data_6EPW # _entry.id 6EPW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6EPW WWPDB D_1200007018 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EPW _pdbx_database_status.recvd_initial_deposition_date 2017-10-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sledz, P.' 1 ? 'Caflisch, A.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Hitting a moving target: simulation and crystallography study of ATAD2 bromodomain blockers' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Sledz, P.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6EPW _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.072 _cell.length_a_esd ? _cell.length_b 79.072 _cell.length_b_esd ? _cell.length_c 139.764 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EPW _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATPase family AAA domain-containing protein 2' 15453.514 1 3.6.1.3 ? ? ? 2 non-polymer syn '(2~{R})-~{N}-[5-[3,5-bis(oxidanyl)phenyl]-4-ethanoyl-1,3-thiazol-2-yl]-2-carbamimidamido-propanamide' 363.392 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 46 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AAA nuclear coregulator cancer-associated protein,ANCCA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_seq_one_letter_code_can ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLN n 1 4 GLU n 1 5 GLU n 1 6 ASP n 1 7 THR n 1 8 PHE n 1 9 ARG n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 PHE n 1 15 LEU n 1 16 ARG n 1 17 ASN n 1 18 VAL n 1 19 THR n 1 20 HIS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ILE n 1 25 ASP n 1 26 LYS n 1 27 ARG n 1 28 PHE n 1 29 ARG n 1 30 VAL n 1 31 PHE n 1 32 THR n 1 33 LYS n 1 34 PRO n 1 35 VAL n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 GLU n 1 40 VAL n 1 41 PRO n 1 42 ASP n 1 43 TYR n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 PRO n 1 51 MET n 1 52 ASP n 1 53 LEU n 1 54 SER n 1 55 SER n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 ILE n 1 61 ASP n 1 62 LEU n 1 63 HIS n 1 64 LYS n 1 65 TYR n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 LYS n 1 70 ASP n 1 71 TYR n 1 72 LEU n 1 73 ARG n 1 74 ASP n 1 75 ILE n 1 76 ASP n 1 77 LEU n 1 78 ILE n 1 79 CYS n 1 80 SER n 1 81 ASN n 1 82 ALA n 1 83 LEU n 1 84 GLU n 1 85 TYR n 1 86 ASN n 1 87 PRO n 1 88 ASP n 1 89 ARG n 1 90 ASP n 1 91 PRO n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 LEU n 1 96 ILE n 1 97 ARG n 1 98 HIS n 1 99 ARG n 1 100 ALA n 1 101 CYS n 1 102 ALA n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 THR n 1 107 ALA n 1 108 TYR n 1 109 ALA n 1 110 ILE n 1 111 ILE n 1 112 LYS n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 ASP n 1 117 GLU n 1 118 ASP n 1 119 PHE n 1 120 GLU n 1 121 GLN n 1 122 LEU n 1 123 CYS n 1 124 GLU n 1 125 GLU n 1 126 ILE n 1 127 GLN n 1 128 GLU n 1 129 SER n 1 130 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATAD2, L16, PRO2000' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATAD2_HUMAN _struct_ref.pdbx_db_accession Q6PL18 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNA LEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _struct_ref.pdbx_align_begin 981 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6EPW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6PL18 _struct_ref_seq.db_align_beg 981 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 981 _struct_ref_seq.pdbx_auth_seq_align_end 1108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6EPW SER A 1 ? UNP Q6PL18 ? ? 'expression tag' 979 1 1 6EPW MET A 2 ? UNP Q6PL18 ? ? 'expression tag' 980 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BQ8 non-polymer . '(2~{R})-~{N}-[5-[3,5-bis(oxidanyl)phenyl]-4-ethanoyl-1,3-thiazol-2-yl]-2-carbamimidamido-propanamide' ? 'C15 H17 N5 O4 S' 363.392 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EPW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.08 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2M ammonium sulfate, 0.1M Bis-Tris pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999870 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999870 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6EPW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.92 _reflns.d_resolution_low 48.910 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 37062 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.87 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.91 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.046 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.92 _reflns_shell.d_res_low 2.04 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.03 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5875 _reflns_shell.percent_possible_all 98.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.88 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.849 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.832 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EPW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.924 _refine.ls_d_res_low 48.910 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36990 _refine.ls_number_reflns_R_free 1862 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.67 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2238 _refine.ls_R_factor_R_free 0.2429 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2227 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.08 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.22 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1069 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 51 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 1166 _refine_hist.d_res_high 1.924 _refine_hist.d_res_low 48.910 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1149 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.597 ? 1561 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 9.983 ? 992 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 170 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 206 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9238 1.9758 . . 138 2604 96.00 . . . 0.3147 . 0.3099 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9758 2.0340 . . 141 2724 100.00 . . . 0.2988 . 0.2736 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0340 2.0996 . . 141 2679 100.00 . . . 0.2394 . 0.2562 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0996 2.1747 . . 141 2732 100.00 . . . 0.2905 . 0.2453 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1747 2.2617 . . 146 2706 100.00 . . . 0.2863 . 0.2327 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2617 2.3647 . . 139 2692 100.00 . . . 0.2511 . 0.2379 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3647 2.4893 . . 146 2741 100.00 . . . 0.2727 . 0.2431 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4893 2.6453 . . 144 2711 100.00 . . . 0.3003 . 0.2434 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6453 2.8495 . . 148 2676 100.00 . . . 0.2709 . 0.2484 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8495 3.1362 . . 145 2723 100.00 . . . 0.2637 . 0.2392 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1362 3.5899 . . 146 2719 100.00 . . . 0.2252 . 0.2262 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5899 4.5224 . . 145 2692 100.00 . . . 0.2283 . 0.1914 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5224 48.9260 . . 142 2729 100.00 . . . 0.2031 . 0.2031 . . . . . . . . . . # _struct.entry_id 6EPW _struct.title 'The ATAD2 bromodomain in complex with compound UZH-DU32' _struct.pdbx_descriptor 'ATPase family AAA domain-containing protein 2 (E.C.3.6.1.3)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EPW _struct_keywords.text 'Bromodomain, ATAD2, inhibitor, complex, CYTOSOLIC PROTEIN' _struct_keywords.pdbx_keywords 'CYTOSOLIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? ILE A 24 ? SER A 979 ILE A 1002 1 ? 24 HELX_P HELX_P2 AA2 ASP A 25 ? THR A 32 ? ASP A 1003 THR A 1010 5 ? 8 HELX_P HELX_P3 AA3 ASP A 42 ? ILE A 47 ? ASP A 1020 ILE A 1025 1 ? 6 HELX_P HELX_P4 AA4 ASP A 52 ? LEU A 62 ? ASP A 1030 LEU A 1040 1 ? 11 HELX_P HELX_P5 AA5 THR A 67 ? ASN A 86 ? THR A 1045 ASN A 1064 1 ? 20 HELX_P HELX_P6 AA6 ASP A 90 ? LEU A 115 ? ASP A 1068 LEU A 1093 1 ? 26 HELX_P HELX_P7 AA7 ASP A 116 ? SER A 129 ? ASP A 1094 SER A 1107 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ARG _struct_conn.ptnr1_label_seq_id 89 _struct_conn.ptnr1_label_atom_id NH1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id D _struct_conn.ptnr2_label_comp_id SO4 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id O2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ARG _struct_conn.ptnr1_auth_seq_id 1067 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id SO4 _struct_conn.ptnr2_auth_seq_id 1203 _struct_conn.ptnr2_symmetry 5_655 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.301 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A BQ8 1201 ? 9 'binding site for residue BQ8 A 1201' AC2 Software A BQ8 1202 ? 10 'binding site for residue BQ8 A 1202' AC3 Software A SO4 1203 ? 4 'binding site for residue SO4 A 1203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 VAL A 30 ? VAL A 1008 . ? 1_555 ? 2 AC1 9 VAL A 35 ? VAL A 1013 . ? 1_555 ? 3 AC1 9 TYR A 85 ? TYR A 1063 . ? 1_555 ? 4 AC1 9 ASN A 86 ? ASN A 1064 . ? 1_555 ? 5 AC1 9 GLY A 92 ? GLY A 1070 . ? 1_555 ? 6 AC1 9 ASP A 93 ? ASP A 1071 . ? 1_555 ? 7 AC1 9 HOH E . ? HOH A 1303 . ? 1_555 ? 8 AC1 9 HOH E . ? HOH A 1317 . ? 1_555 ? 9 AC1 9 HOH E . ? HOH A 1329 . ? 1_555 ? 10 AC2 10 PRO A 34 ? PRO A 1012 . ? 1_555 ? 11 AC2 10 VAL A 35 ? VAL A 1013 . ? 1_555 ? 12 AC2 10 ASP A 36 ? ASP A 1014 . ? 10_447 ? 13 AC2 10 PRO A 37 ? PRO A 1015 . ? 1_555 ? 14 AC2 10 TYR A 43 ? TYR A 1021 . ? 1_555 ? 15 AC2 10 ILE A 47 ? ILE A 1025 . ? 1_555 ? 16 AC2 10 PRO A 50 ? PRO A 1028 . ? 1_555 ? 17 AC2 10 HOH E . ? HOH A 1301 . ? 10_447 ? 18 AC2 10 HOH E . ? HOH A 1301 . ? 1_555 ? 19 AC2 10 HOH E . ? HOH A 1302 . ? 1_555 ? 20 AC3 4 ARG A 9 ? ARG A 987 . ? 1_555 ? 21 AC3 4 ARG A 12 ? ARG A 990 . ? 1_555 ? 22 AC3 4 ARG A 16 ? ARG A 994 . ? 1_555 ? 23 AC3 4 ARG A 89 ? ARG A 1067 . ? 6_444 ? # _atom_sites.entry_id 6EPW _atom_sites.fract_transf_matrix[1][1] 0.012647 _atom_sites.fract_transf_matrix[1][2] 0.007302 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014603 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007155 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 979 979 SER SER A . n A 1 2 MET 2 980 980 MET MET A . n A 1 3 GLN 3 981 981 GLN GLN A . n A 1 4 GLU 4 982 982 GLU GLU A . n A 1 5 GLU 5 983 983 GLU GLU A . n A 1 6 ASP 6 984 984 ASP ASP A . n A 1 7 THR 7 985 985 THR THR A . n A 1 8 PHE 8 986 986 PHE PHE A . n A 1 9 ARG 9 987 987 ARG ARG A . n A 1 10 GLU 10 988 988 GLU GLU A . n A 1 11 LEU 11 989 989 LEU LEU A . n A 1 12 ARG 12 990 990 ARG ARG A . n A 1 13 ILE 13 991 991 ILE ILE A . n A 1 14 PHE 14 992 992 PHE PHE A . n A 1 15 LEU 15 993 993 LEU LEU A . n A 1 16 ARG 16 994 994 ARG ARG A . n A 1 17 ASN 17 995 995 ASN ASN A . n A 1 18 VAL 18 996 996 VAL VAL A . n A 1 19 THR 19 997 997 THR THR A . n A 1 20 HIS 20 998 998 HIS HIS A . n A 1 21 ARG 21 999 999 ARG ARG A . n A 1 22 LEU 22 1000 1000 LEU LEU A . n A 1 23 ALA 23 1001 1001 ALA ALA A . n A 1 24 ILE 24 1002 1002 ILE ILE A . n A 1 25 ASP 25 1003 1003 ASP ASP A . n A 1 26 LYS 26 1004 1004 LYS LYS A . n A 1 27 ARG 27 1005 1005 ARG ARG A . n A 1 28 PHE 28 1006 1006 PHE PHE A . n A 1 29 ARG 29 1007 1007 ARG ARG A . n A 1 30 VAL 30 1008 1008 VAL VAL A . n A 1 31 PHE 31 1009 1009 PHE PHE A . n A 1 32 THR 32 1010 1010 THR THR A . n A 1 33 LYS 33 1011 1011 LYS LYS A . n A 1 34 PRO 34 1012 1012 PRO PRO A . n A 1 35 VAL 35 1013 1013 VAL VAL A . n A 1 36 ASP 36 1014 1014 ASP ASP A . n A 1 37 PRO 37 1015 1015 PRO PRO A . n A 1 38 ASP 38 1016 1016 ASP ASP A . n A 1 39 GLU 39 1017 1017 GLU GLU A . n A 1 40 VAL 40 1018 1018 VAL VAL A . n A 1 41 PRO 41 1019 1019 PRO PRO A . n A 1 42 ASP 42 1020 1020 ASP ASP A . n A 1 43 TYR 43 1021 1021 TYR TYR A . n A 1 44 VAL 44 1022 1022 VAL VAL A . n A 1 45 THR 45 1023 1023 THR THR A . n A 1 46 VAL 46 1024 1024 VAL VAL A . n A 1 47 ILE 47 1025 1025 ILE ILE A . n A 1 48 LYS 48 1026 1026 LYS LYS A . n A 1 49 GLN 49 1027 1027 GLN GLN A . n A 1 50 PRO 50 1028 1028 PRO PRO A . n A 1 51 MET 51 1029 1029 MET MET A . n A 1 52 ASP 52 1030 1030 ASP ASP A . n A 1 53 LEU 53 1031 1031 LEU LEU A . n A 1 54 SER 54 1032 1032 SER SER A . n A 1 55 SER 55 1033 1033 SER SER A . n A 1 56 VAL 56 1034 1034 VAL VAL A . n A 1 57 ILE 57 1035 1035 ILE ILE A . n A 1 58 SER 58 1036 1036 SER SER A . n A 1 59 LYS 59 1037 1037 LYS LYS A . n A 1 60 ILE 60 1038 1038 ILE ILE A . n A 1 61 ASP 61 1039 1039 ASP ASP A . n A 1 62 LEU 62 1040 1040 LEU LEU A . n A 1 63 HIS 63 1041 1041 HIS HIS A . n A 1 64 LYS 64 1042 1042 LYS LYS A . n A 1 65 TYR 65 1043 1043 TYR TYR A . n A 1 66 LEU 66 1044 1044 LEU LEU A . n A 1 67 THR 67 1045 1045 THR THR A . n A 1 68 VAL 68 1046 1046 VAL VAL A . n A 1 69 LYS 69 1047 1047 LYS LYS A . n A 1 70 ASP 70 1048 1048 ASP ASP A . n A 1 71 TYR 71 1049 1049 TYR TYR A . n A 1 72 LEU 72 1050 1050 LEU LEU A . n A 1 73 ARG 73 1051 1051 ARG ARG A . n A 1 74 ASP 74 1052 1052 ASP ASP A . n A 1 75 ILE 75 1053 1053 ILE ILE A . n A 1 76 ASP 76 1054 1054 ASP ASP A . n A 1 77 LEU 77 1055 1055 LEU LEU A . n A 1 78 ILE 78 1056 1056 ILE ILE A . n A 1 79 CYS 79 1057 1057 CYS CYS A . n A 1 80 SER 80 1058 1058 SER SER A . n A 1 81 ASN 81 1059 1059 ASN ASN A . n A 1 82 ALA 82 1060 1060 ALA ALA A . n A 1 83 LEU 83 1061 1061 LEU LEU A . n A 1 84 GLU 84 1062 1062 GLU GLU A . n A 1 85 TYR 85 1063 1063 TYR TYR A . n A 1 86 ASN 86 1064 1064 ASN ASN A . n A 1 87 PRO 87 1065 1065 PRO PRO A . n A 1 88 ASP 88 1066 1066 ASP ASP A . n A 1 89 ARG 89 1067 1067 ARG ARG A . n A 1 90 ASP 90 1068 1068 ASP ASP A . n A 1 91 PRO 91 1069 1069 PRO PRO A . n A 1 92 GLY 92 1070 1070 GLY GLY A . n A 1 93 ASP 93 1071 1071 ASP ASP A . n A 1 94 ARG 94 1072 1072 ARG ARG A . n A 1 95 LEU 95 1073 1073 LEU LEU A . n A 1 96 ILE 96 1074 1074 ILE ILE A . n A 1 97 ARG 97 1075 1075 ARG ARG A . n A 1 98 HIS 98 1076 1076 HIS HIS A . n A 1 99 ARG 99 1077 1077 ARG ARG A . n A 1 100 ALA 100 1078 1078 ALA ALA A . n A 1 101 CYS 101 1079 1079 CYS CYS A . n A 1 102 ALA 102 1080 1080 ALA ALA A . n A 1 103 LEU 103 1081 1081 LEU LEU A . n A 1 104 ARG 104 1082 1082 ARG ARG A . n A 1 105 ASP 105 1083 1083 ASP ASP A . n A 1 106 THR 106 1084 1084 THR THR A . n A 1 107 ALA 107 1085 1085 ALA ALA A . n A 1 108 TYR 108 1086 1086 TYR TYR A . n A 1 109 ALA 109 1087 1087 ALA ALA A . n A 1 110 ILE 110 1088 1088 ILE ILE A . n A 1 111 ILE 111 1089 1089 ILE ILE A . n A 1 112 LYS 112 1090 1090 LYS LYS A . n A 1 113 GLU 113 1091 1091 GLU GLU A . n A 1 114 GLU 114 1092 1092 GLU GLU A . n A 1 115 LEU 115 1093 1093 LEU LEU A . n A 1 116 ASP 116 1094 1094 ASP ASP A . n A 1 117 GLU 117 1095 1095 GLU GLU A . n A 1 118 ASP 118 1096 1096 ASP ASP A . n A 1 119 PHE 119 1097 1097 PHE PHE A . n A 1 120 GLU 120 1098 1098 GLU GLU A . n A 1 121 GLN 121 1099 1099 GLN GLN A . n A 1 122 LEU 122 1100 1100 LEU LEU A . n A 1 123 CYS 123 1101 1101 CYS CYS A . n A 1 124 GLU 124 1102 1102 GLU GLU A . n A 1 125 GLU 125 1103 1103 GLU GLU A . n A 1 126 ILE 126 1104 1104 ILE ILE A . n A 1 127 GLN 127 1105 1105 GLN GLN A . n A 1 128 GLU 128 1106 1106 GLU GLU A . n A 1 129 SER 129 1107 1107 SER SER A . n A 1 130 ARG 130 1108 1108 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BQ8 1 1201 1 BQ8 DRG A . C 2 BQ8 1 1202 2 BQ8 DRG A . D 3 SO4 1 1203 1 SO4 SO4 A . E 4 HOH 1 1301 23 HOH HOH A . E 4 HOH 2 1302 18 HOH HOH A . E 4 HOH 3 1303 7 HOH HOH A . E 4 HOH 4 1304 26 HOH HOH A . E 4 HOH 5 1305 5 HOH HOH A . E 4 HOH 6 1306 11 HOH HOH A . E 4 HOH 7 1307 32 HOH HOH A . E 4 HOH 8 1308 4 HOH HOH A . E 4 HOH 9 1309 36 HOH HOH A . E 4 HOH 10 1310 17 HOH HOH A . E 4 HOH 11 1311 35 HOH HOH A . E 4 HOH 12 1312 2 HOH HOH A . E 4 HOH 13 1313 30 HOH HOH A . E 4 HOH 14 1314 6 HOH HOH A . E 4 HOH 15 1315 12 HOH HOH A . E 4 HOH 16 1316 27 HOH HOH A . E 4 HOH 17 1317 8 HOH HOH A . E 4 HOH 18 1318 3 HOH HOH A . E 4 HOH 19 1319 34 HOH HOH A . E 4 HOH 20 1320 14 HOH HOH A . E 4 HOH 21 1321 1 HOH HOH A . E 4 HOH 22 1322 9 HOH HOH A . E 4 HOH 23 1323 28 HOH HOH A . E 4 HOH 24 1324 10 HOH HOH A . E 4 HOH 25 1325 38 HOH HOH A . E 4 HOH 26 1326 37 HOH HOH A . E 4 HOH 27 1327 29 HOH HOH A . E 4 HOH 28 1328 21 HOH HOH A . E 4 HOH 29 1329 43 HOH HOH A . E 4 HOH 30 1330 16 HOH HOH A . E 4 HOH 31 1331 19 HOH HOH A . E 4 HOH 32 1332 22 HOH HOH A . E 4 HOH 33 1333 25 HOH HOH A . E 4 HOH 34 1334 13 HOH HOH A . E 4 HOH 35 1335 20 HOH HOH A . E 4 HOH 36 1336 45 HOH HOH A . E 4 HOH 37 1337 44 HOH HOH A . E 4 HOH 38 1338 15 HOH HOH A . E 4 HOH 39 1339 46 HOH HOH A . E 4 HOH 40 1340 24 HOH HOH A . E 4 HOH 41 1341 41 HOH HOH A . E 4 HOH 42 1342 31 HOH HOH A . E 4 HOH 43 1343 39 HOH HOH A . E 4 HOH 44 1344 40 HOH HOH A . E 4 HOH 45 1345 33 HOH HOH A . E 4 HOH 46 1346 42 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 190 ? 1 MORE -14 ? 1 'SSA (A^2)' 7950 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A BQ8 1202 ? C BQ8 . 2 1 A HOH 1344 ? E HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-31 2 'Structure model' 1 1 2019-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation.title' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CAA _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 BQ8 _pdbx_validate_symm_contact.auth_seq_id_1 1202 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CAQ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 BQ8 _pdbx_validate_symm_contact.auth_seq_id_2 1202 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 10_447 _pdbx_validate_symm_contact.dist 1.55 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 980 ? CG ? A MET 2 CG 2 1 Y 1 A MET 980 ? SD ? A MET 2 SD 3 1 Y 1 A MET 980 ? CE ? A MET 2 CE 4 1 Y 1 A LYS 1004 ? CG ? A LYS 26 CG 5 1 Y 1 A LYS 1004 ? CD ? A LYS 26 CD 6 1 Y 1 A LYS 1004 ? CE ? A LYS 26 CE 7 1 Y 1 A LYS 1004 ? NZ ? A LYS 26 NZ 8 1 Y 1 A ARG 1007 ? NE ? A ARG 29 NE 9 1 Y 1 A ARG 1007 ? CZ ? A ARG 29 CZ 10 1 Y 1 A ARG 1007 ? NH1 ? A ARG 29 NH1 11 1 Y 1 A ARG 1007 ? NH2 ? A ARG 29 NH2 12 1 Y 1 A LYS 1047 ? CG ? A LYS 69 CG 13 1 Y 1 A LYS 1047 ? CD ? A LYS 69 CD 14 1 Y 1 A LYS 1047 ? CE ? A LYS 69 CE 15 1 Y 1 A LYS 1047 ? NZ ? A LYS 69 NZ 16 1 N 1 A BQ8 1202 ? N ? C BQ8 1 N 17 1 N 1 A BQ8 1202 ? CAP ? C BQ8 1 CAP 18 1 N 1 A BQ8 1202 ? NAC ? C BQ8 1 NAC 19 1 N 1 A BQ8 1202 ? NAD ? C BQ8 1 NAD # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2~{R})-~{N}-[5-[3,5-bis(oxidanyl)phenyl]-4-ethanoyl-1,3-thiazol-2-yl]-2-carbamimidamido-propanamide' BQ8 3 'SULFATE ION' SO4 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #