data_6EDG # _entry.id 6EDG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6EDG pdb_00006edg 10.2210/pdb6edg/pdb WWPDB D_1000236047 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EDG _pdbx_database_status.recvd_initial_deposition_date 2018-08-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Moss, D.L.' 1 0000-0001-7639-7276 'Park, H.W.' 2 0000-0003-0758-0231 'Mettu, R.R.' 3 0000-0001-9479-9156 'Landry, S.J.' 4 0000-0002-4082-0543 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 294 _citation.language ? _citation.page_first 4667 _citation.page_last 4681 _citation.title 'Deimmunizing substitutions in Pseudomonasexotoxin domain III perturb antigen processing without eliminating T-cell epitopes.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.006704 _citation.pdbx_database_id_PubMed 30683694 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moss, D.L.' 1 0000-0001-7639-7276 primary 'Park, H.W.' 2 ? primary 'Mettu, R.R.' 3 ? primary 'Landry, S.J.' 4 0000-0002-4082-0543 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6EDG _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.373 _cell.length_a_esd ? _cell.length_b 48.188 _cell.length_b_esd ? _cell.length_c 99.002 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EDG _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Exotoxin 22797.230 1 ? 'R427A, F443A, R494A, R505H, L552E' ? ? 2 non-polymer syn 'N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE' 295.336 1 ? ? ? ? 3 water nat water 18.015 62 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHAQLEERGYVFVGYHGTALEAAQSIVFGGVRARSQDLDAIWRGFYIAGD PALAYGYAQDQEPDARGRIANGALLRVYVPHSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGREET ILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKP ; _entity_poly.pdbx_seq_one_letter_code_can ;PTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHAQLEERGYVFVGYHGTALEAAQSIVFGGVRARSQDLDAIWRGFYIAGD PALAYGYAQDQEPDARGRIANGALLRVYVPHSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGREET ILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 THR n 1 3 GLY n 1 4 ALA n 1 5 GLU n 1 6 PHE n 1 7 LEU n 1 8 GLY n 1 9 ASP n 1 10 GLY n 1 11 GLY n 1 12 ASP n 1 13 VAL n 1 14 SER n 1 15 PHE n 1 16 SER n 1 17 THR n 1 18 ARG n 1 19 GLY n 1 20 THR n 1 21 GLN n 1 22 ASN n 1 23 TRP n 1 24 THR n 1 25 VAL n 1 26 GLU n 1 27 ARG n 1 28 LEU n 1 29 LEU n 1 30 GLN n 1 31 ALA n 1 32 HIS n 1 33 ALA n 1 34 GLN n 1 35 LEU n 1 36 GLU n 1 37 GLU n 1 38 ARG n 1 39 GLY n 1 40 TYR n 1 41 VAL n 1 42 PHE n 1 43 VAL n 1 44 GLY n 1 45 TYR n 1 46 HIS n 1 47 GLY n 1 48 THR n 1 49 ALA n 1 50 LEU n 1 51 GLU n 1 52 ALA n 1 53 ALA n 1 54 GLN n 1 55 SER n 1 56 ILE n 1 57 VAL n 1 58 PHE n 1 59 GLY n 1 60 GLY n 1 61 VAL n 1 62 ARG n 1 63 ALA n 1 64 ARG n 1 65 SER n 1 66 GLN n 1 67 ASP n 1 68 LEU n 1 69 ASP n 1 70 ALA n 1 71 ILE n 1 72 TRP n 1 73 ARG n 1 74 GLY n 1 75 PHE n 1 76 TYR n 1 77 ILE n 1 78 ALA n 1 79 GLY n 1 80 ASP n 1 81 PRO n 1 82 ALA n 1 83 LEU n 1 84 ALA n 1 85 TYR n 1 86 GLY n 1 87 TYR n 1 88 ALA n 1 89 GLN n 1 90 ASP n 1 91 GLN n 1 92 GLU n 1 93 PRO n 1 94 ASP n 1 95 ALA n 1 96 ARG n 1 97 GLY n 1 98 ARG n 1 99 ILE n 1 100 ALA n 1 101 ASN n 1 102 GLY n 1 103 ALA n 1 104 LEU n 1 105 LEU n 1 106 ARG n 1 107 VAL n 1 108 TYR n 1 109 VAL n 1 110 