data_6EKR # _entry.id 6EKR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6EKR WWPDB D_1200006765 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EKR _pdbx_database_status.recvd_initial_deposition_date 2017-09-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tamulaitiene, G.' 1 ? 'Manakova, E.' 2 0000-0002-6027-2265 'Grazulis, S.' 3 ? 'Siksnys, V.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Type IIP restriction endonuclease PfoI with cognate DNA' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tamulaitiene, G.' 1 ? primary 'Manakova, E.' 2 ? primary 'Jovaisaite, V.' 3 ? primary 'Grazulis, S.' 4 ? primary 'Siksnys, V.' 5 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6EKR _cell.details ? _cell.formula_units_Z ? _cell.length_a 134.794 _cell.length_a_esd ? _cell.length_b 134.794 _cell.length_b_esd ? _cell.length_c 134.794 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EKR _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Type ii site-specific deoxyribonuclease' 36329.820 1 3.1.21.4 K185A,K187A ? ? 2 non-polymer syn 'SULFATE ION' 96.063 5 ? ? ? ? 3 water nat water 18.015 26 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)DILKEKIDVASRLYNLNLDHIPATLQVIEHA(MSE)LLLKNNAGYGYFGSFNGKNTQEYHSFTFNGEYSRPVRDD LFITDYDFFVSGFREFNESLRDIGSKWSSFDSRRANKIIYTSV(MSE)SVACCFDLWKSGSRKTPGTFFEIF(MSE)AAV LKW(MSE)IPDEIFSKHIPLIDQLESDDESIDPSSVSTDIVIKSAYANASVVIPLKITTRERIVQPFAQQRILDSYFGNG VYFSFLACISETQQDKKKKKVNHICVPGTIRLYQKYLSSLSG(MSE)YYCDIPERYLERDLTDIIPVRT(MSE)GDFLFD IYSFFRSQGAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDILKEKIDVASRLYNLNLDHIPATLQVIEHAMLLLKNNAGYGYFGSFNGKNTQEYHSFTFNGEYSRPVRDDLFITDYDF FVSGFREFNESLRDIGSKWSSFDSRRANKIIYTSVMSVACCFDLWKSGSRKTPGTFFEIFMAAVLKWMIPDEIFSKHIPL IDQLESDDESIDPSSVSTDIVIKSAYANASVVIPLKITTRERIVQPFAQQRILDSYFGNGVYFSFLACISETQQDKKKKK VNHICVPGTIRLYQKYLSSLSGMYYCDIPERYLERDLTDIIPVRTMGDFLFDIYSFFRSQGAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASP n 1 3 ILE n 1 4 LEU n 1 5 LYS n 1 6 GLU n 1 7 LYS n 1 8 ILE n 1 9 ASP n 1 10 VAL n 1 11 ALA n 1 12 SER n 1 13 ARG n 1 14 LEU n 1 15 TYR n 1 16 ASN n 1 17 LEU n 1 18 ASN n 1 19 LEU n 1 20 ASP n 1 21 HIS n 1 22 ILE n 1 23 PRO n 1 24 ALA n 1 25 THR n 1 26 LEU n 1 27 GLN n 1 28 VAL n 1 29 ILE n 1 30 GLU n 1 31 HIS n 1 32 ALA n 1 33 MSE n 1 34 LEU n 1 35 LEU n 1 36 LEU n 1 37 LYS n 1 38 ASN n 1 39 ASN n 1 40 ALA n 1 41 GLY n 1 42 TYR n 1 43 GLY n 1 44 TYR n 1 45 PHE n 1 46 GLY n 1 47 SER n 1 48 PHE n 1 49 ASN n 1 50 GLY n 1 51 LYS n 1 52 ASN n 1 53 THR n 1 54 GLN n 1 55 GLU n 1 56 TYR n 1 57 HIS n 1 58 SER n 1 59 PHE n 1 60 THR n 1 61 PHE n 1 62 ASN n 1 63 GLY n 1 64 GLU n 1 65 TYR n 1 66 SER n 1 67 ARG n 1 68 PRO n 1 69 VAL n 1 70 ARG n 1 71 ASP n 1 72 ASP n 1 73 LEU n 1 74 PHE n 1 75 ILE n 1 76 THR n 1 77 ASP n 1 78 TYR n 1 79 ASP n 1 80 PHE n 1 81 PHE n 1 82 VAL n 1 83 SER n 1 84 GLY n 1 85 PHE n 1 86 ARG n 1 87 GLU n 1 88 PHE n 1 89 ASN n 1 90 GLU n 1 91 SER n 1 92 LEU n 1 93 ARG n 1 94 ASP n 1 95 ILE n 1 96 GLY n 1 97 SER n 1 98 LYS n 1 99 TRP n 1 100 SER n 1 101 SER n 1 102 PHE n 1 103 ASP n 1 104 SER n 1 105 ARG n 1 106 ARG n 1 107 ALA n 1 108 ASN n 1 109 LYS n 1 