data_6E9M # _entry.id 6E9M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6E9M pdb_00006e9m 10.2210/pdb6e9m/pdb WWPDB D_1000235949 ? ? BMRB 30505 ? 10.13018/BMR30505 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-07 2 'Structure model' 1 1 2020-01-08 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6E9M _pdbx_database_status.recvd_initial_deposition_date 2018-08-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR Structure of a Class I Hydrophobin from Wallemia ichthyophaga' _pdbx_database_related.db_id 30505 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kenward, C.' 1 ? 'Langelaan, D.N.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution NMR Structure of a Class I Hydrophobin from Wallemia ichthyophaga' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kenward, C.' 1 ? primary 'Langelaan, D.N.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Hydrophobin _entity.formula_weight 9444.642 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGWESKTGSCNTGKLACCDTNKKVQKSTGEESGLLHTGDVLDQVAIQCTQIPLLIGIAIEDECKNTPTCCEDVEDDGLV GINCTPIPLI ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGWESKTGSCNTGKLACCDTNKKVQKSTGEESGLLHTGDVLDQVAIQCTQIPLLIGIAIEDECKNTPTCCEDVEDDGLV GINCTPIPLI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 TRP n 1 5 GLU n 1 6 SER n 1 7 LYS n 1 8 THR n 1 9 GLY n 1 10 SER n 1 11 CYS n 1 12 ASN n 1 13 THR n 1 14 GLY n 1 15 LYS n 1 16 LEU n 1 17 ALA n 1 18 CYS n 1 19 CYS n 1 20 ASP n 1 21 THR n 1 22 ASN n 1 23 LYS n 1 24 LYS n 1 25 VAL n 1 26 GLN n 1 27 LYS n 1 28 SER n 1 29 THR n 1 30 GLY n 1 31 GLU n 1 32 GLU n 1 33 SER n 1 34 GLY n 1 35 LEU n 1 36 LEU n 1 37 HIS n 1 38 THR n 1 39 GLY n 1 40 ASP n 1 41 VAL n 1 42 LEU n 1 43 ASP n 1 44 GLN n 1 45 VAL n 1 46 ALA n 1 47 ILE n 1 48 GLN n 1 49 CYS n 1 50 THR n 1 51 GLN n 1 52 ILE n 1 53 PRO n 1 54 LEU n 1 55 LEU n 1 56 ILE n 1 57 GLY n 1 58 ILE n 1 59 ALA n 1 60 ILE n 1 61 GLU n 1 62 ASP n 1 63 GLU n 1 64 CYS n 1 65 LYS n 1 66 ASN n 1 67 THR n 1 68 PRO n 1 69 THR n 1 70 CYS n 1 71 CYS n 1 72 GLU n 1 73 ASP n 1 74 VAL n 1 75 GLU n 1 76 ASP n 1 77 ASP n 1 78 GLY n 1 79 LEU n 1 80 VAL n 1 81 GLY n 1 82 ILE n 1 83 ASN n 1 84 CYS n 1 85 THR n 1 86 PRO n 1 87 ILE n 1 88 PRO n 1 89 LEU n 1 90 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 90 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene J056_002864 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'EXF-994 / CBS 113033' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Wallemia ichthyophaga' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1299270 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli DH1' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 536056 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Shuffle _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ILE 90 90 90 ILE ILE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6E9M _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6E9M _struct.title 'Solution NMR Structure of a Class I Hydrophobin from Wallemia ichthyophaga' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6E9M _struct_keywords.text 'Hydrophobin, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R9A9N7_WALI9 _struct_ref.pdbx_db_accession R9A9N7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GWESKTGSCNTGKLACCDTNKKVQKSTGEESGLLHTGDVLDQVAIQCTQIPLLIGIAIEDECKNTPTCCEDVEDDGLVGI NCTPIPLI ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6E9M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession R9A9N7 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6E9M GLY A 1 ? UNP R9A9N7 ? ? 'expression tag' 1 1 1 6E9M SER A 2 ? UNP R9A9N7 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5830 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 59 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 59 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 64 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 11 A CYS 70 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 18 A CYS 64 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf3 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 19 A CYS 49 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf4 disulf ? ? A CYS 71 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 71 A CYS 84 1_555 ? ? ? ? ? ? ? 2.019 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 11 ? CYS A 70 ? CYS A 11 ? 1_555 CYS A 70 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 18 ? CYS A 64 ? CYS A 18 ? 1_555 CYS A 64 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 19 ? CYS A 49 ? CYS A 19 ? 1_555 CYS A 49 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 71 ? CYS A 84 ? CYS A 71 ? 1_555 CYS A 84 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 73 ? GLU A 75 ? ASP A 73 GLU A 75 AA1 2 VAL A 80 ? ILE A 82 ? VAL A 80 ILE A 82 AA1 3 ALA A 46 ? CYS A 49 ? ALA A 46 CYS A 49 AA1 4 LYS A 15 ? LYS A 24 ? LYS A 15 LYS A 24 AA1 5 THR A 67 ? CYS A 71 ? THR A 67 CYS A 71 AA1 6 THR A 85 ? PRO A 86 ? THR A 85 PRO A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 75 ? N GLU A 75 O VAL A 80 ? O VAL A 80 AA1 2 3 O GLY A 81 ? O GLY A 81 N ILE A 47 ? N ILE A 47 AA1 3 4 O GLN A 48 ? O GLN A 48 N ASP A 20 ? N ASP A 20 AA1 4 5 N ALA A 17 ? N ALA A 17 O THR A 69 ? O THR A 69 AA1 5 6 N CYS A 70 ? N CYS A 70 O THR A 85 ? O THR A 85 # _pdbx_entry_details.entry_id 6E9M _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HZ1 A LYS 15 ? ? OE2 A GLU 32 ? ? 1.59 2 13 HZ2 A LYS 15 ? ? OE2 A GLU 32 ? ? 1.60 3 18 HG1 A THR 38 ? ? OD1 A ASP 73 ? ? 1.59 4 19 HE22 A GLN 51 ? ? OE1 A GLU 63 ? ? 1.59 5 19 HZ3 A LYS 15 ? ? OE2 A GLU 32 ? ? 1.59 6 20 HZ1 A LYS 7 ? ? OE1 A GLU 61 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 29 ? ? -122.16 -69.12 2 1 PRO A 53 ? ? -32.33 101.07 3 1 LYS A 65 ? ? -98.84 56.07 4 1 ASP A 76 ? ? 61.73 -151.22 5 2 SER A 2 ? ? -90.78 37.73 6 2 GLU A 5 ? ? -59.37 109.05 7 2 SER A 28 ? ? -150.12 66.20 8 2 PRO A 53 ? ? -33.59 108.59 9 2 ASP A 76 ? ? 67.24 -149.90 10 2 LEU A 89 ? ? -93.23 30.54 11 3 GLU A 5 ? ? -59.94 106.13 12 3 THR A 29 ? ? -152.04 -80.17 13 3 PRO A 53 ? ? -34.72 118.94 14 3 ASN A 66 ? ? -115.21 -163.17 15 3 ASP A 76 ? ? 56.53 -148.86 16 4 GLU A 5 ? ? -59.47 106.82 17 4 GLU A 32 ? ? -100.77 -68.99 18 4 PRO A 53 ? ? -32.68 117.24 19 4 LYS A 65 ? ? -99.36 48.35 20 4 ASP A 76 ? ? 59.80 -154.02 21 4 ASP A 77 ? ? -79.35 23.99 22 5 PRO A 53 ? ? -43.11 107.04 23 5 ASP A 76 ? ? 60.49 -151.93 24 6 GLN A 26 ? ? -80.08 32.89 25 6 LYS A 27 ? ? 31.12 115.21 26 6 SER A 28 ? ? -123.92 -76.83 27 6 HIS A 37 ? ? -109.15 -71.25 28 6 PRO A 53 ? ? -34.25 121.13 29 6 ASP A 76 ? ? 61.31 -151.81 30 7 SER A 2 ? ? 67.40 -172.71 31 7 PRO A 53 ? ? -38.45 102.42 32 7 ASN A 66 ? ? -123.23 -155.43 33 7 ASP A 76 ? ? 66.58 -148.19 34 7 CYS A 84 ? ? -69.82 95.33 35 8 PRO A 53 ? ? -34.30 130.58 36 8 LYS A 65 ? ? -99.69 33.17 37 8 ASN A 66 ? ? -117.94 -165.32 38 8 ASP A 76 ? ? 57.68 -150.19 39 9 SER A 28 ? ? -93.63 54.92 40 9 PRO A 53 ? ? -32.83 102.67 41 9 LYS A 65 ? ? -99.79 45.70 42 9 ASP A 76 ? ? 62.34 -153.34 43 9 ASP A 77 ? ? -79.81 23.58 44 10 HIS A 37 ? ? -112.22 -71.07 45 10 ASP A 76 ? ? 65.26 -154.25 46 10 LEU A 89 ? ? -92.03 36.85 47 11 SER A 28 ? ? -111.96 53.96 48 11 THR A 29 ? ? -99.42 -93.91 49 11 PRO A 53 ? ? -34.11 127.77 50 11 ASN A 66 ? ? -105.25 -140.57 51 11 ASP A 76 ? ? 66.65 -152.98 52 12 SER A 2 ? ? 60.89 84.39 53 12 PRO A 53 ? ? -33.88 99.42 54 12 ASN A 66 ? ? -105.07 -168.49 55 12 ASP A 76 ? ? 66.78 -152.64 56 13 GLN A 26 ? ? -78.10 30.25 57 13 SER A 28 ? ? -148.02 23.55 58 13 PRO A 53 ? ? -33.94 116.89 59 13 LYS A 65 ? ? -104.64 44.70 60 13 ASN A 66 ? ? -124.55 -165.68 61 13 ASP A 76 ? ? 67.40 -151.92 62 13 ASP A 77 ? ? -79.17 22.86 63 14 GLN A 26 ? ? -74.58 23.83 64 14 PRO A 53 ? ? -33.37 107.97 65 14 ASP A 76 ? ? 62.26 -154.37 66 15 THR A 29 ? ? -136.54 -61.00 67 15 HIS A 37 ? ? -101.05 -71.81 68 15 PRO A 53 ? ? -35.14 111.90 69 15 ASN A 66 ? ? -107.06 -160.92 70 15 ASP A 76 ? ? 62.80 -156.32 71 16 GLN A 26 ? ? -76.48 31.76 72 16 LYS A 27 ? ? 37.81 114.53 73 16 SER A 28 ? ? -101.24 -81.03 74 16 PRO A 53 ? ? -33.57 111.11 75 16 LYS A 65 ? ? -98.65 55.71 76 16 ASP A 76 ? ? 67.69 -150.08 77 16 LEU A 89 ? ? -92.05 32.75 78 17 THR A 29 ? ? -140.23 -48.52 79 17 THR A 50 ? ? -160.23 114.08 80 17 PRO A 53 ? ? -37.10 129.41 81 17 ASN A 66 ? ? -113.25 -169.61 82 17 ASP A 76 ? ? 65.27 -152.08 83 18 PRO A 53 ? ? -43.30 109.29 84 18 ASN A 66 ? ? -126.65 -165.58 85 18 ASP A 76 ? ? 67.59 -156.01 86 19 PRO A 53 ? ? -37.26 126.75 87 19 ASN A 66 ? ? -104.12 -168.14 88 19 ASP A 76 ? ? 63.82 -150.16 89 19 LEU A 89 ? ? -94.05 33.53 90 20 PRO A 53 ? ? -34.00 99.28 91 20 ASP A 76 ? ? 63.67 -156.52 92 20 ASP A 77 ? ? -75.45 23.06 # _pdbx_nmr_ensemble.entry_id 6E9M _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6E9M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '250 uM [U-13C; U-15N] WI1, 20 mM MES, 50 mM sodium chloride, 90% H2O/10% D2O' '90% H2O/10% D2O' WI1 solution ? 2 '100 uM [U-13C; U-15N] WI1, 20 mM MES, 50 mM sodium chloride, 100% D2O' '100% D2O' WI1 solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 WI1 250 ? uM '[U-13C; U-15N]' 1 MES 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 2 WI1 100 ? uM '[U-13C; U-15N]' 2 MES 20 ? mM 'natural abundance' 2 'sodium chloride' 50 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303.15 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'Condition 1' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HN(CA)CO' 1 isotropic 5 1 1 '3D CBCA(CO)NH' 1 isotropic 6 1 1 '3D HCCH-TOCSY' 1 isotropic 7 1 1 '3D HCCH-COSY' 1 isotropic 8 1 1 '2D 1H-13C HSQC' 1 isotropic 9 1 1 '3D 1H-13C NOESY' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 1 isotropic 11 1 2 '2D 1H-15N HSQC' 2 isotropic # _pdbx_nmr_refine.entry_id 6E9M _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 refinement ARIA 2.3.1 ;Linge, O'Donoghue and Nilges ; 3 processing NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'chemical shift assignment' Analysis ? CCPN 5 'structure calculation' ARIA 2.3.1 ;Linge, O'Donoghue and Nilges ; 6 'data analysis' Analysis ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 PRO N N N N 200 PRO CA C N S 201 PRO C C N N 202 PRO O O N N 203 PRO CB C N N 204 PRO CG C N N 205 PRO CD C N N 206 PRO OXT O N N 207 PRO H H N N 208 PRO HA H N N 209 PRO HB2 H N N 210 PRO HB3 H N N 211 PRO HG2 H N N 212 PRO HG3 H N N 213 PRO HD2 H N N 214 PRO HD3 H N N 215 PRO HXT H N N 216 SER N N N N 217 SER CA C N S 218 SER C C N N 219 SER O O N N 220 SER CB C N N 221 SER OG O N N 222 SER OXT O N N 223 SER H H N N 224 SER H2 H N N 225 SER HA H N N 226 SER HB2 H N N 227 SER HB3 H N N 228 SER HG H N N 229 SER HXT H N N 230 THR N N N N 231 THR CA C N S 232 THR C C N N 233 THR O O N N 234 THR CB C N R 235 THR OG1 O N N 236 THR CG2 C N N 237 THR OXT O N N 238 THR H H N N 239 THR H2 H N N 240 THR HA H N N 241 THR HB H N N 242 THR HG1 H N N 243 THR HG21 H N N 244 THR HG22 H N N 245 THR HG23 H N N 246 THR HXT H N N 247 TRP N N N N 248 TRP CA C N S 249 TRP C C N N 250 TRP O O N N 251 TRP CB C N N 252 TRP CG C Y N 253 TRP CD1 C Y N 254 TRP CD2 C Y N 255 TRP NE1 N Y N 256 TRP CE2 C Y N 257 TRP CE3 C Y N 258 TRP CZ2 C Y N 259 TRP CZ3 C Y N 260 TRP CH2 C Y N 261 TRP OXT O N N 262 TRP H H N N 263 TRP H2 H N N 264 TRP HA H N N 265 TRP HB2 H N N 266 TRP HB3 H N N 267 TRP HD1 H N N 268 TRP HE1 H N N 269 TRP HE3 H N N 270 TRP HZ2 H N N 271 TRP HZ3 H N N 272 TRP HH2 H N N 273 TRP HXT H N N 274 VAL N N N N 275 VAL CA C N S 276 VAL C C N N 277 VAL O O N N 278 VAL CB C N N 279 VAL CG1 C N N 280 VAL CG2 C N N 281 VAL OXT O N N 282 VAL H H N N 283 VAL H2 H N N 284 VAL HA H N N 285 VAL HB H N N 286 VAL HG11 H N N 287 VAL HG12 H N N 288 VAL HG13 H N N 289 VAL HG21 H N N 290 VAL HG22 H N N 291 VAL HG23 H N N 292 VAL HXT H N N 293 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 PRO N CA sing N N 190 PRO N CD sing N N 191 PRO N H sing N N 192 PRO CA C sing N N 193 PRO CA CB sing N N 194 PRO CA HA sing N N 195 PRO C O doub N N 196 PRO C OXT sing N N 197 PRO CB CG sing N N 198 PRO CB HB2 sing N N 199 PRO CB HB3 sing N N 200 PRO CG CD sing N N 201 PRO CG HG2 sing N N 202 PRO CG HG3 sing N N 203 PRO CD HD2 sing N N 204 PRO CD HD3 sing N N 205 PRO OXT HXT sing N N 206 SER N CA sing N N 207 SER N H sing N N 208 SER N H2 sing N N 209 SER CA C sing N N 210 SER CA CB sing N N 211 SER CA HA sing N N 212 SER C O doub N N 213 SER C OXT sing N N 214 SER CB OG sing N N 215 SER CB HB2 sing N N 216 SER CB HB3 sing N N 217 SER OG HG sing N N 218 SER OXT HXT sing N N 219 THR N CA sing N N 220 THR N H sing N N 221 THR N H2 sing N N 222 THR CA C sing N N 223 THR CA CB sing N N 224 THR CA HA sing N N 225 THR C O doub N N 226 THR C OXT sing N N 227 THR CB OG1 sing N N 228 THR CB CG2 sing N N 229 THR CB HB sing N N 230 THR OG1 HG1 sing N N 231 THR CG2 HG21 sing N N 232 THR CG2 HG22 sing N N 233 THR CG2 HG23 sing N N 234 THR OXT HXT sing N N 235 TRP N CA sing N N 236 TRP N H sing N N 237 TRP N H2 sing N N 238 TRP CA C sing N N 239 TRP CA CB sing N N 240 TRP CA HA sing N N 241 TRP C O doub N N 242 TRP C OXT sing N N 243 TRP CB CG sing N N 244 TRP CB HB2 sing N N 245 TRP CB HB3 sing N N 246 TRP CG CD1 doub Y N 247 TRP CG CD2 sing Y N 248 TRP CD1 NE1 sing Y N 249 TRP CD1 HD1 sing N N 250 TRP CD2 CE2 doub Y N 251 TRP CD2 CE3 sing Y N 252 TRP NE1 CE2 sing Y N 253 TRP NE1 HE1 sing N N 254 TRP CE2 CZ2 sing Y N 255 TRP CE3 CZ3 doub Y N 256 TRP CE3 HE3 sing N N 257 TRP CZ2 CH2 doub Y N 258 TRP CZ2 HZ2 sing N N 259 TRP CZ3 CH2 sing Y N 260 TRP CZ3 HZ3 sing N N 261 TRP CH2 HH2 sing N N 262 TRP OXT HXT sing N N 263 VAL N CA sing N N 264 VAL N H sing N N 265 VAL N H2 sing N N 266 VAL CA C sing N N 267 VAL CA CB sing N N 268 VAL CA HA sing N N 269 VAL C O doub N N 270 VAL C OXT sing N N 271 VAL CB CG1 sing N N 272 VAL CB CG2 sing N N 273 VAL CB HB sing N N 274 VAL CG1 HG11 sing N N 275 VAL CG1 HG12 sing N N 276 VAL CG1 HG13 sing N N 277 VAL CG2 HG21 sing N N 278 VAL CG2 HG22 sing N N 279 VAL CG2 HG23 sing N N 280 VAL OXT HXT sing N N 281 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number RGPIN-2017-05338 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 QANUC 2 'AVANCE III' ? Bruker 700 'NRC - Halifax' # _atom_sites.entry_id 6E9M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_