PRO n 1 111 HIS n 1 112 SER n 1 113 SER n 1 114 LEU n 1 115 PRO n 1 116 GLY n 1 117 PHE n 1 118 TYR n 1 119 ARG n 1 120 THR n 1 121 SER n 1 122 LEU n 1 123 THR n 1 124 LEU n 1 125 ALA n 1 126 ALA n 1 127 PRO n 1 128 GLU n 1 129 ALA n 1 130 ALA n 1 131 GLY n 1 132 GLU n 1 133 VAL n 1 134 GLU n 1 135 ARG n 1 136 LEU n 1 137 ILE n 1 138 GLY n 1 139 HIS n 1 140 PRO n 1 141 LEU n 1 142 PRO n 1 143 LEU n 1 144 ARG n 1 145 LEU n 1 146 ASP n 1 147 ALA n 1 148 ILE n 1 149 THR n 1 150 GLY n 1 151 PRO n 1 152 GLU n 1 153 GLU n 1 154 GLU n 1 155 GLY n 1 156 GLY n 1 157 ARG n 1 158 GLU n 1 159 GLU n 1 160 THR n 1 161 ILE n 1 162 LEU n 1 163 GLY n 1 164 TRP n 1 165 PRO n 1 166 LEU n 1 167 ALA n 1 168 GLU n 1 169 ARG n 1 170 THR n 1 171 VAL n 1 172 VAL n 1 173 ILE n 1 174 PRO n 1 175 SER n 1 176 ALA n 1 177 ILE n 1 178 PRO n 1 179 THR n 1 180 ASP n 1 181 PRO n 1 182 ARG n 1 183 ASN n 1 184 VAL n 1 185 GLY n 1 186 GLY n 1 187 ASP n 1 188 LEU n 1 189 ASP n 1 190 PRO n 1 191 SER n 1 192 SER n 1 193 ILE n 1 194 PRO n 1 195 ASP n 1 196 LYS n 1 197 GLU n 1 198 GLN n 1 199 ALA n 1 200 ILE n 1 201 SER n 1 202 ALA n 1 203 LEU n 1 204 PRO n 1 205 ASP n 1 206 TYR n 1 207 ALA n 1 208 SER n 1 209 GLN n 1 210 PRO n 1 211 GLY n 1 212 LYS n 1 213 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 213 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CGU42_27545 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A222DLT0_PSEAI _struct_ref.pdbx_db_accession A0A222DLT0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGD PALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLET ILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKP ; _struct_ref.pdbx_align_begin 417 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6EDG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 213 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A222DLT0 _struct_ref_seq.db_align_beg 417 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 629 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 395 _struct_ref_seq.pdbx_auth_seq_align_end 607 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6EDG ALA A 33 ? UNP A0A222DLT0 ARG 449 'engineered mutation' 427 1 1 6EDG ALA A 49 ? UNP A0A222DLT0 PHE 465 'engineered mutation' 443 2 1 6EDG ALA A 100 ? UNP A0A222DLT0 ARG 516 'engineered mutation' 494 3 1 6EDG HIS A 111 ? UNP A0A222DLT0 ARG 527 'engineered mutation' 505 4 1 6EDG GLU A 158 ? UNP A0A222DLT0 LEU 574 'engineered mutation' 552 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 P34 non-polymer . 'N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE' ? 'C17 H17 N3 O2' 295.336 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EDG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.66 M sodium citrate pH 7.5, 0.54 mM sodium azide, 0.3 mM dithiothreitol, 0.5 mM PJ34 1.1 M sodium citrate pH 7.5, 0.9 mM sodium azide, 0.5 mM dithiothreitol 0.5 mM PJ34 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-09-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03320 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03320 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6EDG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.47 _reflns.d_resolution_low 49.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 32473 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.24 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.51 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.067 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.47 _reflns_shell.d_res_low 1.54 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.14 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5020 _reflns_shell.percent_possible_all 96.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.76 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.959 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.805 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.26 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -1.31 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 1.06 _refine.B_iso_max ? _refine.B_iso_mean 28.335 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.969 _refine.correlation_coeff_Fo_to_Fc_free 0.968 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EDG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.47 _refine.ls_d_res_low 49.50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30481 _refine.ls_number_reflns_R_free 1549 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.94 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17810 _refine.ls_R_factor_R_free 0.19195 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17742 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1XK9 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.071 _refine.pdbx_overall_ESU_R_Free 0.068 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.215 _refine.overall_SU_ML 0.046 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1608 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1692 _refine_hist.d_res_high 1.47 _refine_hist.d_res_low 49.50 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.027 0.019 1673 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1544 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.439 1.983 2284 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.273 3.000 3547 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.683 5.000 212 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.416 23.289 76 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.816 15.000 235 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.998 15.000 15 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.173 0.200 243 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.015 0.021 1939 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 386 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 3.170 2.591 854 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.132 2.567 850 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.779 3.870 1064 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.775 3.855 1063 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.482 3.024 819 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.480 3.031 820 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.735 4.364 1221 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.844 21.837 1893 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 8.863 21.837 1878 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.470 _refine_ls_shell.d_res_low 1.508 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 144 _refine_ls_shell.number_reflns_R_work 2198 _refine_ls_shell.percent_reflns_obs 99.96 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.273 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.270 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6EDG _struct.title 'Pseudomonas exotoxin A domain III T18H477L' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EDG _struct_keywords.text TRANSFERASE _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 2 ? LEU A 7 ? THR A 396 LEU A 401 5 ? 6 HELX_P HELX_P2 AA2 THR A 24 ? ARG A 38 ? THR A 418 ARG A 432 1 ? 15 HELX_P HELX_P3 AA3 ALA A 49 ? GLY A 60 ? ALA A 443 GLY A 454 1 ? 12 HELX_P HELX_P4 AA4 ASP A 80 ? GLY A 86 ? ASP A 474 GLY A 480 1 ? 7 HELX_P HELX_P5 AA5 SER A 112 ? PRO A 115 ? SER A 506 PRO A 509 5 ? 4 HELX_P HELX_P6 AA6 GLU A 128 ? GLY A 138 ? GLU A 522 GLY A 532 1 ? 11 HELX_P HELX_P7 AA7 GLY A 163 ? GLU A 168 ? GLY A 557 GLU A 562 1 ? 6 HELX_P HELX_P8 AA8 ASP A 189 ? ILE A 193 ? ASP A 583 ILE A 587 5 ? 5 HELX_P HELX_P9 AA9 PRO A 194 ? ALA A 199 ? PRO A 588 ALA A 593 1 ? 6 HELX_P HELX_P10 AB1 PRO A 204 ? SER A 208 ? PRO A 598 SER A 602 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 141 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 535 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 142 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 536 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 11.16 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 40 ? THR A 48 ? TYR A 434 THR A 442 AA1 2 ALA A 103 ? PRO A 110 ? ALA A 497 PRO A 504 AA1 3 VAL A 171 ? PRO A 174 ? VAL A 565 PRO A 568 AA2 1 PHE A 75 ? ALA A 78 ? PHE A 469 ALA A 472 AA2 2 GLU A 158 ? LEU A 162 ? GLU A 552 LEU A 556 AA2 3 ALA A 147 ? PRO A 151 ? ALA A 541 PRO A 545 AA2 4 PHE A 117 ? ARG A 119 ? PHE A 511 ARG A 513 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 44 ? N GLY A 438 O VAL A 107 ? O VAL A 501 AA1 2 3 N ARG A 106 ? N ARG A 500 O ILE A 173 ? O ILE A 567 AA2 1 2 N ILE A 77 ? N ILE A 471 O THR A 160 ? O THR A 554 AA2 2 3 O ILE A 161 ? O ILE A 555 N ILE A 148 ? N ILE A 542 AA2 3 4 O ALA A 147 ? O ALA A 541 N TYR A 118 ? N TYR A 512 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id P34 _struct_site.pdbx_auth_seq_id 1001 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'binding site for residue P34 A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 HIS A 46 ? HIS A 440 . ? 1_555 ? 2 AC1 7 GLY A 47 ? GLY A 441 . ? 1_555 ? 3 AC1 7 TYR A 76 ? TYR A 470 . ? 1_555 ? 4 AC1 7 ALA A 84 ? ALA A 478 . ? 1_555 ? 5 AC1 7 TYR A 87 ? TYR A 481 . ? 1_555 ? 6 AC1 7 GLN A 91 ? GLN A 485 . ? 1_555 ? 7 AC1 7 GLU A 159 ? GLU A 553 . ? 1_555 ? # _atom_sites.entry_id 6EDG _atom_sites.fract_transf_matrix[1][1] 0.026060 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020752 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010101 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 395 395 PRO PRO A . n A 1 2 THR 2 396 396 THR THR A . n A 1 3 GLY 3 397 397 GLY GLY A . n A 1 4 ALA 4 398 398 ALA ALA A . n A 1 5 GLU 5 399 399 GLU GLU A . n A 1 6 PHE 6 400 400 PHE PHE A . n A 1 7 LEU 7 401 401 LEU LEU A . n A 1 8 GLY 8 402 402 GLY GLY A . n A 1 9 ASP 9 403 403 ASP ASP A . n A 1 10 GLY 10 404 404 GLY GLY A . n A 1 11 GLY 11 405 405 GLY GLY A . n A 1 12 ASP 12 406 406 ASP ASP A . n A 1 13 VAL 13 407 407 VAL VAL A . n A 1 14 SER 14 408 408 SER SER A . n A 1 15 PHE 15 409 409 PHE PHE A . n A 1 16 SER 16 410 410 SER SER A . n A 1 17 THR 17 411 411 THR THR A . n A 1 18 ARG 18 412 412 ARG ARG A . n A 1 19 GLY 19 413 413 GLY GLY A . n A 1 20 THR 20 414 414 THR THR A . n A 1 21 GLN 21 415 415 GLN GLN A . n A 1 22 ASN 22 416 416 ASN ASN A . n A 1 23 TRP 23 417 417 TRP TRP A . n A 1 24 THR 24 418 418 THR THR A . n A 1 25 VAL 25 419 419 VAL VAL A . n A 1 26 GLU 26 420 420 GLU GLU A . n A 1 27 ARG 27 421 421 ARG ARG A . n A 1 28 LEU 28 422 422 LEU LEU A . n A 1 29 LEU 29 423 423 LEU LEU A . n A 1 30 GLN 30 424 424 GLN GLN A . n A 1 31 ALA 31 425 425 ALA ALA A . n A 1 32 HIS 32 426 426 HIS HIS A . n A 1 33 ALA 33 427 427 ALA ALA A . n A 1 34 GLN 34 428 428 GLN GLN A . n A 1 35 LEU 35 429 429 LEU LEU A . n A 1 36 GLU 36 430 430 GLU GLU A . n A 1 37 GLU 37 431 431 GLU GLU A . n A 1 38 ARG 38 432 432 ARG ARG A . n A 1 39 GLY 39 433 433 GLY GLY A . n A 1 40 TYR 40 434 434 TYR TYR A . n A 1 41 VAL 41 435 435 VAL VAL A . n A 1 42 PHE 42 436 436 PHE PHE A . n A 1 43 VAL 43 437 437 VAL VAL A . n A 1 44 GLY 44 438 438 GLY GLY A . n A 1 45 TYR 45 439 439 TYR TYR A . n A 1 46 HIS 46 440 440 HIS HIS A . n A 1 47 GLY 47 441 441 GLY GLY A . n A 1 48 THR 48 442 442 THR THR A . n A 1 49 ALA 49 443 443 ALA ALA A . n A 1 50 LEU 50 444 444 LEU LEU A . n A 1 51 GLU 51 445 445 GLU GLU A . n A 1 52 ALA 52 446 446 ALA ALA A . n A 1 53 ALA 53 447 447 ALA ALA A . n A 1 54 GLN 54 448 448 GLN GLN A . n A 1 55 SER 55 449 449 SER SER A . n A 1 56 ILE 56 450 450 ILE ILE A . n A 1 57 VAL 57 451 451 VAL VAL A . n A 1 58 PHE 58 452 452 PHE PHE A . n A 1 59 GLY 59 453 453 GLY GLY A . n A 1 60 GLY 60 454 454 GLY GLY A . n A 1 61 VAL 61 455 455 VAL VAL A . n A 1 62 ARG 62 456 456 ARG ARG A . n A 1 63 ALA 63 457 457 ALA ALA A . n A 1 64 ARG 64 458 458 ARG ARG A . n A 1 65 SER 65 459 459 SER SER A . n A 1 66 GLN 66 460 460 GLN GLN A . n A 1 67 ASP 67 461 461 ASP ASP A . n A 1 68 LEU 68 462 462 LEU LEU A . n A 1 69 ASP 69 463 463 ASP ASP A . n A 1 70 ALA 70 464 464 ALA ALA A . n A 1 71 ILE 71 465 465 ILE ILE A . n A 1 72 TRP 72 466 466 TRP TRP A . n A 1 73 ARG 73 467 467 ARG ARG A . n A 1 74 GLY 74 468 468 GLY GLY A . n A 1 75 PHE 75 469 469 PHE PHE A . n A 1 76 TYR 76 470 470 TYR TYR A . n A 1 77 ILE 77 471 471 ILE ILE A . n A 1 78 ALA 78 472 472 ALA ALA A . n A 1 79 GLY 79 473 473 GLY GLY A . n A 1 80 ASP 80 474 474 ASP ASP A . n A 1 81 PRO 81 475 475 PRO PRO A . n A 1 82 ALA 82 476 476 ALA ALA A . n A 1 83 LEU 83 477 477 LEU LEU A . n A 1 84 ALA 84 478 478 ALA ALA A . n A 1 85 TYR 85 479 479 TYR TYR A . n A 1 86 GLY 86 480 480 GLY GLY A . n A 1 87 TYR 87 481 481 TYR TYR A . n A 1 88 ALA 88 482 482 ALA ALA A . n A 1 89 GLN 89 483 483 GLN GLN A . n A 1 90 ASP 90 484 484 ASP ASP A . n A 1 91 GLN 91 485 485 GLN GLN A . n A 1 92 GLU 92 486 486 GLU GLU A . n A 1 93 PRO 93 487 487 PRO PRO A . n A 1 94 ASP 94 488 488 ASP ASP A . n A 1 95 ALA 95 489 489 ALA ALA A . n A 1 96 ARG 96 490 490 ARG ARG A . n A 1 97 GLY 97 491 491 GLY GLY A . n A 1 98 ARG 98 492 492 ARG ARG A . n A 1 99 ILE 99 493 493 ILE ILE A . n A 1 100 ALA 100 494 494 ALA ALA A . n A 1 101 ASN 101 495 495 ASN ASN A . n A 1 102 GLY 102 496 496 GLY GLY A . n A 1 103 ALA 103 497 497 ALA ALA A . n A 1 104 LEU 104 498 498 LEU LEU A . n A 1 105 LEU 105 499 499 LEU LEU A . n A 1 106 ARG 106 500 500 ARG ARG A . n A 1 107 VAL 107 501 501 VAL VAL A . n A 1 108 TYR 108 502 502 TYR TYR A . n A 1 109 VAL 109 503 503 VAL VAL A . n A 1 110 PRO 110 504 504 PRO PRO A . n A 1 111 HIS 111 505 505 HIS HIS A . n A 1 112 SER 112 506 506 SER SER A . n A 1 113 SER 113 507 507 SER SER A . n A 1 114 LEU 114 508 508 LEU LEU A . n A 1 115 PRO 115 509 509 PRO PRO A . n A 1 116 GLY 116 510 510 GLY GLY A . n A 1 117 PHE 117 511 511 PHE PHE A . n A 1 118 TYR 118 512 512 TYR TYR A . n A 1 119 ARG 119 513 513 ARG ARG A . n A 1 120 THR 120 514 514 THR THR A . n A 1 121 SER 121 515 515 SER SER A . n A 1 122 LEU 122 516 516 LEU LEU A . n A 1 123 THR 123 517 517 THR THR A . n A 1 124 LEU 124 518 518 LEU LEU A . n A 1 125 ALA 125 519 519 ALA ALA A . n A 1 126 ALA 126 520 520 ALA ALA A . n A 1 127 PRO 127 521 521 PRO PRO A . n A 1 128 GLU 128 522 522 GLU GLU A . n A 1 129 ALA 129 523 523 ALA ALA A . n A 1 130 ALA 130 524 524 ALA ALA A . n A 1 131 GLY 131 525 525 GLY GLY A . n A 1 132 GLU 132 526 526 GLU GLU A . n A 1 133 VAL 133 527 527 VAL VAL A . n A 1 134 GLU 134 528 528 GLU GLU A . n A 1 135 ARG 135 529 529 ARG ARG A . n A 1 136 LEU 136 530 530 LEU LEU A . n A 1 137 ILE 137 531 531 ILE ILE A . n A 1 138 GLY 138 532 532 GLY GLY A . n A 1 139 HIS 139 533 533 HIS HIS A . n A 1 140 PRO 140 534 534 PRO PRO A . n A 1 141 LEU 141 535 535 LEU LEU A . n A 1 142 PRO 142 536 536 PRO PRO A . n A 1 143 LEU 143 537 537 LEU LEU A . n A 1 144 ARG 144 538 538 ARG ARG A . n A 1 145 LEU 145 539 539 LEU LEU A . n A 1 146 ASP 146 540 540 ASP ASP A . n A 1 147 ALA 147 541 541 ALA ALA A . n A 1 148 ILE 148 542 542 ILE ILE A . n A 1 149 THR 149 543 543 THR THR A . n A 1 150 GLY 150 544 544 GLY GLY A . n A 1 151 PRO 151 545 545 PRO PRO A . n A 1 152 GLU 152 546 546 GLU GLU A . n A 1 153 GLU 153 547 547 GLU GLU A . n A 1 154 GLU 154 548 548 GLU GLU A . n A 1 155 GLY 155 549 549 GLY GLY A . n A 1 156 GLY 156 550 550 GLY GLY A . n A 1 157 ARG 157 551 551 ARG ARG A . n A 1 158 GLU 158 552 552 GLU GLU A . n A 1 159 GLU 159 553 553 GLU GLU A . n A 1 160 THR 160 554 554 THR THR A . n A 1 161 ILE 161 555 555 ILE ILE A . n A 1 162 LEU 162 556 556 LEU LEU A . n A 1 163 GLY 163 557 557 GLY GLY A . n A 1 164 TRP 164 558 558 TRP TRP A . n A 1 165 PRO 165 559 559 PRO PRO A . n A 1 166 LEU 166 560 560 LEU LEU A . n A 1 167 ALA 167 561 561 ALA ALA A . n A 1 168 GLU 168 562 562 GLU GLU A . n A 1 169 ARG 169 563 563 ARG ARG A . n A 1 170 THR 170 564 564 THR THR A . n A 1 171 VAL 171 565 565 VAL VAL A . n A 1 172 VAL 172 566 566 VAL VAL A . n A 1 173 ILE 173 567 567 ILE ILE A . n A 1 174 PRO 174 568 568 PRO PRO A . n A 1 175 SER 175 569 569 SER SER A . n A 1 176 ALA 176 570 570 ALA ALA A . n A 1 177 ILE 177 571 571 ILE ILE A . n A 1 178 PRO 178 572 572 PRO PRO A . n A 1 179 THR 179 573 573 THR THR A . n A 1 180 ASP 180 574 574 ASP ASP A . n A 1 181 PRO 181 575 575 PRO PRO A . n A 1 182 ARG 182 576 576 ARG ARG A . n A 1 183 ASN 183 577 577 ASN ASN A . n A 1 184 VAL 184 578 578 VAL VAL A . n A 1 185 GLY 185 579 579 GLY GLY A . n A 1 186 GLY 186 580 580 GLY GLY A . n A 1 187 ASP 187 581 581 ASP ASP A . n A 1 188 LEU 188 582 582 LEU LEU A . n A 1 189 ASP 189 583 583 ASP ASP A . n A 1 190 PRO 190 584 584 PRO PRO A . n A 1 191 SER 191 585 585 SER SER A . n A 1 192 SER 192 586 586 SER SER A . n A 1 193 ILE 193 587 587 ILE ILE A . n A 1 194 PRO 194 588 588 PRO PRO A . n A 1 195 ASP 195 589 589 ASP ASP A . n A 1 196 LYS 196 590 590 LYS LYS A . n A 1 197 GLU 197 591 591 GLU GLU A . n A 1 198 GLN 198 592 592 GLN GLN A . n A 1 199 ALA 199 593 593 ALA ALA A . n A 1 200 ILE 200 594 594 ILE ILE A . n A 1 201 SER 201 595 595 SER SER A . n A 1 202 ALA 202 596 596 ALA ALA A . n A 1 203 LEU 203 597 597 LEU LEU A . n A 1 204 PRO 204 598 598 PRO PRO A . n A 1 205 ASP 205 599 599 ASP ASP A . n A 1 206 TYR 206 600 600 TYR TYR A . n A 1 207 ALA 207 601 601 ALA ALA A . n A 1 208 SER 208 602 602 SER SER A . n A 1 209 GLN 209 603 603 GLN GLN A . n A 1 210 PRO 210 604 604 PRO PRO A . n A 1 211 GLY 211 605 605 GLY GLY A . n A 1 212 LYS 212 606 606 LYS LYS A . n A 1 213 PRO 213 607 607 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 P34 1 1001 1001 P34 P34 A . C 3 HOH 1 1101 54 HOH HOH A . C 3 HOH 2 1102 11 HOH HOH A . C 3 HOH 3 1103 34 HOH HOH A . C 3 HOH 4 1104 16 HOH HOH A . C 3 HOH 5 1105 44 HOH HOH A . C 3 HOH 6 1106 36 HOH HOH A . C 3 HOH 7 1107 60 HOH HOH A . C 3 HOH 8 1108 22 HOH HOH A . C 3 HOH 9 1109 25 HOH HOH A . C 3 HOH 10 1110 31 HOH HOH A . C 3 HOH 11 1111 7 HOH HOH A . C 3 HOH 12 1112 17 HOH HOH A . C 3 HOH 13 1113 9 HOH HOH A . C 3 HOH 14 1114 15 HOH HOH A . C 3 HOH 15 1115 28 HOH HOH A . C 3 HOH 16 1116 50 HOH HOH A . C 3 HOH 17 1117 52 HOH HOH A . C 3 HOH 18 1118 40 HOH HOH A . C 3 HOH 19 1119 45 HOH HOH A . C 3 HOH 20 1120 57 HOH HOH A . C 3 HOH 21 1121 19 HOH HOH A . C 3 HOH 22 1122 35 HOH HOH A . C 3 HOH 23 1123 42 HOH HOH A . C 3 HOH 24 1124 14 HOH HOH A . C 3 HOH 25 1125 13 HOH HOH A . C 3 HOH 26 1126 53 HOH HOH A . C 3 HOH 27 1127 12 HOH HOH A . C 3 HOH 28 1128 3 HOH HOH A . C 3 HOH 29 1129 6 HOH HOH A . C 3 HOH 30 1130 8 HOH HOH A . C 3 HOH 31 1131 59 HOH HOH A . C 3 HOH 32 1132 1 HOH HOH A . C 3 HOH 33 1133 26 HOH HOH A . C 3 HOH 34 1134 37 HOH HOH A . C 3 HOH 35 1135 55 HOH HOH A . C 3 HOH 36 1136 49 HOH HOH A . C 3 HOH 37 1137 47 HOH HOH A . C 3 HOH 38 1138 10 HOH HOH A . C 3 HOH 39 1139 4 HOH HOH A . C 3 HOH 40 1140 51 HOH HOH A . C 3 HOH 41 1141 39 HOH HOH A . C 3 HOH 42 1142 48 HOH HOH A . C 3 HOH 43 1143 21 HOH HOH A . C 3 HOH 44 1144 2 HOH HOH A . C 3 HOH 45 1145 20 HOH HOH A . C 3 HOH 46 1146 38 HOH HOH A . C 3 HOH 47 1147 56 HOH HOH A . C 3 HOH 48 1148 27 HOH HOH A . C 3 HOH 49 1149 46 HOH HOH A . C 3 HOH 50 1150 24 HOH HOH A . C 3 HOH 51 1151 62 HOH HOH A . C 3 HOH 52 1152 43 HOH HOH A . C 3 HOH 53 1153 58 HOH HOH A . C 3 HOH 54 1154 29 HOH HOH A . C 3 HOH 55 1155 5 HOH HOH A . C 3 HOH 56 1156 32 HOH HOH A . C 3 HOH 57 1157 18 HOH HOH A . C 3 HOH 58 1158 30 HOH HOH A . C 3 HOH 59 1159 41 HOH HOH A . C 3 HOH 60 1160 61 HOH HOH A . C 3 HOH 61 1161 33 HOH HOH A . C 3 HOH 62 1162 23 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-06 2 'Structure model' 1 1 2019-08-21 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' 14 3 'Structure model' '_pdbx_audit_support.funding_organization' 15 4 'Structure model' '_database_2.pdbx_DOI' 16 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'VERSION Jan 26, 2018' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A SER 408 ? ? OG A SER 408 ? ? 1.316 1.418 -0.102 0.013 N 2 1 CZ A TYR 470 ? ? CE2 A TYR 470 ? ? 1.287 1.381 -0.094 0.013 N 3 1 CE1 A TYR 512 ? ? CZ A TYR 512 ? ? 1.297 1.381 -0.084 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 484 ? ? CG A ASP 484 ? ? OD1 A ASP 484 ? ? 123.88 118.30 5.58 0.90 N 2 1 CB A ASP 540 ? ? CG A ASP 540 ? ? OD1 A ASP 540 ? ? 125.94 118.30 7.64 0.90 N 3 1 OE1 A GLU 552 ? ? CD A GLU 552 ? ? OE2 A GLU 552 ? ? 112.06 123.30 -11.24 1.20 N 4 1 CA A VAL 565 ? ? CB A VAL 565 ? ? CG1 A VAL 565 ? ? 120.19 110.90 9.29 1.50 N 5 1 CB A ASP 599 ? ? CG A ASP 599 ? ? OD1 A ASP 599 ? ? 123.87 118.30 5.57 0.90 N 6 1 CB A ASP 599 ? ? CG A ASP 599 ? ? OD2 A ASP 599 ? ? 112.65 118.30 -5.65 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 463 ? ? 76.03 -30.82 2 1 ARG A 538 ? ? -123.96 -104.03 3 1 LEU A 539 ? ? -86.55 48.01 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 548 ? CG ? A GLU 154 CG 2 1 Y 1 A GLU 548 ? CD ? A GLU 154 CD 3 1 Y 1 A GLU 548 ? OE1 ? A GLU 154 OE1 4 1 Y 1 A GLU 548 ? OE2 ? A GLU 154 OE2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 P34 CAA C N N 216 P34 N N N N 217 P34 CAB C N N 218 P34 CA C N N 219 P34 C C N N 220 P34 O O N N 221 P34 NAM N N N 222 P34 CAP C Y N 223 P34 CAK C Y N 224 P34 CAU C Y N 225 P34 CAT C Y N 226 P34 CAI C Y N 227 P34 CAF C Y N 228 P34 CAE C Y N 229 P34 CAH C Y N 230 P34 CAS C Y N 231 P34 CAQ C Y N 232 P34 OAD O N N 233 P34 NAN N Y N 234 P34 CAR C Y N 235 P34 CAJ C Y N 236 P34 CAG C Y N 237 P34 HAA1 H N N 238 P34 HAA2 H N N 239 P34 HAA3 H N N 240 P34 HAB1 H N N 241 P34 HAB2 H N N 242 P34 HAB3 H N N 243 P34 HA1 H N N 244 P34 HA2 H N N 245 P34 HAM H N N 246 P34 HAK H N N 247 P34 HAI H N N 248 P34 HAF H N N 249 P34 HAE H N N 250 P34 HAH H N N 251 P34 HAN H N N 252 P34 HAJ H N N 253 P34 HAG H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 P34 CAA N sing N N 205 P34 CAA HAA1 sing N N 206 P34 CAA HAA2 sing N N 207 P34 CAA HAA3 sing N N 208 P34 N CAB sing N N 209 P34 N CA sing N N 210 P34 CAB HAB1 sing N N 211 P34 CAB HAB2 sing N N 212 P34 CAB HAB3 sing N N 213 P34 CA C sing N N 214 P34 CA HA1 sing N N 215 P34 CA HA2 sing N N 216 P34 C O doub N N 217 P34 C NAM sing N N 218 P34 NAM CAP sing N N 219 P34 NAM HAM sing N N 220 P34 CAP CAK sing Y N 221 P34 CAP CAG doub Y N 222 P34 CAK CAU doub Y N 223 P34 CAK HAK sing N N 224 P34 CAU CAT sing Y N 225 P34 CAU CAR sing Y N 226 P34 CAT CAI sing Y N 227 P34 CAT CAS doub Y N 228 P34 CAI CAF doub Y N 229 P34 CAI HAI sing N N 230 P34 CAF CAE sing Y N 231 P34 CAF HAF sing N N 232 P34 CAE CAH doub Y N 233 P34 CAE HAE sing N N 234 P34 CAH CAS sing Y N 235 P34 CAH HAH sing N N 236 P34 CAS CAQ sing Y N 237 P34 CAQ OAD doub N N 238 P34 CAQ NAN sing Y N 239 P34 NAN CAR sing Y N 240 P34 NAN HAN sing N N 241 P34 CAR CAJ doub Y N 242 P34 CAJ CAG sing Y N 243 P34 CAJ HAJ sing N N 244 P34 CAG HAG sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R21-AI122199 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE' P34 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1XK9 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #