data_6EXJ # _entry.id 6EXJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6EXJ pdb_00006exj 10.2210/pdb6exj/pdb WWPDB D_1200007409 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-03-07 2 'Structure model' 1 1 2018-07-11 3 'Structure model' 1 2 2024-01-17 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6EXJ _pdbx_database_status.recvd_initial_deposition_date 2017-11-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5OVA unspecified PDB . 5OVC unspecified PDB . 5OVP unspecified PDB . 5OVV unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ponna, S.K.' 1 ? 'Keller, C.' 2 ? 'Ruskamo, S.' 3 ? 'Myllykoski, M.' 4 ? 'Boeckers, T.M.' 5 ? 'Kursula, P.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Neurochem.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1471-4159 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 145 _citation.language ? _citation.page_first 449 _citation.page_last 463 _citation.title 'Structural basis for PDZ domain interactions in the post-synaptic density scaffolding protein Shank3.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/jnc.14322 _citation.pdbx_database_id_PubMed 29473168 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ponna, S.K.' 1 ? primary 'Ruskamo, S.' 2 ? primary 'Myllykoski, M.' 3 ? primary 'Keller, C.' 4 ? primary 'Boeckers, T.M.' 5 ? primary 'Kursula, P.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SH3 and multiple ankyrin repeat domains protein 3' 10400.004 2 ? ? ? ? 2 polymer syn SSTR2 701.767 2 ? ? ? ? 3 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Shank3,Proline-rich synapse-associated protein 2,ProSAP2,SPANK-2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWKAGLRTGDFLIEVNGVNVVKVGHKQVVGL IRQGGNRLVMKVVSVT ; ;SVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWKAGLRTGDFLIEVNGVNVVKVGHKQVVGL IRQGGNRLVMKVVSVT ; A,C ? 2 'polypeptide(L)' no yes '(ACE)DLQTSI' XDLQTSI B,D ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 VAL n 1 3 ALA n 1 4 ILE n 1 5 LEU n 1 6 GLN n 1 7 LYS n 1 8 ARG n 1 9 ASP n 1 10 HIS n 1 11 GLU n 1 12 GLY n 1 13 PHE n 1 14 GLY n 1 15 PHE n 1 16 VAL n 1 17 LEU n 1 18 ARG n 1 19 GLY n 1 20 ALA n 1 21 LYS n 1 22 ALA n 1 23 GLU n 1 24 THR n 1 25 PRO n 1 26 ILE n 1 27 GLU n 1 28 GLU n 1 29 PHE n 1 30 THR n 1 31 PRO n 1 32 THR n 1 33 PRO n 1 34 ALA n 1 35 PHE n 1 36 PRO n 1 37 ALA n 1 38 LEU n 1 39 GLN n 1 40 TYR n 1 41 LEU n 1 42 GLU n 1 43 SER n 1 44 VAL n 1 45 ASP n 1 46 VAL n 1 47 GLU n 1 48 GLY n 1 49 VAL n 1 50 ALA n 1 51 TRP n 1 52 LYS n 1 53 ALA n 1 54 GLY n 1 55 LEU n 1 56 ARG n 1 57 THR n 1 58 GLY n 1 59 ASP n 1 60 PHE n 1 61 LEU n 1 62 ILE n 1 63 GLU n 1 64 VAL n 1 65 ASN n 1 66 GLY n 1 67 VAL n 1 68 ASN n 1 69 VAL n 1 70 VAL n 1 71 LYS n 1 72 VAL n 1 73 GLY n 1 74 HIS n 1 75 LYS n 1 76 GLN n 1 77 VAL n 1 78 VAL n 1 79 GLY n 1 80 LEU n 1 81 ILE n 1 82 ARG n 1 83 GLN n 1 84 GLY n 1 85 GLY n 1 86 ASN n 1 87 ARG n 1 88 LEU n 1 89 VAL n 1 90 MET n 1 91 LYS n 1 92 VAL n 1 93 VAL n 1 94 SER n 1 95 VAL n 1 96 THR n 2 1 ACE n 2 2 ASP n 2 3 LEU n 2 4 GLN n 2 5 THR n 2 6 SER n 2 7 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 96 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Shank3, Prosap2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 7 _pdbx_entity_src_syn.organism_scientific 'Rattus norvegicus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 10116 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 644 644 SER SER A . n A 1 2 VAL 2 645 645 VAL VAL A . n A 1 3 ALA 3 646 646 ALA ALA A . n A 1 4 ILE 4 647 647 ILE ILE A . n A 1 5 LEU 5 648 648 LEU LEU A . n A 1 6 GLN 6 649 649 GLN GLN A . n A 1 7 LYS 7 650 650 LYS LYS A . n A 1 8 ARG 8 651 651 ARG ARG A . n A 1 9 ASP 9 652 652 ASP ASP A . n A 1 10 HIS 10 653 653 HIS HIS A . n A 1 11 GLU 11 654 654 GLU GLU A . n A 1 12 GLY 12 655 655 GLY GLY A . n A 1 13 PHE 13 656 656 PHE PHE A . n A 1 14 GLY 14 657 657 GLY GLY A . n A 1 15 PHE 15 658 658 PHE PHE A . n A 1 16 VAL 16 659 659 VAL VAL A . n A 1 17 LEU 17 660 660 LEU LEU A . n A 1 18 ARG 18 661 661 ARG ARG A . n A 1 19 GLY 19 662 662 GLY GLY A . n A 1 20 ALA 20 663 663 ALA ALA A . n A 1 21 LYS 21 664 664 LYS LYS A . n A 1 22 ALA 22 665 665 ALA ALA A . n A 1 23 GLU 23 666 666 GLU GLU A . n A 1 24 THR 24 667 ? ? ? A . n A 1 25 PRO 25 668 ? ? ? A . n A 1 26 ILE 26 669 ? ? ? A . n A 1 27 GLU 27 670 ? ? ? A . n A 1 28 GLU 28 671 ? ? ? A . n A 1 29 PHE 29 672 ? ? ? A . n A 1 30 THR 30 673 ? ? ? A . n A 1 31 PRO 31 674 674 PRO PRO A . n A 1 32 THR 32 675 675 THR THR A . n A 1 33 PRO 33 676 676 PRO PRO A . n A 1 34 ALA 34 677 677 ALA ALA A . n A 1 35 PHE 35 678 678 PHE PHE A . n A 1 36 PRO 36 679 679 PRO PRO A . n A 1 37 ALA 37 680 680 ALA ALA A . n A 1 38 LEU 38 681 681 LEU LEU A . n A 1 39 GLN 39 682 682 GLN GLN A . n A 1 40 TYR 40 683 683 TYR TYR A . n A 1 41 LEU 41 684 684 LEU LEU A . n A 1 42 GLU 42 685 685 GLU GLU A . n A 1 43 SER 43 686 686 SER SER A . n A 1 44 VAL 44 687 687 VAL VAL A . n A 1 45 ASP 45 688 688 ASP ASP A . n A 1 46 VAL 46 689 689 VAL VAL A . n A 1 47 GLU 47 690 690 GLU GLU A . n A 1 48 GLY 48 691 691 GLY GLY A . n A 1 49 VAL 49 692 692 VAL VAL A . n A 1 50 ALA 50 693 693 ALA ALA A . n A 1 51 TRP 51 694 694 TRP TRP A . n A 1 52 LYS 52 695 695 LYS LYS A . n A 1 53 ALA 53 696 696 ALA ALA A . n A 1 54 GLY 54 697 697 GLY GLY A . n A 1 55 LEU 55 698 698 LEU LEU A . n A 1 56 ARG 56 699 699 ARG ARG A . n A 1 57 THR 57 700 700 THR THR A . n A 1 58 GLY 58 701 701 GLY GLY A . n A 1 59 ASP 59 702 702 ASP ASP A . n A 1 60 PHE 60 703 703 PHE PHE A . n A 1 61 LEU 61 704 704 LEU LEU A . n A 1 62 ILE 62 705 705 ILE ILE A . n A 1 63 GLU 63 706 706 GLU GLU A . n A 1 64 VAL 64 707 707 VAL VAL A . n A 1 65 ASN 65 708 708 ASN ASN A . n A 1 66 GLY 66 709 709 GLY GLY A . n A 1 67 VAL 67 710 710 VAL VAL A . n A 1 68 ASN 68 711 711 ASN ASN A . n A 1 69 VAL 69 712 712 VAL VAL A . n A 1 70 VAL 70 713 713 VAL VAL A . n A 1 71 LYS 71 714 714 LYS LYS A . n A 1 72 VAL 72 715 715 VAL VAL A . n A 1 73 GLY 73 716 716 GLY GLY A . n A 1 74 HIS 74 717 717 HIS HIS A . n A 1 75 LYS 75 718 718 LYS LYS A . n A 1 76 GLN 76 719 719 GLN GLN A . n A 1 77 VAL 77 720 720 VAL VAL A . n A 1 78 VAL 78 721 721 VAL VAL A . n A 1 79 GLY 79 722 722 GLY GLY A . n A 1 80 LEU 80 723 723 LEU LEU A . n A 1 81 ILE 81 724 724 ILE ILE A . n A 1 82 ARG 82 725 725 ARG ARG A . n A 1 83 GLN 83 726 726 GLN GLN A . n A 1 84 GLY 84 727 727 GLY GLY A . n A 1 85 GLY 85 728 728 GLY GLY A . n A 1 86 ASN 86 729 729 ASN ASN A . n A 1 87 ARG 87 730 730 ARG ARG A . n A 1 88 LEU 88 731 731 LEU LEU A . n A 1 89 VAL 89 732 732 VAL VAL A . n A 1 90 MET 90 733 733 MET MET A . n A 1 91 LYS 91 734 734 LYS LYS A . n A 1 92 VAL 92 735 735 VAL VAL A . n A 1 93 VAL 93 736 736 VAL VAL A . n A 1 94 SER 94 737 737 SER SER A . n A 1 95 VAL 95 738 738 VAL VAL A . n A 1 96 THR 96 739 739 THR THR A . n B 2 1 ACE 1 363 363 ACE ACE B . n B 2 2 ASP 2 364 364 ASP ASP B . n B 2 3 LEU 3 365 365 LEU LEU B . n B 2 4 GLN 4 366 366 GLN GLN B . n B 2 5 THR 5 367 367 THR THR B . n B 2 6 SER 6 368 368 SER SER B . n B 2 7 ILE 7 369 369 ILE ILE B . n C 1 1 SER 1 644 644 SER SER C . n C 1 2 VAL 2 645 645 VAL VAL C . n C 1 3 ALA 3 646 646 ALA ALA C . n C 1 4 ILE 4 647 647 ILE ILE C . n C 1 5 LEU 5 648 648 LEU LEU C . n C 1 6 GLN 6 649 649 GLN GLN C . n C 1 7 LYS 7 650 650 LYS LYS C . n C 1 8 ARG 8 651 651 ARG ARG C . n C 1 9 ASP 9 652 652 ASP ASP C . n C 1 10 HIS 10 653 653 HIS HIS C . n C 1 11 GLU 11 654 654 GLU GLU C . n C 1 12 GLY 12 655 655 GLY GLY C . n C 1 13 PHE 13 656 656 PHE PHE C . n C 1 14 GLY 14 657 657 GLY GLY C . n C 1 15 PHE 15 658 658 PHE PHE C . n C 1 16 VAL 16 659 659 VAL VAL C . n C 1 17 LEU 17 660 660 LEU LEU C . n C 1 18 ARG 18 661 661 ARG ARG C . n C 1 19 GLY 19 662 662 GLY GLY C . n C 1 20 ALA 20 663 663 ALA ALA C . n C 1 21 LYS 21 664 664 LYS LYS C . n C 1 22 ALA 22 665 665 ALA ALA C . n C 1 23 GLU 23 666 666 GLU GLU C . n C 1 24 THR 24 667 667 THR THR C . n C 1 25 PRO 25 668 ? ? ? C . n C 1 26 ILE 26 669 ? ? ? C . n C 1 27 GLU 27 670 ? ? ? C . n C 1 28 GLU 28 671 ? ? ? C . n C 1 29 PHE 29 672 ? ? ? C . n C 1 30 THR 30 673 ? ? ? C . n C 1 31 PRO 31 674 ? ? ? C . n C 1 32 THR 32 675 675 THR THR C . n C 1 33 PRO 33 676 676 PRO PRO C . n C 1 34 ALA 34 677 677 ALA ALA C . n C 1 35 PHE 35 678 678 PHE PHE C . n C 1 36 PRO 36 679 679 PRO PRO C . n C 1 37 ALA 37 680 680 ALA ALA C . n C 1 38 LEU 38 681 681 LEU LEU C . n C 1 39 GLN 39 682 682 GLN GLN C . n C 1 40 TYR 40 683 683 TYR TYR C . n C 1 41 LEU 41 684 684 LEU LEU C . n C 1 42 GLU 42 685 685 GLU GLU C . n C 1 43 SER 43 686 686 SER SER C . n C 1 44 VAL 44 687 687 VAL VAL C . n C 1 45 ASP 45 688 688 ASP ASP C . n C 1 46 VAL 46 689 689 VAL VAL C . n C 1 47 GLU 47 690 690 GLU GLU C . n C 1 48 GLY 48 691 691 GLY GLY C . n C 1 49 VAL 49 692 692 VAL VAL C . n C 1 50 ALA 50 693 693 ALA ALA C . n C 1 51 TRP 51 694 694 TRP TRP C . n C 1 52 LYS 52 695 695 LYS LYS C . n C 1 53 ALA 53 696 696 ALA ALA C . n C 1 54 GLY 54 697 697 GLY GLY C . n C 1 55 LEU 55 698 698 LEU LEU C . n C 1 56 ARG 56 699 699 ARG ARG C . n C 1 57 THR 57 700 700 THR THR C . n C 1 58 GLY 58 701 701 GLY GLY C . n C 1 59 ASP 59 702 702 ASP ASP C . n C 1 60 PHE 60 703 703 PHE PHE C . n C 1 61 LEU 61 704 704 LEU LEU C . n C 1 62 ILE 62 705 705 ILE ILE C . n C 1 63 GLU 63 706 706 GLU GLU C . n C 1 64 VAL 64 707 707 VAL VAL C . n C 1 65 ASN 65 708 708 ASN ASN C . n C 1 66 GLY 66 709 709 GLY GLY C . n C 1 67 VAL 67 710 710 VAL VAL C . n C 1 68 ASN 68 711 711 ASN ASN C . n C 1 69 VAL 69 712 712 VAL VAL C . n C 1 70 VAL 70 713 713 VAL VAL C . n C 1 71 LYS 71 714 714 LYS LYS C . n C 1 72 VAL 72 715 715 VAL VAL C . n C 1 73 GLY 73 716 716 GLY GLY C . n C 1 74 HIS 74 717 717 HIS HIS C . n C 1 75 LYS 75 718 718 LYS LYS C . n C 1 76 GLN 76 719 719 GLN GLN C . n C 1 77 VAL 77 720 720 VAL VAL C . n C 1 78 VAL 78 721 721 VAL VAL C . n C 1 79 GLY 79 722 722 GLY GLY C . n C 1 80 LEU 80 723 723 LEU LEU C . n C 1 81 ILE 81 724 724 ILE ILE C . n C 1 82 ARG 82 725 725 ARG ARG C . n C 1 83 GLN 83 726 726 GLN GLN C . n C 1 84 GLY 84 727 727 GLY GLY C . n C 1 85 GLY 85 728 728 GLY GLY C . n C 1 86 ASN 86 729 729 ASN ASN C . n C 1 87 ARG 87 730 730 ARG ARG C . n C 1 88 LEU 88 731 731 LEU LEU C . n C 1 89 VAL 89 732 732 VAL VAL C . n C 1 90 MET 90 733 733 MET MET C . n C 1 91 LYS 91 734 734 LYS LYS C . n C 1 92 VAL 92 735 735 VAL VAL C . n C 1 93 VAL 93 736 736 VAL VAL C . n C 1 94 SER 94 737 737 SER SER C . n C 1 95 VAL 95 738 738 VAL VAL C . n C 1 96 THR 96 739 739 THR THR C . n D 2 1 ACE 1 363 363 ACE ACE D . n D 2 2 ASP 2 364 364 ASP ASP D . n D 2 3 LEU 3 365 365 LEU LEU D . n D 2 4 GLN 4 366 366 GLN GLN D . n D 2 5 THR 5 367 367 THR THR D . n D 2 6 SER 6 368 368 SER SER D . n D 2 7 ILE 7 369 369 ILE ILE D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 801 5 HOH HOH A . E 3 HOH 2 802 2 HOH HOH A . E 3 HOH 3 803 6 HOH HOH A . E 3 HOH 4 804 18 HOH HOH A . E 3 HOH 5 805 26 HOH HOH A . E 3 HOH 6 806 33 HOH HOH A . E 3 HOH 7 807 25 HOH HOH A . E 3 HOH 8 808 17 HOH HOH A . E 3 HOH 9 809 22 HOH HOH A . E 3 HOH 10 810 7 HOH HOH A . E 3 HOH 11 811 37 HOH HOH A . E 3 HOH 12 812 30 HOH HOH A . F 3 HOH 1 401 9 HOH HOH B . F 3 HOH 2 402 14 HOH HOH B . F 3 HOH 3 403 31 HOH HOH B . F 3 HOH 4 404 12 HOH HOH B . F 3 HOH 5 405 38 HOH HOH B . G 3 HOH 1 801 20 HOH HOH C . G 3 HOH 2 802 4 HOH HOH C . G 3 HOH 3 803 8 HOH HOH C . G 3 HOH 4 804 15 HOH HOH C . G 3 HOH 5 805 1 HOH HOH C . G 3 HOH 6 806 13 HOH HOH C . G 3 HOH 7 807 3 HOH HOH C . G 3 HOH 8 808 36 HOH HOH C . G 3 HOH 9 809 35 HOH HOH C . G 3 HOH 10 810 16 HOH HOH C . G 3 HOH 11 811 24 HOH HOH C . H 3 HOH 1 401 27 HOH HOH D . H 3 HOH 2 402 19 HOH HOH D . H 3 HOH 3 403 10 HOH HOH D . H 3 HOH 4 404 34 HOH HOH D . H 3 HOH 5 405 11 HOH HOH D . H 3 HOH 6 406 39 HOH HOH D . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6EXJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.850 _cell.length_a_esd ? _cell.length_b 43.300 _cell.length_b_esd ? _cell.length_c 78.760 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6EXJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6EXJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2 M ammonium sulphate, 0.2 M NaCl, 0.1 M MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-10-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 42.7 _reflns.entry_id 6EXJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14124 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.071 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1020 _reflns_shell.percent_possible_all 99.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.515 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.540 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6EXJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.800 _refine.ls_d_res_low 37.944 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14079 _refine.ls_number_reflns_R_free 1416 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.59 _refine.ls_percent_reflns_R_free 10.06 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2296 _refine.ls_R_factor_R_free 0.2739 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2249 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5OVC _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.01 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1452 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 1486 _refine_hist.d_res_high 1.800 _refine_hist.d_res_low 37.944 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 ? 1469 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.601 ? 1981 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 21.790 ? 870 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.078 ? 235 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 ? 254 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8002 1.8646 . . 138 1229 99.00 . . . 0.3917 . 0.4030 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8646 1.9392 . . 137 1241 99.00 . . . 0.4527 . 0.3437 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9392 2.0275 . . 141 1234 99.00 . . . 0.3164 . 0.3108 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0275 2.1343 . . 141 1253 100.00 . . . 0.3970 . 0.3024 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1343 2.2680 . . 140 1254 100.00 . . . 0.3758 . 0.2761 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2680 2.4431 . . 140 1246 100.00 . . . 0.2796 . 0.2522 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4431 2.6889 . . 145 1270 100.00 . . . 0.3066 . 0.2625 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6889 3.0779 . . 141 1275 100.00 . . . 0.2294 . 0.2406 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0779 3.8772 . . 146 1291 100.00 . . . 0.2711 . 0.1901 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8772 37.9522 . . 147 1370 100.00 . . . 0.2324 . 0.1889 . . . . . . . . . . # _struct.entry_id 6EXJ _struct.title 'PDZ domain from rat Shank3 bound to the C terminus of somatostatin receptor subtype 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6EXJ _struct_keywords.text 'PDZ domain, peptide binding, post-synaptic density, C terminus, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SHAN3_RAT Q9JLU4 ? 1 ;VAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWKAGLRTGDFLIEVNGVNVVKVGHKQVVGLI RQGGNRLVMKVVSVT ; 570 2 PDB 6EXJ 6EXJ ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6EXJ A 2 ? 96 ? Q9JLU4 570 ? 664 ? 645 739 2 2 6EXJ B 1 ? 7 ? 6EXJ 363 ? 369 ? 363 369 3 1 6EXJ C 2 ? 96 ? Q9JLU4 570 ? 664 ? 645 739 4 2 6EXJ D 1 ? 7 ? 6EXJ 363 ? 369 ? 363 369 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6EXJ SER A 1 ? UNP Q9JLU4 ? ? 'expression tag' 644 1 3 6EXJ SER C 1 ? UNP Q9JLU4 ? ? 'expression tag' 644 2 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1220 ? 1 MORE -5 ? 1 'SSA (A^2)' 5670 ? 2 'ABSA (A^2)' 1210 ? 2 MORE -5 ? 2 'SSA (A^2)' 5570 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F 2 1 C,D,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 48 ? ALA A 53 ? GLY A 691 ALA A 696 1 ? 6 HELX_P HELX_P2 AA2 GLY A 73 ? GLY A 84 ? GLY A 716 GLY A 727 1 ? 12 HELX_P HELX_P3 AA3 GLY C 48 ? ALA C 53 ? GLY C 691 ALA C 696 1 ? 6 HELX_P HELX_P4 AA4 GLY C 73 ? GLY C 84 ? GLY C 716 GLY C 727 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C ? ? ? 1_555 B ASP 2 N ? ? B ACE 363 B ASP 364 1_555 ? ? ? ? ? ? ? 1.306 ? ? covale2 covale both ? D ACE 1 C ? ? ? 1_555 D ASP 2 N ? ? D ACE 363 D ASP 364 1_555 ? ? ? ? ? ? ? 1.304 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 ACE B 1 ? ASP B 2 ? ACE B 363 ? 1_555 ASP B 364 ? 1_555 . . ASP 9 ACE None 'Terminal acetylation' 2 ACE D 1 ? ASP D 2 ? ACE D 363 ? 1_555 ASP D 364 ? 1_555 . . ASP 9 ACE None 'Terminal acetylation' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 2 ? GLN A 6 ? VAL A 645 GLN A 649 AA1 2 ARG A 87 ? SER A 94 ? ARG A 730 SER A 737 AA1 3 ASP A 59 ? VAL A 64 ? ASP A 702 VAL A 707 AA1 4 VAL A 67 ? ASN A 68 ? VAL A 710 ASN A 711 AA2 1 GLN A 39 ? VAL A 44 ? GLN A 682 VAL A 687 AA2 2 PHE A 15 ? GLY A 19 ? PHE A 658 GLY A 662 AA2 3 LEU B 3 ? SER B 6 ? LEU B 365 SER B 368 AA3 1 VAL C 2 ? GLN C 6 ? VAL C 645 GLN C 649 AA3 2 ARG C 87 ? SER C 94 ? ARG C 730 SER C 737 AA3 3 ASP C 59 ? VAL C 64 ? ASP C 702 VAL C 707 AA3 4 VAL C 67 ? ASN C 68 ? VAL C 710 ASN C 711 AA4 1 GLN C 39 ? VAL C 44 ? GLN C 682 VAL C 687 AA4 2 PHE C 15 ? GLY C 19 ? PHE C 658 GLY C 662 AA4 3 LEU D 3 ? SER D 6 ? LEU D 365 SER D 368 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 5 ? N LEU A 648 O LEU A 88 ? O LEU A 731 AA1 2 3 O VAL A 93 ? O VAL A 736 N PHE A 60 ? N PHE A 703 AA1 3 4 N VAL A 64 ? N VAL A 707 O VAL A 67 ? O VAL A 710 AA2 1 2 O TYR A 40 ? O TYR A 683 N ARG A 18 ? N ARG A 661 AA2 2 3 N LEU A 17 ? N LEU A 660 O THR B 5 ? O THR B 367 AA3 1 2 N LEU C 5 ? N LEU C 648 O LEU C 88 ? O LEU C 731 AA3 2 3 O VAL C 93 ? O VAL C 736 N PHE C 60 ? N PHE C 703 AA3 3 4 N VAL C 64 ? N VAL C 707 O VAL C 67 ? O VAL C 710 AA4 1 2 O TYR C 40 ? O TYR C 683 N ARG C 18 ? N ARG C 661 AA4 2 3 N LEU C 17 ? N LEU C 660 O THR D 5 ? O THR D 367 # _pdbx_entry_details.entry_id 6EXJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 C _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 652 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 C _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 801 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.94 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 C _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 706 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG _pdbx_validate_rmsd_bond.auth_asym_id_2 C _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 706 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.393 _pdbx_validate_rmsd_bond.bond_target_value 1.517 _pdbx_validate_rmsd_bond.bond_deviation -0.124 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 1.5738 96.1704 20.7037 0.3953 0.5444 0.4465 -0.0738 0.0473 -0.1699 3.5797 3.8866 3.0125 1.6986 -0.1512 -1.9514 0.2259 -0.6168 1.1354 0.6466 -0.0373 0.6092 -0.1253 -0.0717 -0.1590 'X-RAY DIFFRACTION' 2 ? refined 23.2326 95.6362 15.4303 0.4503 0.8163 0.4153 0.1829 -0.0026 0.0196 2.7415 5.4174 6.9658 3.7014 1.6669 2.0121 0.8936 1.0947 -0.6314 -0.6397 -1.0117 -0.3606 -0.0427 0.7468 -0.1950 'X-RAY DIFFRACTION' 3 ? refined 4.5705 101.5523 14.6974 0.5378 0.4085 0.5900 -0.0078 0.0057 -0.0576 8.5497 3.8782 5.0363 2.0680 -1.4841 2.0599 0.5355 -0.1335 1.1215 -0.4379 -0.5723 0.6906 -0.9524 -0.4154 -0.0503 'X-RAY DIFFRACTION' 4 ? refined 15.6881 97.3038 24.0298 0.5249 0.5580 0.3849 -0.1542 -0.0381 -0.0085 3.7165 5.9060 8.0544 -2.3979 -0.2706 1.5304 0.1789 -0.8865 0.5488 0.9941 -0.2647 0.0535 0.2158 0.6565 -0.0356 'X-RAY DIFFRACTION' 5 ? refined 10.6474 88.2368 22.7627 0.6953 0.4888 0.4492 -0.1343 -0.0054 0.0719 2.2032 6.3797 9.1620 -2.2481 -3.7419 -1.1897 -0.1849 -0.7126 -1.4819 1.3001 -0.2761 0.5461 1.6556 -0.8334 0.5841 'X-RAY DIFFRACTION' 6 ? refined 8.2055 100.4877 23.0827 0.5159 0.7552 0.4419 -0.1598 0.0017 -0.1059 8.0600 7.7791 0.5670 3.5104 0.5825 0.7082 0.5492 -0.1896 0.3001 0.4190 -0.1653 0.4764 0.3700 -0.3502 -0.2035 'X-RAY DIFFRACTION' 7 ? refined 9.7355 89.9895 12.8685 0.5584 0.5305 0.3027 0.0064 -0.0193 -0.0425 6.6469 9.5614 8.3389 -0.6825 0.6326 -0.1290 -0.6616 -0.6587 -0.2171 0.1802 0.0903 -0.1009 1.3295 -0.3742 0.5054 'X-RAY DIFFRACTION' 8 ? refined 0.9838 95.8317 -0.8466 0.6827 0.3553 0.5081 -0.1089 -0.2682 0.0349 5.4089 4.0197 2.5024 2.9214 -2.2129 1.4111 -0.4622 0.5117 1.0608 -1.6216 0.3908 1.2817 -0.1852 -0.0835 -0.0273 'X-RAY DIFFRACTION' 9 ? refined -0.5760 85.4519 4.9274 0.2571 0.3573 0.2815 -0.0334 -0.0010 0.0512 7.5882 5.5922 7.8297 2.0223 1.6430 1.0526 -0.1854 0.0328 0.5870 0.2311 0.1640 0.2019 0.3511 0.0896 0.1950 'X-RAY DIFFRACTION' 10 ? refined -2.0164 84.1304 -2.0568 0.4476 0.4086 0.3799 -0.1103 -0.0370 0.0327 8.7135 4.4263 8.9083 -0.4229 -0.9192 0.0627 -0.2738 0.7995 0.2848 -0.6989 0.2808 0.5882 0.2669 -0.3890 0.0368 'X-RAY DIFFRACTION' 11 ? refined 8.2264 88.7564 -3.8611 0.7324 0.7310 0.4079 -0.2859 0.0619 -0.0078 5.1949 5.6456 3.6899 1.4839 -1.2038 3.8298 -0.5184 0.9637 0.4101 -2.2037 0.6273 -0.3170 -1.0676 2.0467 0.1949 'X-RAY DIFFRACTION' 12 ? refined -5.2034 87.3867 -2.5317 0.7775 0.4485 0.2773 -0.2547 -0.2299 0.1017 8.2061 9.1927 2.1203 1.6029 -0.8413 -1.7243 -0.5295 0.4068 -0.2019 -0.4749 -1.0014 0.9241 -2.0981 0.7626 0.0892 'X-RAY DIFFRACTION' 13 ? refined 7.3501 87.6426 6.7874 0.5430 0.4677 0.3657 0.0516 -0.0537 -0.0142 8.4129 8.2924 5.6764 -3.0952 0.4441 0.6137 0.1336 0.5052 -0.3608 0.0308 -0.6713 0.7861 0.0529 1.0151 0.3553 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 644 through 662 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 663 through 681 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 682 through 701 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 702 through 716 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 717 through 726 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 727 through 739 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 364 through 369 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 644 through 662 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 663 through 695 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 696 through 716 ) ; 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 717 through 729 ) ; 'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 730 through 739 ) ; 'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 364 through 369 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 667 ? A THR 24 2 1 Y 1 A PRO 668 ? A PRO 25 3 1 Y 1 A ILE 669 ? A ILE 26 4 1 Y 1 A GLU 670 ? A GLU 27 5 1 Y 1 A GLU 671 ? A GLU 28 6 1 Y 1 A PHE 672 ? A PHE 29 7 1 Y 1 A THR 673 ? A THR 30 8 1 Y 1 C PRO 668 ? C PRO 25 9 1 Y 1 C ILE 669 ? C ILE 26 10 1 Y 1 C GLU 670 ? C GLU 27 11 1 Y 1 C GLU 671 ? C GLU 28 12 1 Y 1 C PHE 672 ? C PHE 29 13 1 Y 1 C THR 673 ? C THR 30 14 1 Y 1 C PRO 674 ? C PRO 31 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 GLN N N N N 81 GLN CA C N S 82 GLN C C N N 83 GLN O O N N 84 GLN CB C N N 85 GLN CG C N N 86 GLN CD C N N 87 GLN OE1 O N N 88 GLN NE2 N N N 89 GLN OXT O N N 90 GLN H H N N 91 GLN H2 H N N 92 GLN HA H N N 93 GLN HB2 H N N 94 GLN HB3 H N N 95 GLN HG2 H N N 96 GLN HG3 H N N 97 GLN HE21 H N N 98 GLN HE22 H N N 99 GLN HXT H N N 100 GLU N N N N 101 GLU CA C N S 102 GLU C C N N 103 GLU O O N N 104 GLU CB C N N 105 GLU CG C N N 106 GLU CD C N N 107 GLU OE1 O N N 108 GLU OE2 O N N 109 GLU OXT O N N 110 GLU H H N N 111 GLU H2 H N N 112 GLU HA H N N 113 GLU HB2 H N N 114 GLU HB3 H N N 115 GLU HG2 H N N 116 GLU HG3 H N N 117 GLU HE2 H N N 118 GLU HXT H N N 119 GLY N N N N 120 GLY CA C N N 121 GLY C C N N 122 GLY O O N N 123 GLY OXT O N N 124 GLY H H N N 125 GLY H2 H N N 126 GLY HA2 H N N 127 GLY HA3 H N N 128 GLY HXT H N N 129 HIS N N N N 130 HIS CA C N S 131 HIS C C N N 132 HIS O O N N 133 HIS CB C N N 134 HIS CG C Y N 135 HIS ND1 N Y N 136 HIS CD2 C Y N 137 HIS CE1 C Y N 138 HIS NE2 N Y N 139 HIS OXT O N N 140 HIS H H N N 141 HIS H2 H N N 142 HIS HA H N N 143 HIS HB2 H N N 144 HIS HB3 H N N 145 HIS HD1 H N N 146 HIS HD2 H N N 147 HIS HE1 H N N 148 HIS HE2 H N N 149 HIS HXT H N N 150 HOH O O N N 151 HOH H1 H N N 152 HOH H2 H N N 153 ILE N N N N 154 ILE CA C N S 155 ILE C C N N 156 ILE O O N N 157 ILE CB C N S 158 ILE CG1 C N N 159 ILE CG2 C N N 160 ILE CD1 C N N 161 ILE OXT O N N 162 ILE H H N N 163 ILE H2 H N N 164 ILE HA H N N 165 ILE HB H N N 166 ILE HG12 H N N 167 ILE HG13 H N N 168 ILE HG21 H N N 169 ILE HG22 H N N 170 ILE HG23 H N N 171 ILE HD11 H N N 172 ILE HD12 H N N 173 ILE HD13 H N N 174 ILE HXT H N N 175 LEU N N N N 176 LEU CA C N S 177 LEU C C N N 178 LEU O O N N 179 LEU CB C N N 180 LEU CG C N N 181 LEU CD1 C N N 182 LEU CD2 C N N 183 LEU OXT O N N 184 LEU H H N N 185 LEU H2 H N N 186 LEU HA H N N 187 LEU HB2 H N N 188 LEU HB3 H N N 189 LEU HG H N N 190 LEU HD11 H N N 191 LEU HD12 H N N 192 LEU HD13 H N N 193 LEU HD21 H N N 194 LEU HD22 H N N 195 LEU HD23 H N N 196 LEU HXT H N N 197 LYS N N N N 198 LYS CA C N S 199 LYS C C N N 200 LYS O O N N 201 LYS CB C N N 202 LYS CG C N N 203 LYS CD C N N 204 LYS CE C N N 205 LYS NZ N N N 206 LYS OXT O N N 207 LYS H H N N 208 LYS H2 H N N 209 LYS HA H N N 210 LYS HB2 H N N 211 LYS HB3 H N N 212 LYS HG2 H N N 213 LYS HG3 H N N 214 LYS HD2 H N N 215 LYS HD3 H N N 216 LYS HE2 H N N 217 LYS HE3 H N N 218 LYS HZ1 H N N 219 LYS HZ2 H N N 220 LYS HZ3 H N N 221 LYS HXT H N N 222 MET N N N N 223 MET CA C N S 224 MET C C N N 225 MET O O N N 226 MET CB C N N 227 MET CG C N N 228 MET SD S N N 229 MET CE C N N 230 MET OXT O N N 231 MET H H N N 232 MET H2 H N N 233 MET HA H N N 234 MET HB2 H N N 235 MET HB3 H N N 236 MET HG2 H N N 237 MET HG3 H N N 238 MET HE1 H N N 239 MET HE2 H N N 240 MET HE3 H N N 241 MET HXT H N N 242 PHE N N N N 243 PHE CA C N S 244 PHE C C N N 245 PHE O O N N 246 PHE CB C N N 247 PHE CG C Y N 248 PHE CD1 C Y N 249 PHE CD2 C Y N 250 PHE CE1 C Y N 251 PHE CE2 C Y N 252 PHE CZ C Y N 253 PHE OXT O N N 254 PHE H H N N 255 PHE H2 H N N 256 PHE HA H N N 257 PHE HB2 H N N 258 PHE HB3 H N N 259 PHE HD1 H N N 260 PHE HD2 H N N 261 PHE HE1 H N N 262 PHE HE2 H N N 263 PHE HZ H N N 264 PHE HXT H N N 265 PRO N N N N 266 PRO CA C N S 267 PRO C C N N 268 PRO O O N N 269 PRO CB C N N 270 PRO CG C N N 271 PRO CD C N N 272 PRO OXT O N N 273 PRO H H N N 274 PRO HA H N N 275 PRO HB2 H N N 276 PRO HB3 H N N 277 PRO HG2 H N N 278 PRO HG3 H N N 279 PRO HD2 H N N 280 PRO HD3 H N N 281 PRO HXT H N N 282 SER N N N N 283 SER CA C N S 284 SER C C N N 285 SER O O N N 286 SER CB C N N 287 SER OG O N N 288 SER OXT O N N 289 SER H H N N 290 SER H2 H N N 291 SER HA H N N 292 SER HB2 H N N 293 SER HB3 H N N 294 SER HG H N N 295 SER HXT H N N 296 THR N N N N 297 THR CA C N S 298 THR C C N N 299 THR O O N N 300 THR CB C N R 301 THR OG1 O N N 302 THR CG2 C N N 303 THR OXT O N N 304 THR H H N N 305 THR H2 H N N 306 THR HA H N N 307 THR HB H N N 308 THR HG1 H N N 309 THR HG21 H N N 310 THR HG22 H N N 311 THR HG23 H N N 312 THR HXT H N N 313 TRP N N N N 314 TRP CA C N S 315 TRP C C N N 316 TRP O O N N 317 TRP CB C N N 318 TRP CG C Y N 319 TRP CD1 C Y N 320 TRP CD2 C Y N 321 TRP NE1 N Y N 322 TRP CE2 C Y N 323 TRP CE3 C Y N 324 TRP CZ2 C Y N 325 TRP CZ3 C Y N 326 TRP CH2 C Y N 327 TRP OXT O N N 328 TRP H H N N 329 TRP H2 H N N 330 TRP HA H N N 331 TRP HB2 H N N 332 TRP HB3 H N N 333 TRP HD1 H N N 334 TRP HE1 H N N 335 TRP HE3 H N N 336 TRP HZ2 H N N 337 TRP HZ3 H N N 338 TRP HH2 H N N 339 TRP HXT H N N 340 TYR N N N N 341 TYR CA C N S 342 TYR C C N N 343 TYR O O N N 344 TYR CB C N N 345 TYR CG C Y N 346 TYR CD1 C Y N 347 TYR CD2 C Y N 348 TYR CE1 C Y N 349 TYR CE2 C Y N 350 TYR CZ C Y N 351 TYR OH O N N 352 TYR OXT O N N 353 TYR H H N N 354 TYR H2 H N N 355 TYR HA H N N 356 TYR HB2 H N N 357 TYR HB3 H N N 358 TYR HD1 H N N 359 TYR HD2 H N N 360 TYR HE1 H N N 361 TYR HE2 H N N 362 TYR HH H N N 363 TYR HXT H N N 364 VAL N N N N 365 VAL CA C N S 366 VAL C C N N 367 VAL O O N N 368 VAL CB C N N 369 VAL CG1 C N N 370 VAL CG2 C N N 371 VAL OXT O N N 372 VAL H H N N 373 VAL H2 H N N 374 VAL HA H N N 375 VAL HB H N N 376 VAL HG11 H N N 377 VAL HG12 H N N 378 VAL HG13 H N N 379 VAL HG21 H N N 380 VAL HG22 H N N 381 VAL HG23 H N N 382 VAL HXT H N N 383 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 HIS N CA sing N N 122 HIS N H sing N N 123 HIS N H2 sing N N 124 HIS CA C sing N N 125 HIS CA CB sing N N 126 HIS CA HA sing N N 127 HIS C O doub N N 128 HIS C OXT sing N N 129 HIS CB CG sing N N 130 HIS CB HB2 sing N N 131 HIS CB HB3 sing N N 132 HIS CG ND1 sing Y N 133 HIS CG CD2 doub Y N 134 HIS ND1 CE1 doub Y N 135 HIS ND1 HD1 sing N N 136 HIS CD2 NE2 sing Y N 137 HIS CD2 HD2 sing N N 138 HIS CE1 NE2 sing Y N 139 HIS CE1 HE1 sing N N 140 HIS NE2 HE2 sing N N 141 HIS OXT HXT sing N N 142 HOH O H1 sing N N 143 HOH O H2 sing N N 144 ILE N CA sing N N 145 ILE N H sing N N 146 ILE N H2 sing N N 147 ILE CA C sing N N 148 ILE CA CB sing N N 149 ILE CA HA sing N N 150 ILE C O doub N N 151 ILE C OXT sing N N 152 ILE CB CG1 sing N N 153 ILE CB CG2 sing N N 154 ILE CB HB sing N N 155 ILE CG1 CD1 sing N N 156 ILE CG1 HG12 sing N N 157 ILE CG1 HG13 sing N N 158 ILE CG2 HG21 sing N N 159 ILE CG2 HG22 sing N N 160 ILE CG2 HG23 sing N N 161 ILE CD1 HD11 sing N N 162 ILE CD1 HD12 sing N N 163 ILE CD1 HD13 sing N N 164 ILE OXT HXT sing N N 165 LEU N CA sing N N 166 LEU N H sing N N 167 LEU N H2 sing N N 168 LEU CA C sing N N 169 LEU CA CB sing N N 170 LEU CA HA sing N N 171 LEU C O doub N N 172 LEU C OXT sing N N 173 LEU CB CG sing N N 174 LEU CB HB2 sing N N 175 LEU CB HB3 sing N N 176 LEU CG CD1 sing N N 177 LEU CG CD2 sing N N 178 LEU CG HG sing N N 179 LEU CD1 HD11 sing N N 180 LEU CD1 HD12 sing N N 181 LEU CD1 HD13 sing N N 182 LEU CD2 HD21 sing N N 183 LEU CD2 HD22 sing N N 184 LEU CD2 HD23 sing N N 185 LEU OXT HXT sing N N 186 LYS N CA sing N N 187 LYS N H sing N N 188 LYS N H2 sing N N 189 LYS CA C sing N N 190 LYS CA CB sing N N 191 LYS CA HA sing N N 192 LYS C O doub N N 193 LYS C OXT sing N N 194 LYS CB CG sing N N 195 LYS CB HB2 sing N N 196 LYS CB HB3 sing N N 197 LYS CG CD sing N N 198 LYS CG HG2 sing N N 199 LYS CG HG3 sing N N 200 LYS CD CE sing N N 201 LYS CD HD2 sing N N 202 LYS CD HD3 sing N N 203 LYS CE NZ sing N N 204 LYS CE HE2 sing N N 205 LYS CE HE3 sing N N 206 LYS NZ HZ1 sing N N 207 LYS NZ HZ2 sing N N 208 LYS NZ HZ3 sing N N 209 LYS OXT HXT sing N N 210 MET N CA sing N N 211 MET N H sing N N 212 MET N H2 sing N N 213 MET CA C sing N N 214 MET CA CB sing N N 215 MET CA HA sing N N 216 MET C O doub N N 217 MET C OXT sing N N 218 MET CB CG sing N N 219 MET CB HB2 sing N N 220 MET CB HB3 sing N N 221 MET CG SD sing N N 222 MET CG HG2 sing N N 223 MET CG HG3 sing N N 224 MET SD CE sing N N 225 MET CE HE1 sing N N 226 MET CE HE2 sing N N 227 MET CE HE3 sing N N 228 MET OXT HXT sing N N 229 PHE N CA sing N N 230 PHE N H sing N N 231 PHE N H2 sing N N 232 PHE CA C sing N N 233 PHE CA CB sing N N 234 PHE CA HA sing N N 235 PHE C O doub N N 236 PHE C OXT sing N N 237 PHE CB CG sing N N 238 PHE CB HB2 sing N N 239 PHE CB HB3 sing N N 240 PHE CG CD1 doub Y N 241 PHE CG CD2 sing Y N 242 PHE CD1 CE1 sing Y N 243 PHE CD1 HD1 sing N N 244 PHE CD2 CE2 doub Y N 245 PHE CD2 HD2 sing N N 246 PHE CE1 CZ doub Y N 247 PHE CE1 HE1 sing N N 248 PHE CE2 CZ sing Y N 249 PHE CE2 HE2 sing N N 250 PHE CZ HZ sing N N 251 PHE OXT HXT sing N N 252 PRO N CA sing N N 253 PRO N CD sing N N 254 PRO N H sing N N 255 PRO CA C sing N N 256 PRO CA CB sing N N 257 PRO CA HA sing N N 258 PRO C O doub N N 259 PRO C OXT sing N N 260 PRO CB CG sing N N 261 PRO CB HB2 sing N N 262 PRO CB HB3 sing N N 263 PRO CG CD sing N N 264 PRO CG HG2 sing N N 265 PRO CG HG3 sing N N 266 PRO CD HD2 sing N N 267 PRO CD HD3 sing N N 268 PRO OXT HXT sing N N 269 SER N CA sing N N 270 SER N H sing N N 271 SER N H2 sing N N 272 SER CA C sing N N 273 SER CA CB sing N N 274 SER CA HA sing N N 275 SER C O doub N N 276 SER C OXT sing N N 277 SER CB OG sing N N 278 SER CB HB2 sing N N 279 SER CB HB3 sing N N 280 SER OG HG sing N N 281 SER OXT HXT sing N N 282 THR N CA sing N N 283 THR N H sing N N 284 THR N H2 sing N N 285 THR CA C sing N N 286 THR CA CB sing N N 287 THR CA HA sing N N 288 THR C O doub N N 289 THR C OXT sing N N 290 THR CB OG1 sing N N 291 THR CB CG2 sing N N 292 THR CB HB sing N N 293 THR OG1 HG1 sing N N 294 THR CG2 HG21 sing N N 295 THR CG2 HG22 sing N N 296 THR CG2 HG23 sing N N 297 THR OXT HXT sing N N 298 TRP N CA sing N N 299 TRP N H sing N N 300 TRP N H2 sing N N 301 TRP CA C sing N N 302 TRP CA CB sing N N 303 TRP CA HA sing N N 304 TRP C O doub N N 305 TRP C OXT sing N N 306 TRP CB CG sing N N 307 TRP CB HB2 sing N N 308 TRP CB HB3 sing N N 309 TRP CG CD1 doub Y N 310 TRP CG CD2 sing Y N 311 TRP CD1 NE1 sing Y N 312 TRP CD1 HD1 sing N N 313 TRP CD2 CE2 doub Y N 314 TRP CD2 CE3 sing Y N 315 TRP NE1 CE2 sing Y N 316 TRP NE1 HE1 sing N N 317 TRP CE2 CZ2 sing Y N 318 TRP CE3 CZ3 doub Y N 319 TRP CE3 HE3 sing N N 320 TRP CZ2 CH2 doub Y N 321 TRP CZ2 HZ2 sing N N 322 TRP CZ3 CH2 sing Y N 323 TRP CZ3 HZ3 sing N N 324 TRP CH2 HH2 sing N N 325 TRP OXT HXT sing N N 326 TYR N CA sing N N 327 TYR N H sing N N 328 TYR N H2 sing N N 329 TYR CA C sing N N 330 TYR CA CB sing N N 331 TYR CA HA sing N N 332 TYR C O doub N N 333 TYR C OXT sing N N 334 TYR CB CG sing N N 335 TYR CB HB2 sing N N 336 TYR CB HB3 sing N N 337 TYR CG CD1 doub Y N 338 TYR CG CD2 sing Y N 339 TYR CD1 CE1 sing Y N 340 TYR CD1 HD1 sing N N 341 TYR CD2 CE2 doub Y N 342 TYR CD2 HD2 sing N N 343 TYR CE1 CZ doub Y N 344 TYR CE1 HE1 sing N N 345 TYR CE2 CZ sing Y N 346 TYR CE2 HE2 sing N N 347 TYR CZ OH sing N N 348 TYR OH HH sing N N 349 TYR OXT HXT sing N N 350 VAL N CA sing N N 351 VAL N H sing N N 352 VAL N H2 sing N N 353 VAL CA C sing N N 354 VAL CA CB sing N N 355 VAL CA HA sing N N 356 VAL C O doub N N 357 VAL C OXT sing N N 358 VAL CB CG1 sing N N 359 VAL CB CG2 sing N N 360 VAL CB HB sing N N 361 VAL CG1 HG11 sing N N 362 VAL CG1 HG12 sing N N 363 VAL CG1 HG13 sing N N 364 VAL CG2 HG21 sing N N 365 VAL CG2 HG22 sing N N 366 VAL CG2 HG23 sing N N 367 VAL OXT HXT sing N N 368 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5OVC _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6EXJ _atom_sites.fract_transf_matrix[1][1] 0.023337 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023095 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012697 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_