110 ILE n 1 111 ILE n 1 112 TYR n 1 113 THR n 1 114 SER n 1 115 VAL n 1 116 MSE n 1 117 SER n 1 118 VAL n 1 119 ALA n 1 120 CYS n 1 121 CYS n 1 122 PHE n 1 123 ASP n 1 124 LEU n 1 125 TRP n 1 126 LYS n 1 127 SER n 1 128 GLY n 1 129 SER n 1 130 ARG n 1 131 LYS n 1 132 THR n 1 133 PRO n 1 134 GLY n 1 135 THR n 1 136 PHE n 1 137 PHE n 1 138 GLU n 1 139 ILE n 1 140 PHE n 1 141 MSE n 1 142 ALA n 1 143 ALA n 1 144 VAL n 1 145 LEU n 1 146 LYS n 1 147 TRP n 1 148 MSE n 1 149 ILE n 1 150 PRO n 1 151 ASP n 1 152 GLU n 1 153 ILE n 1 154 PHE n 1 155 SER n 1 156 LYS n 1 157 HIS n 1 158 ILE n 1 159 PRO n 1 160 LEU n 1 161 ILE n 1 162 ASP n 1 163 GLN n 1 164 LEU n 1 165 GLU n 1 166 SER n 1 167 ASP n 1 168 ASP n 1 169 GLU n 1 170 SER n 1 171 ILE n 1 172 ASP n 1 173 PRO n 1 174 SER n 1 175 SER n 1 176 VAL n 1 177 SER n 1 178 THR n 1 179 ASP n 1 180 ILE n 1 181 VAL n 1 182 ILE n 1 183 LYS n 1 184 SER n 1 185 ALA n 1 186 TYR n 1 187 ALA n 1 188 ASN n 1 189 ALA n 1 190 SER n 1 191 VAL n 1 192 VAL n 1 193 ILE n 1 194 PRO n 1 195 LEU n 1 196 LYS n 1 197 ILE n 1 198 THR n 1 199 THR n 1 200 ARG n 1 201 GLU n 1 202 ARG n 1 203 ILE n 1 204 VAL n 1 205 GLN n 1 206 PRO n 1 207 PHE n 1 208 ALA n 1 209 GLN n 1 210 GLN n 1 211 ARG n 1 212 ILE n 1 213 LEU n 1 214 ASP n 1 215 SER n 1 216 TYR n 1 217 PHE n 1 218 GLY n 1 219 ASN n 1 220 GLY n 1 221 VAL n 1 222 TYR n 1 223 PHE n 1 224 SER n 1 225 PHE n 1 226 LEU n 1 227 ALA n 1 228 CYS n 1 229 ILE n 1 230 SER n 1 231 GLU n 1 232 THR n 1 233 GLN n 1 234 GLN n 1 235 ASP n 1 236 LYS n 1 237 LYS n 1 238 LYS n 1 239 LYS n 1 240 LYS n 1 241 VAL n 1 242 ASN n 1 243 HIS n 1 244 ILE n 1 245 CYS n 1 246 VAL n 1 247 PRO n 1 248 GLY n 1 249 THR n 1 250 ILE n 1 251 ARG n 1 252 LEU n 1 253 TYR n 1 254 GLN n 1 255 LYS n 1 256 TYR n 1 257 LEU n 1 258 SER n 1 259 SER n 1 260 LEU n 1 261 SER n 1 262 GLY n 1 263 MSE n 1 264 TYR n 1 265 TYR n 1 266 CYS n 1 267 ASP n 1 268 ILE n 1 269 PRO n 1 270 GLU n 1 271 ARG n 1 272 TYR n 1 273 LEU n 1 274 GLU n 1 275 ARG n 1 276 ASP n 1 277 LEU n 1 278 THR n 1 279 ASP n 1 280 ILE n 1 281 ILE n 1 282 PRO n 1 283 VAL n 1 284 ARG n 1 285 THR n 1 286 MSE n 1 287 GLY n 1 288 ASP n 1 289 PHE n 1 290 LEU n 1 291 PHE n 1 292 ASP n 1 293 ILE n 1 294 TYR n 1 295 SER n 1 296 PHE n 1 297 PHE n 1 298 ARG n 1 299 SER n 1 300 GLN n 1 301 GLY n 1 302 ALA n 1 303 ALA n 1 304 ALA n 1 305 LEU n 1 306 GLU n 1 307 HIS n 1 308 HIS n 1 309 HIS n 1 310 HIS n 1 311 HIS n 1 312 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 312 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 573 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ER2566 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q93K38_KLEPN _struct_ref.pdbx_db_accession Q93K38 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDILKEKIDVASRLYNLNLDHIPATLQVIEHAMLLLKNNAGYGYFGSFNGKNTQEYHSFTFNGEYSRPVRDDLFITDYDF FVSGFREFNESLRDIGSKWSSFDSRRANKIIYTSVMSVACCFDLWKSGSRKTPGTFFEIFMAAVLKWMIPDEIFSKHIPL IDQLESDDESIDPSSVSTDIVIKSKYKNASVVIPLKITTRERIVQPFAQQRILDSYFGNGVYFSFLACISETQQDKKKKK VNHICVPGTIRLYQKYLSSLSGMYYCDIPERYLERDLTDIIPVRTMGDFLFDIYSFFRSQG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6EKR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 301 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q93K38 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 301 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 301 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6EKR ALA A 185 ? UNP Q93K38 LYS 185 'engineered mutation' 185 1 1 6EKR ALA A 187 ? UNP Q93K38 LYS 187 'engineered mutation' 187 2 1 6EKR ALA A 302 ? UNP Q93K38 ? ? 