEU 5 -21 ? ? ? A . n A 1 6 SER 6 -20 ? ? ? A . n A 1 7 LEU 7 -19 ? ? ? A . n A 1 8 PRO 8 -18 ? ? ? A . n A 1 9 VAL 9 -17 ? ? ? A . n A 1 10 LEU 10 -16 ? ? ? A . n A 1 11 VAL 11 -15 ? ? ? A . n A 1 12 VAL 12 -14 ? ? ? A . n A 1 13 VAL 13 -13 ? ? ? A . n A 1 14 LEU 14 -12 ? ? ? A . n A 1 15 SER 15 -11 ? ? ? A . n A 1 16 ILE 16 -10 ? ? ? A . n A 1 17 VAL 17 -9 ? ? ? A . n A 1 18 LEU 18 -8 ? ? ? A . n A 1 19 GLU 19 -7 ? ? ? A . n A 1 20 GLY 20 -6 ? ? ? A . n A 1 21 PRO 21 -5 ? ? ? A . n A 1 22 ALA 22 -4 ? ? ? A . n A 1 23 PRO 23 -3 ? ? ? A . n A 1 24 ALA 24 -2 ? ? ? A . n A 1 25 GLN 25 -1 ? ? ? A . n A 1 26 GLY 26 0 ? ? ? A . n A 1 27 THR 27 1 ? ? ? A . n A 1 28 PRO 28 2 ? ? ? A . n A 1 29 ASP 29 3 ? ? ? A . n A 1 30 VAL 30 4 ? ? ? A . n A 1 31 SER 31 5 5 SER SER A . n A 1 32 SER 32 6 6 SER SER A . n A 1 33 ALA 33 7 7 ALA ALA A . n A 1 34 LEU 34 8 8 LEU LEU A . n A 1 35 ASP 35 9 9 ASP ASP A . n A 1 36 LYS 36 10 10 LYS LYS A . n A 1 37 LEU 37 11 11 LEU LEU A . n A 1 38 LYS 38 12 12 LYS LYS A . n A 1 39 GLU 39 13 13 GLU GLU A . n A 1 40 PHE 40 14 14 PHE PHE A . n A 1 41 GLY 41 15 15 GLY GLY A . n A 1 42 ASN 42 16 16 ASN ASN A . n A 1 43 THR 43 17 17 THR THR A . n A 1 44 LEU 44 18 18 LEU LEU A . n A 1 45 GLU 45 19 19 GLU GLU A . n A 1 46 ASP 46 20 20 ASP ASP A . n A 1 47 LYS 47 21 21 LYS LYS A . n A 1 48 ALA 48 22 22 ALA ALA A . n A 1 49 ARG 49 23 23 ARG ARG A . n A 1 50 GLU 50 24 24 GLU GLU A . n A 1 51 LEU 51 25 25 LEU LEU A . n A 1 52 ILE 52 26 26 ILE ILE A . n A 1 53 SER 53 27 27 SER SER A . n A 1 54 ARG 54 28 28 ARG ARG A . n A 1 55 ILE 55 29 29 ILE ILE A . n A 1 56 LYS 56 30 30 LYS LYS A . n A 1 57 GLN 57 31 31 GLN GLN A . n A 1 58 SER 58 32 32 SER SER A . n A 1 59 GLU 59 33 33 GLU GLU A . n A 1 60 LEU 60 34 34 LEU LEU A . n A 1 61 SER 61 35 35 SER SER A . n A 1 62 ALA 62 36 36 ALA ALA A . n A 1 63 LYS 63 37 37 LYS LYS A . n A 1 64 MET 64 38 38 MET MET A . n A 1 65 ARG 65 39 39 ARG ARG A . n A 1 66 GLU 66 40 40 GLU GLU A . n A 1 67 TRP 67 41 41 TRP TRP A . n A 1 68 PHE 68 42 42 PHE PHE A . n A 1 69 SER 69 43 43 SER SER A . n A 1 70 GLU 70 44 44 GLU GLU A . n A 1 71 THR 71 45 45 THR THR A . n A 1 72 PHE 72 46 46 PHE PHE A . n A 1 73 GLN 73 47 47 GLN GLN A . n A 1 74 LYS 74 48 48 LYS LYS A . n A 1 75 VAL 75 49 49 VAL VAL A . n A 1 76 LYS 76 50 50 LYS LYS A . n A 1 77 GLU 77 51 51 GLU GLU A . n A 1 78 LYS 78 52 52 LYS LYS A . n A 1 79 LEU 79 53 53 LEU LEU A . n A 1 80 LYS 80 54 54 LYS LYS A . n A 1 81 ILE 81 55 55 ILE ILE A . n A 1 82 ASP 82 56 ? ? ? A . n A 1 83 SER 83 57 ? ? ? A . n B 1 1 MET 1 -25 ? ? ? B . n B 1 2 ARG 2 -24 ? ? ? B . n B 1 3 LEU 3 -23 ? ? ? B . n B 1 4 PHE 4 -22 ? ? ? B . n B 1 5 LEU 5 -21 ? ? ? B . n B 1 6 SER 6 -20 ? ? ? B . n B 1 7 LEU 7 -19 ? ? ? B . n B 1 8 PRO 8 -18 ? ? ? B . n B 1 9 VAL 9 -17 ? ? ? B . n B 1 10 LEU 10 -16 ? ? ? B . n B 1 11 VAL 11 -15 ? ? ? B . n B 1 12 VAL 12 -14 ? ? ? B . n B 1 13 VAL 13 -13 ? ? ? B . n B 1 14 LEU 14 -12 ? ? ? B . n B 1 15 SER 15 -11 ? ? ? B . n B 1 16 ILE 16 -10 ? ? ? B . n B 1 17 VAL 17 -9 ? ? ? B . n B 1 18 LEU 18 -8 ? ? ? B . n B 1 19 GLU 19 -7 ? ? ? B . n B 1 20 GLY 20 -6 ? ? ? B . n B 1 21 PRO 21 -5 ? ? ? B . n B 1 22 ALA 22 -4 ? ? ? B . n B 1 23 PRO 23 -3 ? ? ? B . n B 1 24 ALA 24 -2 ? ? ? B . n B 1 25 GLN 25 -1 ? ? ? B . n B 1 26 GLY 26 0 ? ? ? B . n B 1 27 THR 27 1 ? ? ? B . n B 1 28 PRO 28 2 2 PRO PRO B . n B 1 29 ASP 29 3 3 ASP ASP B . n B 1 30 VAL 30 4 4 VAL VAL B . n B 1 31 SER 31 5 5 SER SER B . n B 1 32 SER 32 6 6 SER SER B . n B 1 33 ALA 33 7 7 ALA ALA B . n B 1 34 LEU 34 8 8 LEU LEU B . n B 1 35 ASP 35 9 9 ASP ASP B . n B 1 36 LYS 36 10 10 LYS LYS B . n B 1 37 LEU 37 11 11 LEU LEU B . n B 1 38 LYS 38 12 12 LYS LYS B . n B 1 39 GLU 39 13 13 GLU GLU B . n B 1 40 PHE 40 14 14 PHE PHE B . n B 1 41 GLY 41 15 15 GLY GLY B . n B 1 42 ASN 42 16 16 ASN ASN B . n B 1 43 THR 43 17 17 THR THR B . n B 1 44 LEU 44 18 18 LEU LEU B . n B 1 45 GLU 45 19 19 GLU GLU B . n B 1 46 ASP 46 20 20 ASP ASP B . n B 1 47 LYS 47 21 21 LYS LYS B . n B 1 48 ALA 48 22 22 ALA ALA B . n B 1 49 ARG 49 23 23 ARG ARG B . n B 1 50 GLU 50 24 24 GLU GLU B . n B 1 51 LEU 51 25 25 LEU LEU B . n B 1 52 ILE 52 26 26 ILE ILE B . n B 1 53 SER 53 27 27 SER SER B . n B 1 54 ARG 54 28 28 ARG ARG B . n B 1 55 ILE 55 29 29 ILE ILE B . n B 1 56 LYS 56 30 30 LYS LYS B . n B 1 57 GLN 57 31 31 GLN GLN B . n B 1 58 SER 58 32 32 SER SER B . n B 1 59 GLU 59 33 33 GLU GLU B . n B 1 60 LEU 60 34 34 LEU LEU B . n B 1 61 SER 61 35 35 SER SER B . n B 1 62 ALA 62 36 36 ALA ALA B . n B 1 63 LYS 63 37 37 LYS LYS B . n B 1 64 MET 64 38 38 MET MET B . n B 1 65 ARG 65 39 39 ARG ARG B . n B 1 66 GLU 66 40 40 GLU GLU B . n B 1 67 TRP 67 41 41 TRP TRP B . n B 1 68 PHE 68 42 42 PHE PHE B . n B 1 69 SER 69 43 43 SER SER B . n B 1 70 GLU 70 44 44 GLU GLU B . n B 1 71 THR 71 45 45 THR THR B . n B 1 72 PHE 72 46 46 PHE PHE B . n B 1 73 GLN 73 47 47 GLN GLN B . n B 1 74 LYS 74 48 48 LYS LYS B . n B 1 75 VAL 75 49 49 VAL VAL B . n B 1 76 LYS 76 50 50 LYS LYS B . n B 1 77 GLU 77 51 51 GLU GLU B . n B 1 78 LYS 78 52 52 LYS LYS B . n B 1 79 LEU 79 53 53 LEU LEU B . n B 1 80 LYS 80 54 54 LYS LYS B . n B 1 81 ILE 81 55 55 ILE ILE B . n B 1 82 ASP 82 56 56 ASP ASP B . n B 1 83 SER 83 57 57 SER SER B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 MPD 1 101 4 MPD MPD A . D 2 MPD 1 102 7 MPD MPD A . E 3 HOH 1 201 17 HOH HOH A . E 3 HOH 2 202 1 HOH HOH A . E 3 HOH 3 203 27 HOH HOH A . E 3 HOH 4 204 38 HOH HOH A . E 3 HOH 5 205 34 HOH HOH A . E 3 HOH 6 206 11 HOH HOH A . E 3 HOH 7 207 16 HOH HOH A . F 3 HOH 1 101 41 HOH HOH B . F 3 HOH 2 102 21 HOH HOH B . F 3 HOH 3 103 23 HOH HOH B . F 3 HOH 4 104 14 HOH HOH B . F 3 HOH 5 105 47 HOH HOH B . F 3 HOH 6 106 42 HOH HOH B . F 3 HOH 7 107 12 HOH HOH B . F 3 HOH 8 108 2 HOH HOH B . F 3 HOH 9 109 30 HOH HOH B . F 3 HOH 10 110 46 HOH HOH B . F 3 HOH 11 111 3 HOH HOH B . F 3 HOH 12 112 24 HOH HOH B . F 3 HOH 13 113 6 HOH HOH B . F 3 HOH 14 114 39 HOH HOH B . F 3 HOH 15 115 25 HOH HOH B . F 3 HOH 16 116 4 HOH HOH B . F 3 HOH 17 117 40 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D,E 1 2 B,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1880 ? 1 MORE -26 ? 1 'SSA (A^2)' 9350 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 1_656 x+1,y,z+1 1.0000000000 0.0000000000 0.0000000000 25.4280587041 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 33.9990516329 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-26 2 'Structure model' 1 1 2019-01-16 3 'Structure model' 1 2 2019-02-13 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_ISSN' 3 2 'Structure model' '_citation.pdbx_database_id_DOI' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation.title' 11 3 'Structure model' '_citation.year' 12 4 'Structure model' '_database_2.pdbx_DOI' 13 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 56 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.84 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 44 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 ILE _pdbx_validate_symm_contact.auth_seq_id_2 55 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_757 _pdbx_validate_symm_contact.dist 1.81 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -25 ? A MET 1 2 1 Y 1 A ARG -24 ? A ARG 2 3 1 Y 1 A LEU -23 ? A LEU 3 4 1 Y 1 A PHE -22 ? A PHE 4 5 1 Y 1 A LEU -21 ? A LEU 5 6 1 Y 1 A SER -20 ? A SER 6 7 1 Y 1 A LEU -19 ? A LEU 7 8 1 Y 1 A PRO -18 ? A PRO 8 9 1 Y 1 A VAL -17 ? A VAL 9 10 1 Y 1 A LEU -16 ? A LEU 10 11 1 Y 1 A VAL -15 ? A VAL 11 12 1 Y 1 A VAL -14 ? A VAL 12 13 1 Y 1 A VAL -13 ? A VAL 13 14 1 Y 1 A LEU -12 ? A LEU 14 15 1 Y 1 A SER -11 ? A SER 15 16 1 Y 1 A ILE -10 ? A ILE 16 17 1 Y 1 A VAL -9 ? A VAL 17 18 1 Y 1 A LEU -8 ? A LEU 18 19 1 Y 1 A GLU -7 ? A GLU 19 20 1 Y 1 A GLY -6 ? A GLY 20 21 1 Y 1 A PRO -5 ? A PRO 21 22 1 Y 1 A ALA -4 ? A ALA 22 23 1 Y 1 A PRO -3 ? A PRO 23 24 1 Y 1 A ALA -2 ? A ALA 24 25 1 Y 1 A GLN -1 ? A GLN 25 26 1 Y 1 A GLY 0 ? A GLY 26 27 1 Y 1 A THR 1 ? A THR 27 28 1 Y 1 A PRO 2 ? A PRO 28 29 1 Y 1 A ASP 3 ? A ASP 29 30 1 Y 1 A VAL 4 ? A VAL 30 31 1 Y 1 A ASP 56 ? A ASP 82 32 1 Y 1 A SER 57 ? A SER 83 33 1 Y 1 B MET -25 ? B MET 1 34 1 Y 1 B ARG -24 ? B ARG 2 35 1 Y 1 B LEU -23 ? B LEU 3 36 1 Y 1 B PHE -22 ? B PHE 4 37 1 Y 1 B LEU -21 ? B LEU 5 38 1 Y 1 B SER -20 ? B SER 6 39 1 Y 1 B LEU -19 ? B LEU 7 40 1 Y 1 B PRO -18 ? B PRO 8 41 1 Y 1 B VAL -17 ? B VAL 9 42 1 Y 1 B LEU -16 ? B LEU 10 43 1 Y 1 B VAL -15 ? B VAL 11 44 1 Y 1 B VAL -14 ? B VAL 12 45 1 Y 1 B VAL -13 ? B VAL 13 46 1 Y 1 B LEU -12 ? B LEU 14 47 1 Y 1 B SER -11 ? B SER 15 48 1 Y 1 B ILE -10 ? B ILE 16 49 1 Y 1 B VAL -9 ? B VAL 17 50 1 Y 1 B LEU -8 ? B LEU 18 51 1 Y 1 B GLU -7 ? B GLU 19 52 1 Y 1 B GLY -6 ? B GLY 20 53 1 Y 1 B PRO -5 ? B PRO 21 54 1 Y 1 B ALA -4 ? B ALA 22 55 1 Y 1 B PRO -3 ? B PRO 23 56 1 Y 1 B ALA -2 ? B ALA 24 57 1 Y 1 B GLN -1 ? B GLN 25 58 1 Y 1 B GLY 0 ? B GLY 26 59 1 Y 1 B THR 1 ? B THR 27 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 MPD C1 C N N 215 MPD C2 C N N 216 MPD O2 O N N 217 MPD CM C N N 218 MPD C3 C N N 219 MPD C4 C N S 220 MPD O4 O N N 221 MPD C5 C N N 222 MPD H11 H N N 223 MPD H12 H N N 224 MPD H13 H N N 225 MPD HO2 H N N 226 MPD HM1 H N N 227 MPD HM2 H N N 228 MPD HM3 H N N 229 MPD H31 H N N 230 MPD H32 H N N 231 MPD H4 H N N 232 MPD HO4 H N N 233 MPD H51 H N N 234 MPD H52 H N N 235 MPD H53 H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 MPD C1 C2 sing N N 203 MPD C1 H11 sing N N 204 MPD C1 H12 sing N N 205 MPD C1 H13 sing N N 206 MPD C2 O2 sing N N 207 MPD C2 CM sing N N 208 MPD C2 C3 sing N N 209 MPD O2 HO2 sing N N 210 MPD CM HM1 sing N N 211 MPD CM HM2 sing N N 212 MPD CM HM3 sing N N 213 MPD C3 C4 sing N N 214 MPD C3 H31 sing N N 215 MPD C3 H32 sing N N 216 MPD C4 O4 sing N N 217 MPD C4 C5 sing N N 218 MPD C4 H4 sing N N 219 MPD O4 HO4 sing N N 220 MPD C5 H51 sing N N 221 MPD C5 H52 sing N N 222 MPD C5 H53 sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 VAL N CA sing N N 321 VAL N H sing N N 322 VAL N H2 sing N N 323 VAL CA C sing N N 324 VAL CA CB sing N N 325 VAL CA HA sing N N 326 VAL C O doub N N 327 VAL C OXT sing N N 328 VAL CB CG1 sing N N 329 VAL CB CG2 sing N N 330 VAL CB HB sing N N 331 VAL CG1 HG11 sing N N 332 VAL CG1 HG12 sing N N 333 VAL CG1 HG13 sing N N 334 VAL CG2 HG21 sing N N 335 VAL CG2 HG22 sing N N 336 VAL CG2 HG23 sing N N 337 VAL OXT HXT sing N N 338 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ROP _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #