data_6EI8
# 
_entry.id   6EI8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6EI8         pdb_00006ei8 10.2210/pdb6ei8/pdb 
WWPDB D_1200006651 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-10-10 
2 'Structure model' 1 1 2018-12-26 
3 'Structure model' 1 2 2019-05-22 
4 'Structure model' 1 3 2019-06-05 
5 'Structure model' 1 4 2024-01-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Data collection'        
2  2 'Structure model' 'Database references'    
3  2 'Structure model' 'Structure summary'      
4  3 'Structure model' 'Data collection'        
5  3 'Structure model' 'Database references'    
6  4 'Structure model' 'Data collection'        
7  4 'Structure model' 'Database references'    
8  5 'Structure model' 'Data collection'        
9  5 'Structure model' 'Database references'    
10 5 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation                      
2  2 'Structure model' citation_author               
3  2 'Structure model' entity                        
4  3 'Structure model' citation                      
5  3 'Structure model' citation_author               
6  3 'Structure model' pdbx_database_proc            
7  4 'Structure model' citation                      
8  4 'Structure model' pdbx_database_proc            
9  5 'Structure model' chem_comp_atom                
10 5 'Structure model' chem_comp_bond                
11 5 'Structure model' database_2                    
12 5 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.title'                     
2  2 'Structure model' '_entity.formula_weight'              
3  3 'Structure model' '_citation.country'                   
4  3 'Structure model' '_citation.journal_abbrev'            
5  3 'Structure model' '_citation.journal_id_ASTM'           
6  3 'Structure model' '_citation.journal_id_CSD'            
7  3 'Structure model' '_citation.journal_id_ISSN'           
8  3 'Structure model' '_citation.pdbx_database_id_DOI'      
9  3 'Structure model' '_citation.pdbx_database_id_PubMed'   
10 3 'Structure model' '_citation.title'                     
11 3 'Structure model' '_citation.year'                      
12 4 'Structure model' '_citation.journal_volume'            
13 4 'Structure model' '_citation.page_first'                
14 4 'Structure model' '_citation.page_last'                 
15 5 'Structure model' '_database_2.pdbx_DOI'                
16 5 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6EI8 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bou-Nader, C.' 1 ? 
'Pecqueur, L.'  2 ? 
'Hamdane, D.'   3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            58 
_citation.language                  ? 
_citation.page_first                2463 
_citation.page_last                 2473 
_citation.title                     
'Conformational Stability Adaptation of a Double-Stranded RNA-Binding Domain to Transfer RNA Ligand.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.9b00111 
_citation.pdbx_database_id_PubMed   31045345 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bou-Nader, C.'    1 ?                   
primary 'Pecqueur, L.'     2 ?                   
primary 'Barraud, P.'      3 ?                   
primary 'Fontecave, M.'    4 ?                   
primary 'Tisne, C.'        5 ?                   
primary 'Sacquin-Mora, S.' 6 0000-0002-2781-4333 
primary 'Hamdane, D.'      7 0000-0002-1737-8320 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'tRNA-dihydrouridine(20) synthase [NAD(P)+]-like' 13652.602 1  1.3.1.- F359A 'UNP residues 338-450' ? 
2 non-polymer syn 'SULFATE ION'                                     96.063    3  ?       ?     ?                      ? 
3 water       nat water                                             18.015    48 ?       ?     ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Dihydrouridine synthase 2,Up-regulated in lung cancer protein 8,URLC8,tRNA-dihydrouridine synthase 2-like,hDUS2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTSEQTGEPAEDTSGVIKMAVKADRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWD
KSKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHKHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTSEQTGEPAEDTSGVIKMAVKADRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWD
KSKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHKHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   SER n 
1 4   GLU n 
1 5   GLN n 
1 6   THR n 
1 7   GLY n 
1 8   GLU n 
1 9   PRO n 
1 10  ALA n 
1 11  GLU n 
1 12  ASP n 
1 13  THR n 
1 14  SER n 
1 15  GLY n 
1 16  VAL n 
1 17  ILE n 
1 18  LYS n 
1 19  MET n 
1 20  ALA n 
1 21  VAL n 
1 22  LYS n 
1 23  ALA n 
1 24  ASP n 
1 25  ARG n 
1 26  ARG n 
1 27  ALA n 
1 28  TYR n 
1 29  PRO n 
1 30  ALA n 
1 31  GLN n 
1 32  ILE n 
1 33  THR n 
1 34  PRO n 
1 35  LYS n 
1 36  MET n 
1 37  CYS n 
1 38  LEU n 
1 39  LEU n 
1 40  GLU n 
1 41  TRP n 
1 42  CYS n 
1 43  ARG n 
1 44  ARG n 
1 45  GLU n 
1 46  LYS n 
1 47  LEU n 
1 48  ALA n 
1 49  GLN n 
1 50  PRO n 
1 51  VAL n 
1 52  TYR n 
1 53  GLU n 
1 54  THR n 
1 55  VAL n 
1 56  GLN n 
1 57  ARG n 
1 58  PRO n 
1 59  LEU n 
1 60  ASP n 
1 61  ARG n 
1 62  LEU n 
1 63  PHE n 
1 64  SER n 
1 65  SER n 
1 66  ILE n 
1 67  VAL n 
1 68  THR n 
1 69  VAL n 
1 70  ALA n 
1 71  GLU n 
1 72  GLN n 
1 73  LYS n 
1 74  TYR n 
1 75  GLN n 
1 76  SER n 
1 77  THR n 
1 78  LEU n 
1 79  TRP n 
1 80  ASP n 
1 81  LYS n 
1 82  SER n 
1 83  LYS n 
1 84  LYS n 
1 85  LEU n 
1 86  ALA n 
1 87  GLU n 
1 88  GLN n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  ILE n 
1 93  VAL n 
1 94  CYS n 
1 95  LEU n 
1 96  ARG n 
1 97  SER n 
1 98  GLN n 
1 99  GLY n 
1 100 LEU n 
1 101 PRO n 
1 102 GLU n 
1 103 GLY n 
1 104 ARG n 
1 105 LEU n 
1 106 GLY n 
1 107 GLU n 
1 108 GLU n 
1 109 SER n 
1 110 PRO n 
1 111 SER n 
1 112 LEU n 
1 113 HIS n 
1 114 LYS n 
1 115 HIS n 
1 116 HIS n 
1 117 HIS n 
1 118 HIS n 
1 119 HIS n 
1 120 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   120 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DUS2, DUS2L' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               pET11d 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   337 ?   ?   ?   A . n 
A 1 2   THR 2   338 ?   ?   ?   A . n 
A 1 3   SER 3   339 ?   ?   ?   A . n 
A 1 4   GLU 4   340 ?   ?   ?   A . n 
A 1 5   GLN 5   341 ?   ?   ?   A . n 
A 1 6   THR 6   342 ?   ?   ?   A . n 
A 1 7   GLY 7   343 ?   ?   ?   A . n 
A 1 8   GLU 8   344 ?   ?   ?   A . n 
A 1 9   PRO 9   345 ?   ?   ?   A . n 
A 1 10  ALA 10  346 ?   ?   ?   A . n 
A 1 11  GLU 11  347 ?   ?   ?   A . n 
A 1 12  ASP 12  348 348 ASP ASP A . n 
A 1 13  THR 13  349 349 THR THR A . n 
A 1 14  SER 14  350 350 SER SER A . n 
A 1 15  GLY 15  351 351 GLY GLY A . n 
A 1 16  VAL 16  352 352 VAL VAL A . n 
A 1 17  ILE 17  353 353 ILE ILE A . n 
A 1 18  LYS 18  354 354 LYS LYS A . n 
A 1 19  MET 19  355 355 MET MET A . n 
A 1 20  ALA 20  356 356 ALA ALA A . n 
A 1 21  VAL 21  357 357 VAL VAL A . n 
A 1 22  LYS 22  358 358 LYS LYS A . n 
A 1 23  ALA 23  359 359 ALA ALA A . n 
A 1 24  ASP 24  360 360 ASP ASP A . n 
A 1 25  ARG 25  361 361 ARG ARG A . n 
A 1 26  ARG 26  362 362 ARG ARG A . n 
A 1 27  ALA 27  363 363 ALA ALA A . n 
A 1 28  TYR 28  364 364 TYR TYR A . n 
A 1 29  PRO 29  365 365 PRO PRO A . n 
A 1 30  ALA 30  366 366 ALA ALA A . n 
A 1 31  GLN 31  367 367 GLN GLN A . n 
A 1 32  ILE 32  368 368 ILE ILE A . n 
A 1 33  THR 33  369 369 THR THR A . n 
A 1 34  PRO 34  370 370 PRO PRO A . n 
A 1 35  LYS 35  371 371 LYS LYS A . n 
A 1 36  MET 36  372 372 MET MET A . n 
A 1 37  CYS 37  373 373 CYS CYS A . n 
A 1 38  LEU 38  374 374 LEU LEU A . n 
A 1 39  LEU 39  375 375 LEU LEU A . n 
A 1 40  GLU 40  376 376 GLU GLU A . n 
A 1 41  TRP 41  377 377 TRP TRP A . n 
A 1 42  CYS 42  378 378 CYS CYS A . n 
A 1 43  ARG 43  379 379 ARG ARG A . n 
A 1 44  ARG 44  380 380 ARG ARG A . n 
A 1 45  GLU 45  381 381 GLU GLU A . n 
A 1 46  LYS 46  382 382 LYS LYS A . n 
A 1 47  LEU 47  383 383 LEU LEU A . n 
A 1 48  ALA 48  384 384 ALA ALA A . n 
A 1 49  GLN 49  385 385 GLN GLN A . n 
A 1 50  PRO 50  386 386 PRO PRO A . n 
A 1 51  VAL 51  387 387 VAL VAL A . n 
A 1 52  TYR 52  388 388 TYR TYR A . n 
A 1 53  GLU 53  389 389 GLU GLU A . n 
A 1 54  THR 54  390 390 THR THR A . n 
A 1 55  VAL 55  391 391 VAL VAL A . n 
A 1 56  GLN 56  392 392 GLN GLN A . n 
A 1 57  ARG 57  393 393 ARG ARG A . n 
A 1 58  PRO 58  394 394 PRO PRO A . n 
A 1 59  LEU 59  395 395 LEU LEU A . n 
A 1 60  ASP 60  396 396 ASP ASP A . n 
A 1 61  ARG 61  397 397 ARG ARG A . n 
A 1 62  LEU 62  398 398 LEU LEU A . n 
A 1 63  PHE 63  399 399 PHE PHE A . n 
A 1 64  SER 64  400 400 SER SER A . n 
A 1 65  SER 65  401 401 SER SER A . n 
A 1 66  ILE 66  402 402 ILE ILE A . n 
A 1 67  VAL 67  403 403 VAL VAL A . n 
A 1 68  THR 68  404 404 THR THR A . n 
A 1 69  VAL 69  405 405 VAL VAL A . n 
A 1 70  ALA 70  406 406 ALA ALA A . n 
A 1 71  GLU 71  407 407 GLU GLU A . n 
A 1 72  GLN 72  408 408 GLN GLN A . n 
A 1 73  LYS 73  409 409 LYS LYS A . n 
A 1 74  TYR 74  410 410 TYR TYR A . n 
A 1 75  GLN 75  411 411 GLN GLN A . n 
A 1 76  SER 76  412 412 SER SER A . n 
A 1 77  THR 77  413 413 THR THR A . n 
A 1 78  LEU 78  414 414 LEU LEU A . n 
A 1 79  TRP 79  415 415 TRP TRP A . n 
A 1 80  ASP 80  416 416 ASP ASP A . n 
A 1 81  LYS 81  417 417 LYS LYS A . n 
A 1 82  SER 82  418 418 SER SER A . n 
A 1 83  LYS 83  419 419 LYS LYS A . n 
A 1 84  LYS 84  420 420 LYS LYS A . n 
A 1 85  LEU 85  421 421 LEU LEU A . n 
A 1 86  ALA 86  422 422 ALA ALA A . n 
A 1 87  GLU 87  423 423 GLU GLU A . n 
A 1 88  GLN 88  424 424 GLN GLN A . n 
A 1 89  ALA 89  425 425 ALA ALA A . n 
A 1 90  ALA 90  426 426 ALA ALA A . n 
A 1 91  ALA 91  427 427 ALA ALA A . n 
A 1 92  ILE 92  428 428 ILE ILE A . n 
A 1 93  VAL 93  429 429 VAL VAL A . n 
A 1 94  CYS 94  430 430 CYS CYS A . n 
A 1 95  LEU 95  431 431 LEU LEU A . n 
A 1 96  ARG 96  432 432 ARG ARG A . n 
A 1 97  SER 97  433 433 SER SER A . n 
A 1 98  GLN 98  434 434 GLN GLN A . n 
A 1 99  GLY 99  435 435 GLY GLY A . n 
A 1 100 LEU 100 436 436 LEU LEU A . n 
A 1 101 PRO 101 437 437 PRO PRO A . n 
A 1 102 GLU 102 438 438 GLU GLU A . n 
A 1 103 GLY 103 439 439 GLY GLY A . n 
A 1 104 ARG 104 440 440 ARG ARG A . n 
A 1 105 LEU 105 441 441 LEU LEU A . n 
A 1 106 GLY 106 442 442 GLY GLY A . n 
A 1 107 GLU 107 443 443 GLU GLU A . n 
A 1 108 GLU 108 444 444 GLU GLU A . n 
A 1 109 SER 109 445 ?   ?   ?   A . n 
A 1 110 PRO 110 446 ?   ?   ?   A . n 
A 1 111 SER 111 447 ?   ?   ?   A . n 
A 1 112 LEU 112 448 ?   ?   ?   A . n 
A 1 113 HIS 113 449 ?   ?   ?   A . n 
A 1 114 LYS 114 450 ?   ?   ?   A . n 
A 1 115 HIS 115 451 ?   ?   ?   A . n 
A 1 116 HIS 116 452 ?   ?   ?   A . n 
A 1 117 HIS 117 453 ?   ?   ?   A . n 
A 1 118 HIS 118 454 ?   ?   ?   A . n 
A 1 119 HIS 119 455 ?   ?   ?   A . n 
A 1 120 HIS 120 456 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1  501 1  SO4 SO4 A . 
C 2 SO4 1  502 2  SO4 SO4 A . 
D 2 SO4 1  503 3  SO4 SO4 A . 
E 3 HOH 1  601 41 HOH HOH A . 
E 3 HOH 2  602 19 HOH HOH A . 
E 3 HOH 3  603 28 HOH HOH A . 
E 3 HOH 4  604 5  HOH HOH A . 
E 3 HOH 5  605 7  HOH HOH A . 
E 3 HOH 6  606 18 HOH HOH A . 
E 3 HOH 7  607 33 HOH HOH A . 
E 3 HOH 8  608 25 HOH HOH A . 
E 3 HOH 9  609 23 HOH HOH A . 
E 3 HOH 10 610 2  HOH HOH A . 
E 3 HOH 11 611 22 HOH HOH A . 
E 3 HOH 12 612 14 HOH HOH A . 
E 3 HOH 13 613 32 HOH HOH A . 
E 3 HOH 14 614 17 HOH HOH A . 
E 3 HOH 15 615 36 HOH HOH A . 
E 3 HOH 16 616 16 HOH HOH A . 
E 3 HOH 17 617 34 HOH HOH A . 
E 3 HOH 18 618 27 HOH HOH A . 
E 3 HOH 19 619 54 HOH HOH A . 
E 3 HOH 20 620 30 HOH HOH A . 
E 3 HOH 21 621 37 HOH HOH A . 
E 3 HOH 22 622 40 HOH HOH A . 
E 3 HOH 23 623 44 HOH HOH A . 
E 3 HOH 24 624 12 HOH HOH A . 
E 3 HOH 25 625 24 HOH HOH A . 
E 3 HOH 26 626 13 HOH HOH A . 
E 3 HOH 27 627 11 HOH HOH A . 
E 3 HOH 28 628 20 HOH HOH A . 
E 3 HOH 29 629 49 HOH HOH A . 
E 3 HOH 30 630 26 HOH HOH A . 
E 3 HOH 31 631 43 HOH HOH A . 
E 3 HOH 32 632 15 HOH HOH A . 
E 3 HOH 33 633 39 HOH HOH A . 
E 3 HOH 34 634 56 HOH HOH A . 
E 3 HOH 35 635 21 HOH HOH A . 
E 3 HOH 36 636 58 HOH HOH A . 
E 3 HOH 37 637 6  HOH HOH A . 
E 3 HOH 38 638 38 HOH HOH A . 
E 3 HOH 39 639 1  HOH HOH A . 
E 3 HOH 40 640 10 HOH HOH A . 
E 3 HOH 41 641 42 HOH HOH A . 
E 3 HOH 42 642 53 HOH HOH A . 
E 3 HOH 43 643 52 HOH HOH A . 
E 3 HOH 44 644 45 HOH HOH A . 
E 3 HOH 45 645 50 HOH HOH A . 
E 3 HOH 46 646 57 HOH HOH A . 
E 3 HOH 47 647 29 HOH HOH A . 
E 3 HOH 48 648 35 HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 358 ? CG ? A LYS 22 CG 
2 1 Y 1 A LYS 358 ? CD ? A LYS 22 CD 
3 1 Y 1 A LYS 358 ? CE ? A LYS 22 CE 
4 1 Y 1 A LYS 358 ? NZ ? A LYS 22 NZ 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .      4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6EI8 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     81.110 
_cell.length_a_esd                 ? 
_cell.length_b                     81.110 
_cell.length_b_esd                 ? 
_cell.length_c                     56.050 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6EI8 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6EI8 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.90 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.45 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;2M ammonium sulfate
50 mM sodium cacodylate
15 mM magnesium acetate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 9M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-06-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9762 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9762 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 2' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate            57.92 
_reflns.entry_id                         6EI8 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.25 
_reflns.d_resolution_low                 43.81 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       10384 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.2 
_reflns.pdbx_Rmerge_I_obs                0.2334 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.34 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.25 
_reflns_shell.d_res_low                   2.33 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.01 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1020 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             11.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.746 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -4.96240 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][2]                            -4.96240 
_refine.aniso_B[2][3]                            0.00000 
_refine.aniso_B[3][3]                            9.92480 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               52.30 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.884 
_refine.correlation_coeff_Fo_to_Fc_free          0.846 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6EI8 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.25 
_refine.ls_d_res_low                             43.81 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     10383 
_refine.ls_number_reflns_R_free                  1038 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.262 
_refine.ls_R_factor_R_free                       0.286 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.259 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4wft 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.183 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.187 
_refine.pdbx_overall_SU_R_Blow_DPI               0.211 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.202 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6EI8 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.41 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        768 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             52 
_refine_hist.number_atoms_total               835 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        43.81 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 806  ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.08  ? 1094 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 287  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 20   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 113  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 806  ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 2.78  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 18.29 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 104  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 904  ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.25 
_refine_ls_shell.d_res_low                        2.52 
_refine_ls_shell.number_reflns_all                2889 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             289 
_refine_ls_shell.number_reflns_R_work             2600 
_refine_ls_shell.percent_reflns_obs               99.97 
_refine_ls_shell.percent_reflns_R_free            10.00 
_refine_ls_shell.R_factor_all                     0.2140 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2292 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2123 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   5 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6EI8 
_struct.title                        'Crystal structure of human tRNA-dihydrouridine (20) synthase dsRBD F359A mutant' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6EI8 
_struct_keywords.text            'double-stranded RNA-binding domain, RNA binding protein' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DUS2L_HUMAN 
_struct_ref.pdbx_db_accession          Q9NX74 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDK
SKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHK
;
_struct_ref.pdbx_align_begin           338 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6EI8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 114 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NX74 
_struct_ref_seq.db_align_beg                  338 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  450 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       338 
_struct_ref_seq.pdbx_auth_seq_align_end       450 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6EI8 MET A 1   ? UNP Q9NX74 ?   ?   'initiating methionine' 337 1 
1 6EI8 ALA A 23  ? UNP Q9NX74 PHE 359 'engineered mutation'   359 2 
1 6EI8 HIS A 115 ? UNP Q9NX74 ?   ?   'expression tag'        451 3 
1 6EI8 HIS A 116 ? UNP Q9NX74 ?   ?   'expression tag'        452 4 
1 6EI8 HIS A 117 ? UNP Q9NX74 ?   ?   'expression tag'        453 5 
1 6EI8 HIS A 118 ? UNP Q9NX74 ?   ?   'expression tag'        454 6 
1 6EI8 HIS A 119 ? UNP Q9NX74 ?   ?   'expression tag'        455 7 
1 6EI8 HIS A 120 ? UNP Q9NX74 ?   ?   'expression tag'        456 8 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 430  ? 
1 MORE         -28  ? 
1 'SSA (A^2)'  6660 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                SEC-MALLS 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 33 ? GLU A 45 ? THR A 369 GLU A 381 1 ? 13 
HELX_P HELX_P2 AA2 PRO A 58 ? ARG A 61 ? PRO A 394 ARG A 397 5 ? 4  
HELX_P HELX_P3 AA3 SER A 82 ? SER A 97 ? SER A 418 SER A 433 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 16 ? MET A 19 ? VAL A 352 MET A 355 
AA1 2 GLN A 72 ? SER A 76 ? GLN A 408 SER A 412 
AA1 3 LEU A 62 ? VAL A 69 ? LEU A 398 VAL A 405 
AA1 4 VAL A 51 ? ARG A 57 ? VAL A 387 ARG A 393 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 17 ? N ILE A 353 O LYS A 73 ? O LYS A 409 
AA1 2 3 O TYR A 74 ? O TYR A 410 N VAL A 67 ? N VAL A 403 
AA1 3 4 O SER A 64 ? O SER A 400 N VAL A 55 ? N VAL A 391 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 501 ? 4 'binding site for residue SO4 A 501' 
AC2 Software A SO4 502 ? 3 'binding site for residue SO4 A 502' 
AC3 Software A SO4 503 ? 2 'binding site for residue SO4 A 503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ALA A 20 ? ALA A 356 . ? 3_654 ? 
2 AC1 4 GLU A 53 ? GLU A 389 . ? 1_555 ? 
3 AC1 4 THR A 54 ? THR A 390 . ? 1_555 ? 
4 AC1 4 HOH E .  ? HOH A 610 . ? 1_555 ? 
5 AC2 3 ASP A 12 ? ASP A 348 . ? 3_654 ? 
6 AC2 3 ARG A 57 ? ARG A 393 . ? 1_555 ? 
7 AC2 3 TRP A 79 ? TRP A 415 . ? 1_555 ? 
8 AC3 2 ARG A 25 ? ARG A 361 . ? 1_555 ? 
9 AC3 2 ARG A 26 ? ARG A 362 . ? 1_555 ? 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLU 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     407 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             70.22 
_pdbx_validate_torsion.psi             -1.64 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 337 ? A MET 1   
2  1 Y 1 A THR 338 ? A THR 2   
3  1 Y 1 A SER 339 ? A SER 3   
4  1 Y 1 A GLU 340 ? A GLU 4   
5  1 Y 1 A GLN 341 ? A GLN 5   
6  1 Y 1 A THR 342 ? A THR 6   
7  1 Y 1 A GLY 343 ? A GLY 7   
8  1 Y 1 A GLU 344 ? A GLU 8   
9  1 Y 1 A PRO 345 ? A PRO 9   
10 1 Y 1 A ALA 346 ? A ALA 10  
11 1 Y 1 A GLU 347 ? A GLU 11  
12 1 Y 1 A SER 445 ? A SER 109 
13 1 Y 1 A PRO 446 ? A PRO 110 
14 1 Y 1 A SER 447 ? A SER 111 
15 1 Y 1 A LEU 448 ? A LEU 112 
16 1 Y 1 A HIS 449 ? A HIS 113 
17 1 Y 1 A LYS 450 ? A LYS 114 
18 1 Y 1 A HIS 451 ? A HIS 115 
19 1 Y 1 A HIS 452 ? A HIS 116 
20 1 Y 1 A HIS 453 ? A HIS 117 
21 1 Y 1 A HIS 454 ? A HIS 118 
22 1 Y 1 A HIS 455 ? A HIS 119 
23 1 Y 1 A HIS 456 ? A HIS 120 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASP N    N N N 41  
ASP CA   C N S 42  
ASP C    C N N 43  
ASP O    O N N 44  
ASP CB   C N N 45  
ASP CG   C N N 46  
ASP OD1  O N N 47  
ASP OD2  O N N 48  
ASP OXT  O N N 49  
ASP H    H N N 50  
ASP H2   H N N 51  
ASP HA   H N N 52  
ASP HB2  H N N 53  
ASP HB3  H N N 54  
ASP HD2  H N N 55  
ASP HXT  H N N 56  
CYS N    N N N 57  
CYS CA   C N R 58  
CYS C    C N N 59  
CYS O    O N N 60  
CYS CB   C N N 61  
CYS SG   S N N 62  
CYS OXT  O N N 63  
CYS H    H N N 64  
CYS H2   H N N 65  
CYS HA   H N N 66  
CYS HB2  H N N 67  
CYS HB3  H N N 68  
CYS HG   H N N 69  
CYS HXT  H N N 70  
GLN N    N N N 71  
GLN CA   C N S 72  
GLN C    C N N 73  
GLN O    O N N 74  
GLN CB   C N N 75  
GLN CG   C N N 76  
GLN CD   C N N 77  
GLN OE1  O N N 78  
GLN NE2  N N N 79  
GLN OXT  O N N 80  
GLN H    H N N 81  
GLN H2   H N N 82  
GLN HA   H N N 83  
GLN HB2  H N N 84  
GLN HB3  H N N 85  
GLN HG2  H N N 86  
GLN HG3  H N N 87  
GLN HE21 H N N 88  
GLN HE22 H N N 89  
GLN HXT  H N N 90  
GLU N    N N N 91  
GLU CA   C N S 92  
GLU C    C N N 93  
GLU O    O N N 94  
GLU CB   C N N 95  
GLU CG   C N N 96  
GLU CD   C N N 97  
GLU OE1  O N N 98  
GLU OE2  O N N 99  
GLU OXT  O N N 100 
GLU H    H N N 101 
GLU H2   H N N 102 
GLU HA   H N N 103 
GLU HB2  H N N 104 
GLU HB3  H N N 105 
GLU HG2  H N N 106 
GLU HG3  H N N 107 
GLU HE2  H N N 108 
GLU HXT  H N N 109 
GLY N    N N N 110 
GLY CA   C N N 111 
GLY C    C N N 112 
GLY O    O N N 113 
GLY OXT  O N N 114 
GLY H    H N N 115 
GLY H2   H N N 116 
GLY HA2  H N N 117 
GLY HA3  H N N 118 
GLY HXT  H N N 119 
HIS N    N N N 120 
HIS CA   C N S 121 
HIS C    C N N 122 
HIS O    O N N 123 
HIS CB   C N N 124 
HIS CG   C Y N 125 
HIS ND1  N Y N 126 
HIS CD2  C Y N 127 
HIS CE1  C Y N 128 
HIS NE2  N Y N 129 
HIS OXT  O N N 130 
HIS H    H N N 131 
HIS H2   H N N 132 
HIS HA   H N N 133 
HIS HB2  H N N 134 
HIS HB3  H N N 135 
HIS HD1  H N N 136 
HIS HD2  H N N 137 
HIS HE1  H N N 138 
HIS HE2  H N N 139 
HIS HXT  H N N 140 
HOH O    O N N 141 
HOH H1   H N N 142 
HOH H2   H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
SO4 S    S N N 287 
SO4 O1   O N N 288 
SO4 O2   O N N 289 
SO4 O3   O N N 290 
SO4 O4   O N N 291 
THR N    N N N 292 
THR CA   C N S 293 
THR C    C N N 294 
THR O    O N N 295 
THR CB   C N R 296 
THR OG1  O N N 297 
THR CG2  C N N 298 
THR OXT  O N N 299 
THR H    H N N 300 
THR H2   H N N 301 
THR HA   H N N 302 
THR HB   H N N 303 
THR HG1  H N N 304 
THR HG21 H N N 305 
THR HG22 H N N 306 
THR HG23 H N N 307 
THR HXT  H N N 308 
TRP N    N N N 309 
TRP CA   C N S 310 
TRP C    C N N 311 
TRP O    O N N 312 
TRP CB   C N N 313 
TRP CG   C Y N 314 
TRP CD1  C Y N 315 
TRP CD2  C Y N 316 
TRP NE1  N Y N 317 
TRP CE2  C Y N 318 
TRP CE3  C Y N 319 
TRP CZ2  C Y N 320 
TRP CZ3  C Y N 321 
TRP CH2  C Y N 322 
TRP OXT  O N N 323 
TRP H    H N N 324 
TRP H2   H N N 325 
TRP HA   H N N 326 
TRP HB2  H N N 327 
TRP HB3  H N N 328 
TRP HD1  H N N 329 
TRP HE1  H N N 330 
TRP HE3  H N N 331 
TRP HZ2  H N N 332 
TRP HZ3  H N N 333 
TRP HH2  H N N 334 
TRP HXT  H N N 335 
TYR N    N N N 336 
TYR CA   C N S 337 
TYR C    C N N 338 
TYR O    O N N 339 
TYR CB   C N N 340 
TYR CG   C Y N 341 
TYR CD1  C Y N 342 
TYR CD2  C Y N 343 
TYR CE1  C Y N 344 
TYR CE2  C Y N 345 
TYR CZ   C Y N 346 
TYR OH   O N N 347 
TYR OXT  O N N 348 
TYR H    H N N 349 
TYR H2   H N N 350 
TYR HA   H N N 351 
TYR HB2  H N N 352 
TYR HB3  H N N 353 
TYR HD1  H N N 354 
TYR HD2  H N N 355 
TYR HE1  H N N 356 
TYR HE2  H N N 357 
TYR HH   H N N 358 
TYR HXT  H N N 359 
VAL N    N N N 360 
VAL CA   C N S 361 
VAL C    C N N 362 
VAL O    O N N 363 
VAL CB   C N N 364 
VAL CG1  C N N 365 
VAL CG2  C N N 366 
VAL OXT  O N N 367 
VAL H    H N N 368 
VAL H2   H N N 369 
VAL HA   H N N 370 
VAL HB   H N N 371 
VAL HG11 H N N 372 
VAL HG12 H N N 373 
VAL HG13 H N N 374 
VAL HG21 H N N 375 
VAL HG22 H N N 376 
VAL HG23 H N N 377 
VAL HXT  H N N 378 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASP N   CA   sing N N 39  
ASP N   H    sing N N 40  
ASP N   H2   sing N N 41  
ASP CA  C    sing N N 42  
ASP CA  CB   sing N N 43  
ASP CA  HA   sing N N 44  
ASP C   O    doub N N 45  
ASP C   OXT  sing N N 46  
ASP CB  CG   sing N N 47  
ASP CB  HB2  sing N N 48  
ASP CB  HB3  sing N N 49  
ASP CG  OD1  doub N N 50  
ASP CG  OD2  sing N N 51  
ASP OD2 HD2  sing N N 52  
ASP OXT HXT  sing N N 53  
CYS N   CA   sing N N 54  
CYS N   H    sing N N 55  
CYS N   H2   sing N N 56  
CYS CA  C    sing N N 57  
CYS CA  CB   sing N N 58  
CYS CA  HA   sing N N 59  
CYS C   O    doub N N 60  
CYS C   OXT  sing N N 61  
CYS CB  SG   sing N N 62  
CYS CB  HB2  sing N N 63  
CYS CB  HB3  sing N N 64  
CYS SG  HG   sing N N 65  
CYS OXT HXT  sing N N 66  
GLN N   CA   sing N N 67  
GLN N   H    sing N N 68  
GLN N   H2   sing N N 69  
GLN CA  C    sing N N 70  
GLN CA  CB   sing N N 71  
GLN CA  HA   sing N N 72  
GLN C   O    doub N N 73  
GLN C   OXT  sing N N 74  
GLN CB  CG   sing N N 75  
GLN CB  HB2  sing N N 76  
GLN CB  HB3  sing N N 77  
GLN CG  CD   sing N N 78  
GLN CG  HG2  sing N N 79  
GLN CG  HG3  sing N N 80  
GLN CD  OE1  doub N N 81  
GLN CD  NE2  sing N N 82  
GLN NE2 HE21 sing N N 83  
GLN NE2 HE22 sing N N 84  
GLN OXT HXT  sing N N 85  
GLU N   CA   sing N N 86  
GLU N   H    sing N N 87  
GLU N   H2   sing N N 88  
GLU CA  C    sing N N 89  
GLU CA  CB   sing N N 90  
GLU CA  HA   sing N N 91  
GLU C   O    doub N N 92  
GLU C   OXT  sing N N 93  
GLU CB  CG   sing N N 94  
GLU CB  HB2  sing N N 95  
GLU CB  HB3  sing N N 96  
GLU CG  CD   sing N N 97  
GLU CG  HG2  sing N N 98  
GLU CG  HG3  sing N N 99  
GLU CD  OE1  doub N N 100 
GLU CD  OE2  sing N N 101 
GLU OE2 HE2  sing N N 102 
GLU OXT HXT  sing N N 103 
GLY N   CA   sing N N 104 
GLY N   H    sing N N 105 
GLY N   H2   sing N N 106 
GLY CA  C    sing N N 107 
GLY CA  HA2  sing N N 108 
GLY CA  HA3  sing N N 109 
GLY C   O    doub N N 110 
GLY C   OXT  sing N N 111 
GLY OXT HXT  sing N N 112 
HIS N   CA   sing N N 113 
HIS N   H    sing N N 114 
HIS N   H2   sing N N 115 
HIS CA  C    sing N N 116 
HIS CA  CB   sing N N 117 
HIS CA  HA   sing N N 118 
HIS C   O    doub N N 119 
HIS C   OXT  sing N N 120 
HIS CB  CG   sing N N 121 
HIS CB  HB2  sing N N 122 
HIS CB  HB3  sing N N 123 
HIS CG  ND1  sing Y N 124 
HIS CG  CD2  doub Y N 125 
HIS ND1 CE1  doub Y N 126 
HIS ND1 HD1  sing N N 127 
HIS CD2 NE2  sing Y N 128 
HIS CD2 HD2  sing N N 129 
HIS CE1 NE2  sing Y N 130 
HIS CE1 HE1  sing N N 131 
HIS NE2 HE2  sing N N 132 
HIS OXT HXT  sing N N 133 
HOH O   H1   sing N N 134 
HOH O   H2   sing N N 135 
ILE N   CA   sing N N 136 
ILE N   H    sing N N 137 
ILE N   H2   sing N N 138 
ILE CA  C    sing N N 139 
ILE CA  CB   sing N N 140 
ILE CA  HA   sing N N 141 
ILE C   O    doub N N 142 
ILE C   OXT  sing N N 143 
ILE CB  CG1  sing N N 144 
ILE CB  CG2  sing N N 145 
ILE CB  HB   sing N N 146 
ILE CG1 CD1  sing N N 147 
ILE CG1 HG12 sing N N 148 
ILE CG1 HG13 sing N N 149 
ILE CG2 HG21 sing N N 150 
ILE CG2 HG22 sing N N 151 
ILE CG2 HG23 sing N N 152 
ILE CD1 HD11 sing N N 153 
ILE CD1 HD12 sing N N 154 
ILE CD1 HD13 sing N N 155 
ILE OXT HXT  sing N N 156 
LEU N   CA   sing N N 157 
LEU N   H    sing N N 158 
LEU N   H2   sing N N 159 
LEU CA  C    sing N N 160 
LEU CA  CB   sing N N 161 
LEU CA  HA   sing N N 162 
LEU C   O    doub N N 163 
LEU C   OXT  sing N N 164 
LEU CB  CG   sing N N 165 
LEU CB  HB2  sing N N 166 
LEU CB  HB3  sing N N 167 
LEU CG  CD1  sing N N 168 
LEU CG  CD2  sing N N 169 
LEU CG  HG   sing N N 170 
LEU CD1 HD11 sing N N 171 
LEU CD1 HD12 sing N N 172 
LEU CD1 HD13 sing N N 173 
LEU CD2 HD21 sing N N 174 
LEU CD2 HD22 sing N N 175 
LEU CD2 HD23 sing N N 176 
LEU OXT HXT  sing N N 177 
LYS N   CA   sing N N 178 
LYS N   H    sing N N 179 
LYS N   H2   sing N N 180 
LYS CA  C    sing N N 181 
LYS CA  CB   sing N N 182 
LYS CA  HA   sing N N 183 
LYS C   O    doub N N 184 
LYS C   OXT  sing N N 185 
LYS CB  CG   sing N N 186 
LYS CB  HB2  sing N N 187 
LYS CB  HB3  sing N N 188 
LYS CG  CD   sing N N 189 
LYS CG  HG2  sing N N 190 
LYS CG  HG3  sing N N 191 
LYS CD  CE   sing N N 192 
LYS CD  HD2  sing N N 193 
LYS CD  HD3  sing N N 194 
LYS CE  NZ   sing N N 195 
LYS CE  HE2  sing N N 196 
LYS CE  HE3  sing N N 197 
LYS NZ  HZ1  sing N N 198 
LYS NZ  HZ2  sing N N 199 
LYS NZ  HZ3  sing N N 200 
LYS OXT HXT  sing N N 201 
MET N   CA   sing N N 202 
MET N   H    sing N N 203 
MET N   H2   sing N N 204 
MET CA  C    sing N N 205 
MET CA  CB   sing N N 206 
MET CA  HA   sing N N 207 
MET C   O    doub N N 208 
MET C   OXT  sing N N 209 
MET CB  CG   sing N N 210 
MET CB  HB2  sing N N 211 
MET CB  HB3  sing N N 212 
MET CG  SD   sing N N 213 
MET CG  HG2  sing N N 214 
MET CG  HG3  sing N N 215 
MET SD  CE   sing N N 216 
MET CE  HE1  sing N N 217 
MET CE  HE2  sing N N 218 
MET CE  HE3  sing N N 219 
MET OXT HXT  sing N N 220 
PHE N   CA   sing N N 221 
PHE N   H    sing N N 222 
PHE N   H2   sing N N 223 
PHE CA  C    sing N N 224 
PHE CA  CB   sing N N 225 
PHE CA  HA   sing N N 226 
PHE C   O    doub N N 227 
PHE C   OXT  sing N N 228 
PHE CB  CG   sing N N 229 
PHE CB  HB2  sing N N 230 
PHE CB  HB3  sing N N 231 
PHE CG  CD1  doub Y N 232 
PHE CG  CD2  sing Y N 233 
PHE CD1 CE1  sing Y N 234 
PHE CD1 HD1  sing N N 235 
PHE CD2 CE2  doub Y N 236 
PHE CD2 HD2  sing N N 237 
PHE CE1 CZ   doub Y N 238 
PHE CE1 HE1  sing N N 239 
PHE CE2 CZ   sing Y N 240 
PHE CE2 HE2  sing N N 241 
PHE CZ  HZ   sing N N 242 
PHE OXT HXT  sing N N 243 
PRO N   CA   sing N N 244 
PRO N   CD   sing N N 245 
PRO N   H    sing N N 246 
PRO CA  C    sing N N 247 
PRO CA  CB   sing N N 248 
PRO CA  HA   sing N N 249 
PRO C   O    doub N N 250 
PRO C   OXT  sing N N 251 
PRO CB  CG   sing N N 252 
PRO CB  HB2  sing N N 253 
PRO CB  HB3  sing N N 254 
PRO CG  CD   sing N N 255 
PRO CG  HG2  sing N N 256 
PRO CG  HG3  sing N N 257 
PRO CD  HD2  sing N N 258 
PRO CD  HD3  sing N N 259 
PRO OXT HXT  sing N N 260 
SER N   CA   sing N N 261 
SER N   H    sing N N 262 
SER N   H2   sing N N 263 
SER CA  C    sing N N 264 
SER CA  CB   sing N N 265 
SER CA  HA   sing N N 266 
SER C   O    doub N N 267 
SER C   OXT  sing N N 268 
SER CB  OG   sing N N 269 
SER CB  HB2  sing N N 270 
SER CB  HB3  sing N N 271 
SER OG  HG   sing N N 272 
SER OXT HXT  sing N N 273 
SO4 S   O1   doub N N 274 
SO4 S   O2   doub N N 275 
SO4 S   O3   sing N N 276 
SO4 S   O4   sing N N 277 
THR N   CA   sing N N 278 
THR N   H    sing N N 279 
THR N   H2   sing N N 280 
THR CA  C    sing N N 281 
THR CA  CB   sing N N 282 
THR CA  HA   sing N N 283 
THR C   O    doub N N 284 
THR C   OXT  sing N N 285 
THR CB  OG1  sing N N 286 
THR CB  CG2  sing N N 287 
THR CB  HB   sing N N 288 
THR OG1 HG1  sing N N 289 
THR CG2 HG21 sing N N 290 
THR CG2 HG22 sing N N 291 
THR CG2 HG23 sing N N 292 
THR OXT HXT  sing N N 293 
TRP N   CA   sing N N 294 
TRP N   H    sing N N 295 
TRP N   H2   sing N N 296 
TRP CA  C    sing N N 297 
TRP CA  CB   sing N N 298 
TRP CA  HA   sing N N 299 
TRP C   O    doub N N 300 
TRP C   OXT  sing N N 301 
TRP CB  CG   sing N N 302 
TRP CB  HB2  sing N N 303 
TRP CB  HB3  sing N N 304 
TRP CG  CD1  doub Y N 305 
TRP CG  CD2  sing Y N 306 
TRP CD1 NE1  sing Y N 307 
TRP CD1 HD1  sing N N 308 
TRP CD2 CE2  doub Y N 309 
TRP CD2 CE3  sing Y N 310 
TRP NE1 CE2  sing Y N 311 
TRP NE1 HE1  sing N N 312 
TRP CE2 CZ2  sing Y N 313 
TRP CE3 CZ3  doub Y N 314 
TRP CE3 HE3  sing N N 315 
TRP CZ2 CH2  doub Y N 316 
TRP CZ2 HZ2  sing N N 317 
TRP CZ3 CH2  sing Y N 318 
TRP CZ3 HZ3  sing N N 319 
TRP CH2 HH2  sing N N 320 
TRP OXT HXT  sing N N 321 
TYR N   CA   sing N N 322 
TYR N   H    sing N N 323 
TYR N   H2   sing N N 324 
TYR CA  C    sing N N 325 
TYR CA  CB   sing N N 326 
TYR CA  HA   sing N N 327 
TYR C   O    doub N N 328 
TYR C   OXT  sing N N 329 
TYR CB  CG   sing N N 330 
TYR CB  HB2  sing N N 331 
TYR CB  HB3  sing N N 332 
TYR CG  CD1  doub Y N 333 
TYR CG  CD2  sing Y N 334 
TYR CD1 CE1  sing Y N 335 
TYR CD1 HD1  sing N N 336 
TYR CD2 CE2  doub Y N 337 
TYR CD2 HD2  sing N N 338 
TYR CE1 CZ   doub Y N 339 
TYR CE1 HE1  sing N N 340 
TYR CE2 CZ   sing Y N 341 
TYR CE2 HE2  sing N N 342 
TYR CZ  OH   sing N N 343 
TYR OH  HH   sing N N 344 
TYR OXT HXT  sing N N 345 
VAL N   CA   sing N N 346 
VAL N   H    sing N N 347 
VAL N   H2   sing N N 348 
VAL CA  C    sing N N 349 
VAL CA  CB   sing N N 350 
VAL CA  HA   sing N N 351 
VAL C   O    doub N N 352 
VAL C   OXT  sing N N 353 
VAL CB  CG1  sing N N 354 
VAL CB  CG2  sing N N 355 
VAL CB  HB   sing N N 356 
VAL CG1 HG11 sing N N 357 
VAL CG1 HG12 sing N N 358 
VAL CG1 HG13 sing N N 359 
VAL CG2 HG21 sing N N 360 
VAL CG2 HG22 sing N N 361 
VAL CG2 HG23 sing N N 362 
VAL OXT HXT  sing N N 363 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4WFT 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    6EI8 
_atom_sites.fract_transf_matrix[1][1]   0.012329 
_atom_sites.fract_transf_matrix[1][2]   0.007118 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014236 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017841 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_