'expression tag' 302 3 1 6EKR ALA A 303 ? UNP Q93K38 ? ? 'expression tag' 303 4 1 6EKR ALA A 304 ? UNP Q93K38 ? ? 'expression tag' 304 5 1 6EKR LEU A 305 ? UNP Q93K38 ? ? 'expression tag' 305 6 1 6EKR GLU A 306 ? UNP Q93K38 ? ? 'expression tag' 306 7 1 6EKR HIS A 307 ? UNP Q93K38 ? ? 'expression tag' 307 8 1 6EKR HIS A 308 ? UNP Q93K38 ? ? 'expression tag' 308 9 1 6EKR HIS A 309 ? UNP Q93K38 ? ? 'expression tag' 309 10 1 6EKR HIS A 310 ? UNP Q93K38 ? ? 'expression tag' 310 11 1 6EKR HIS A 311 ? UNP Q93K38 ? ? 'expression tag' 311 12 1 6EKR HIS A 312 ? UNP Q93K38 ? ? 'expression tag' 312 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EKR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.97 _exptl_crystal.description 'small cubic crystals (30-50 mkm)' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystallization buffer: 0.1M NaHepes pH7.5, 1.4M ammonium sulfate and glycerol 10%. Complex of Kpn2I with DNA was used at concentration 2-7.5mg/ml ; _exptl_crystal_grow.pdbx_pH_range 6.5-7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.98019 1.0 2 0.98029 1.0 3 0.97789 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98019,0.98029,0.97789 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 62.9 _reflns.entry_id 6EKR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.88 _reflns.d_resolution_low 95.31 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9398 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 39.8 _reflns.pdbx_Rmerge_I_obs 0.116 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.116 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.134 _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.88 _reflns_shell.d_res_low 3.04 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 7.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1347 _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.537 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 34.6 _reflns_shell.pdbx_Rsym_value 0.537 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.555 _reflns_shell.pdbx_Rpim_I_all 0.093 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.086 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.932 _refine.correlation_coeff_Fo_to_Fc_free 0.898 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EKR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.88 _refine.ls_d_res_low 20.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8353 _refine.ls_number_reflns_R_free 959 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.59 _refine.ls_percent_reflns_R_free 10.3 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21498 _refine.ls_R_factor_R_free 0.26398 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20944 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.432 _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2452 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 2503 _refine_hist.d_res_high 2.88 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.022 2532 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.140 1.958 3427 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.586 5.000 302 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.430 23.525 122 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.262 15.000 429 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.796 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.082 0.200 368 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 1917 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.210 0.200 1150 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.315 0.200 1730 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.118 0.200 62 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.150 0.200 37 ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? 0.115 0.200 4 ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.579 1.500 1510 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.081 2.000 2451 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.216 3.000 1022 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 1.941 4.500 976 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.882 _refine_ls_shell.d_res_low 2.955 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 65 _refine_ls_shell.number_reflns_R_work 612 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.432 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.274 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6EKR _struct.title 'Crystal structure of Type IIP restriction endonuclease Kpn2I' _struct.pdbx_descriptor 'restriction endonuclease PfoI (E.C.3.1.21.4)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EKR _struct_keywords.text 'Restriction endonuclease, PD-(D/E)xK nuclease, Hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? LEU A 17 ? ASP A 2 LEU A 17 1 ? 16 HELX_P HELX_P2 AA2 HIS A 21 ? ALA A 40 ? HIS A 21 ALA A 40 1 ? 20 HELX_P HELX_P3 AA3 ASP A 77 ? LEU A 92 ? ASP A 77 LEU A 92 1 ? 16 HELX_P HELX_P4 AA4 SER A 100 ? LYS A 126 ? SER A 100 LYS A 126 1 ? 27 HELX_P HELX_P5 AA5 LYS A 131 ? ILE A 149 ? LYS A 131 ILE A 149 1 ? 19 HELX_P HELX_P6 AA6 ILE A 158 ? ASP A 172 ? ILE A 158 ASP A 172 1 ? 15 HELX_P HELX_P7 AA7 THR A 199 ? ARG A 202 ? THR A 199 ARG A 202 5 ? 4 HELX_P HELX_P8 AA8 ILE A 203 ? GLY A 218 ? ILE A 203 GLY A 218 1 ? 16 HELX_P HELX_P9 AA9 VAL A 246 ? LEU A 257 ? VAL A 246 LEU A 257 1 ? 12 HELX_P HELX_P10 AB1 PRO A 269 ? LEU A 273 ? PRO A 269 LEU A 273 5 ? 5 HELX_P HELX_P11 AB2 GLU A 274 ? ASP A 279 ? GLU A 274 ASP A 279 1 ? 6 HELX_P HELX_P12 AB3 MSE A 286 ? SER A 299 ? MSE A 286 SER A 299 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ASP 2 N ? ? A MSE 1 A ASP 2 1_555 ? ? ? ? ? ? ? 1.333 ? covale2 covale both ? A ALA 32 C ? ? ? 1_555 A MSE 33 N ? ? A ALA 32 A MSE 33 1_555 ? ? ? ? ? ? ? 1.338 ? covale3 covale both ? A MSE 33 C ? ? ? 1_555 A LEU 34 N ? ? A MSE 33 A LEU 34 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale both ? A VAL 115 C ? ? ? 1_555 A MSE 116 N ? ? A VAL 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale both ? A MSE 116 C ? ? ? 1_555 A SER 117 N ? ? A MSE 116 A SER 117 1_555 ? ? ? ? ? ? ? 1.327 ? covale6 covale both ? A PHE 140 C ? ? ? 1_555 A MSE 141 N ? ? A PHE 140 A MSE 141 1_555 ? ? ? ? ? ? ? 1.333 ? covale7 covale both ? A MSE 141 C ? ? ? 1_555 A ALA 142 N ? ? A MSE 141 A ALA 142 1_555 ? ? ? ? ? ? ? 1.328 ? covale8 covale both ? A TRP 147 C ? ? ? 1_555 A MSE 148 N ? ? A TRP 147 A MSE 148 1_555 ? ? ? ? ? ? ? 1.325 ? covale9 covale both ? A MSE 148 C ? ? ? 1_555 A ILE 149 N ? ? A MSE 148 A ILE 149 1_555 ? ? ? ? ? ? ? 1.323 ? covale10 covale both ? A GLY 262 C ? ? ? 1_555 A MSE 263 N ? ? A GLY 262 A MSE 263 1_555 ? ? ? ? ? ? ? 1.333 ? covale11 covale both ? A MSE 263 C ? ? ? 1_555 A TYR 264 N ? ? A MSE 263 A TYR 264 1_555 ? ? ? ? ? ? ? 1.326 ? covale12 covale both ? A THR 285 C ? ? ? 1_555 A MSE 286 N ? ? A THR 285 A MSE 286 1_555 ? ? ? ? ? ? ? 1.336 ? covale13 covale both ? A MSE 286 C ? ? ? 1_555 A GLY 287 N ? ? A MSE 286 A GLY 287 1_555 ? ? ? ? ? ? ? 1.334 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 41 ? ASN A 49 ? GLY A 41 ASN A 49 AA1 2 THR A 53 ? PHE A 61 ? THR A 53 PHE A 61 AA1 3 GLU A 64 ? TYR A 65 ? GLU A 64 TYR A 65 AA2 1 ASP A 179 ? LYS A 183 ? ASP A 179 LYS A 183 AA2 2 SER A 190 ? PRO A 194 ? SER A 190 PRO A 194 AA2 3 TYR A 222 ? ALA A 227 ? TYR A 222 ALA A 227 AA2 4 GLY A 262 ? TYR A 265 ? GLY A 262 TYR A 265 AA2 5 VAL A 283 ? THR A 285 ? VAL A 283 THR A 285 AA3 1 THR A 232 ? ASP A 235 ? THR A 232 ASP A 235 AA3 2 LYS A 240 ? HIS A 243 ? LYS A 240 HIS A 243 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 48 ? N PHE A 48 O GLN A 54 ? O GLN A 54 AA1 2 3 N PHE A 61 ? N PHE A 61 O GLU A 64 ? O GLU A 64 AA2 1 2 N ILE A 180 ? N ILE A 180 O ILE A 193 ? O ILE A 193 AA2 2 3 N VAL A 192 ? N VAL A 192 O PHE A 223 ? O PHE A 223 AA2 3 4 N LEU A 226 ? N LEU A 226 O TYR A 264 ? O TYR A 264 AA2 4 5 N MSE A 263 ? N MSE A 263 O ARG A 284 ? O ARG A 284 AA3 1 2 N GLN A 233 ? N GLN A 233 O ASN A 242 ? O ASN A 242 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 401 ? 3 'binding site for residue SO4 A 401' AC2 Software A SO4 402 ? 6 'binding site for residue SO4 A 402' AC3 Software A SO4 403 ? 1 'binding site for residue SO4 A 403' AC4 Software A SO4 404 ? 4 'binding site for residue SO4 A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LEU A 26 ? LEU A 26 . ? 1_555 ? 2 AC1 3 PHE A 85 ? PHE A 85 . ? 1_555 ? 3 AC1 3 ARG A 86 ? ARG A 86 . ? 1_555 ? 4 AC2 6 LYS A 146 ? LYS A 146 . ? 1_555 ? 5 AC2 6 GLU A 152 ? GLU A 152 . ? 1_555 ? 6 AC2 6 ILE A 153 ? ILE A 153 . ? 1_555 ? 7 AC2 6 PHE A 154 ? PHE A 154 . ? 1_555 ? 8 AC2 6 SER A 155 ? SER A 155 . ? 1_555 ? 9 AC2 6 HOH G . ? HOH A 510 . ? 1_555 ? 10 AC3 1 ARG A 200 ? ARG A 200 . ? 1_555 ? 11 AC4 4 ASP A 235 ? ASP A 235 . ? 1_555 ? 12 AC4 4 LYS A 238 ? LYS A 238 . ? 1_555 ? 13 AC4 4 LYS A 240 ? LYS A 240 . ? 1_555 ? 14 AC4 4 ASN A 242 ? ASN A 242 . ? 1_555 ? # _atom_sites.entry_id 6EKR _atom_sites.fract_transf_matrix[1][1] 0.007419 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007419 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007419 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 MSE 33 33 33 MSE MSE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 TRP 99 99 99 TRP TRP A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 MSE 116 116 116 MSE MSE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 MSE 141 141 141 MSE MSE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 TRP 147 147 147 TRP TRP A . n A 1 148 MSE 148 148 148 MSE MSE A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 PHE 207 207 207 PHE PHE A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 TYR 216 216 216 TYR TYR A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 TYR 222 222 222 TYR TYR A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 CYS 228 228 228 CYS CYS A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 SER 230 230 230 SER SER A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 THR 232 232 232 THR THR A . n A 1 233 GLN 233 233 233 GLN GLN A . n A 1 234 GLN 234 234 234 GLN GLN A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 HIS 243 243 243 HIS HIS A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 CYS 245 245 245 CYS CYS A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 SER 259 259 259 SER SER A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 MSE 263 263 263 MSE MSE A . n A 1 264 TYR 264 264 264 TYR TYR A . n A 1 265 TYR 265 265 265 TYR TYR A . n A 1 266 CYS 266 266 266 CYS CYS A . n A 1 267 ASP 267 267 267 ASP ASP A . n A 1 268 ILE 268 268 268 ILE ILE A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 ARG 271 271 271 ARG ARG A . n A 1 272 TYR 272 272 272 TYR TYR A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 ASP 276 276 276 ASP ASP A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 ASP 279 279 279 ASP ASP A . n A 1 280 ILE 280 280 280 ILE ILE A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 PRO 282 282 282 PRO PRO A . n A 1 283 VAL 283 283 283 VAL VAL A . n A 1 284 ARG 284 284 284 ARG ARG A . n A 1 285 THR 285 285 285 THR THR A . n A 1 286 MSE 286 286 286 MSE MSE A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 ASP 288 288 288 ASP ASP A . n A 1 289 PHE 289 289 289 PHE PHE A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 PHE 291 291 291 PHE PHE A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 ILE 293 293 293 ILE ILE A . n A 1 294 TYR 294 294 294 TYR TYR A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 PHE 296 296 296 PHE PHE A . n A 1 297 PHE 297 297 297 PHE PHE A . n A 1 298 ARG 298 298 298 ARG ARG A . n A 1 299 SER 299 299 299 SER SER A . n A 1 300 GLN 300 300 300 GLN GLN A . n A 1 301 GLY 301 301 301 GLY GLY A . n A 1 302 ALA 302 302 302 ALA ALA A . n A 1 303 ALA 303 303 303 ALA ALA A . n A 1 304 ALA 304 304 ? ? ? A . n A 1 305 LEU 305 305 ? ? ? A . n A 1 306 GLU 306 306 ? ? ? A . n A 1 307 HIS 307 307 ? ? ? A . n A 1 308 HIS 308 308 ? ? ? A . n A 1 309 HIS 309 309 ? ? ? A . n A 1 310 HIS 310 310 ? ? ? A . n A 1 311 HIS 311 311 ? ? ? A . n A 1 312 HIS 312 312 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 1 SO4 SO4 A . C 2 SO4 1 402 2 SO4 SO4 A . D 2 SO4 1 403 3 SO4 SO4 A . E 2 SO4 1 404 4 SO4 SO4 A . F 2 SO4 1 405 5 SO4 SO4 A . G 3 HOH 1 501 3 HOH HOH A . G 3 HOH 2 502 4 HOH HOH A . G 3 HOH 3 503 26 HOH HOH A . G 3 HOH 4 504 16 HOH HOH A . G 3 HOH 5 505 5 HOH HOH A . G 3 HOH 6 506 7 HOH HOH A . G 3 HOH 7 507 13 HOH HOH A . G 3 HOH 8 508 19 HOH HOH A . G 3 HOH 9 509 6 HOH HOH A . G 3 HOH 10 510 22 HOH HOH A . G 3 HOH 11 511 14 HOH HOH A . G 3 HOH 12 512 12 HOH HOH A . G 3 HOH 13 513 21 HOH HOH A . G 3 HOH 14 514 10 HOH HOH A . G 3 HOH 15 515 1 HOH HOH A . G 3 HOH 16 516 18 HOH HOH A . G 3 HOH 17 517 23 HOH HOH A . G 3 HOH 18 518 15 HOH HOH A . G 3 HOH 19 519 9 HOH HOH A . G 3 HOH 20 520 2 HOH HOH A . G 3 HOH 21 521 24 HOH HOH A . G 3 HOH 22 522 17 HOH HOH A . G 3 HOH 23 523 8 HOH HOH A . G 3 HOH 24 524 20 HOH HOH A . G 3 HOH 25 525 11 HOH HOH A . G 3 HOH 26 526 25 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A MSE 33 A MSE 33 ? MET 'modified residue' 3 A MSE 116 A MSE 116 ? MET 'modified residue' 4 A MSE 141 A MSE 141 ? MET 'modified residue' 5 A MSE 148 A MSE 148 ? MET 'modified residue' 6 A MSE 263 A MSE 263 ? MET 'modified residue' 7 A MSE 286 A MSE 286 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3460 ? 1 MORE -99 ? 1 'SSA (A^2)' 25460 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 16_555 x,-y,-z+1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 67.3970000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 405 ? F SO4 . 2 1 A SO4 405 ? F SO4 . 3 1 A HOH 513 ? G HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2018-10-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.2.0019 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 'CCP4 6.2: Scala version 3.3.20 : 23/06/11' 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? Auto-Rickshaw ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 126 ? ? 29.28 56.97 2 1 SER A 129 ? ? -58.91 -7.51 3 1 ARG A 130 ? ? 65.97 -5.77 4 1 ILE A 149 ? ? -110.62 71.43 5 1 SER A 155 ? ? -88.73 36.89 6 1 ILE A 171 ? ? -80.21 -70.17 7 1 ARG A 200 ? ? 57.05 -131.37 8 1 ARG A 284 ? ? -116.47 -155.64 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 126 ? CE ? A LYS 126 CE 2 1 Y 1 A LYS 126 ? NZ ? A LYS 126 NZ 3 1 Y 1 A LYS 156 ? CE ? A LYS 156 CE 4 1 Y 1 A LYS 156 ? NZ ? A LYS 156 NZ 5 1 Y 1 A LYS 236 ? CD ? A LYS 236 CD 6 1 Y 1 A LYS 236 ? CE ? A LYS 236 CE 7 1 Y 1 A LYS 236 ? NZ ? A LYS 236 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 304 ? A ALA 304 2 1 Y 1 A LEU 305 ? A LEU 305 3 1 Y 1 A GLU 306 ? A GLU 306 4 1 Y 1 A HIS 307 ? A HIS 307 5 1 Y 1 A HIS 308 ? A HIS 308 6 1 Y 1 A HIS 309 ? A HIS 309 7 1 Y 1 A HIS 310 ? A HIS 310 8 1 Y 1 A HIS 311 ? A HIS 311 9 1 Y 1 A HIS 312 ? A HIS 312 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Research Council of Lithuania' Lithuania MIP-41/2013 1 'European Union' ? 'BioStruct-X (grant agreement 283570)' 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'gel filtration and similarity to homologous restriction enzymes support the dimeric assembly' #