data_6F99 # _entry.id 6F99 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6F99 pdb_00006f99 10.2210/pdb6f99/pdb WWPDB D_1200007969 ? ? BMRB 34218 ? 10.13018/BMR34218 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-30 2 'Structure model' 1 1 2019-05-08 3 'Structure model' 1 2 2019-10-16 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_software 2 3 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' struct_ref 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 7 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6F99 _pdbx_database_status.recvd_initial_deposition_date 2017-12-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the MRH domain of Yos9' _pdbx_database_related.db_id 34218 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kniss, A.' 1 ? 'Kazemi, S.' 2 0000-0002-5470-9475 'Lohr, F.' 3 ? 'Guntert, P.' 4 ? 'Dotsch, V.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution structure of the MRH domain of Yos9' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Berger, M.' 1 ? primary 'Kniss, A.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ER quality-control lectin' _entity.formula_weight 18328.627 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GASNSEKTALLTKTLNQGVKTIFDKLNERCIFYQAGFWIYEYCPGIEFVQFHGRVNTKTGEIVNRDESLVYRLGKPKANV EEREFELLYDDVGYYISEIIGSGDICDVTGAERMVEIQYVCGGSNSGPSTIQWVRETKICVYEAQVTIPELCNLELLAKN ED ; _entity_poly.pdbx_seq_one_letter_code_can ;GASNSEKTALLTKTLNQGVKTIFDKLNERCIFYQAGFWIYEYCPGIEFVQFHGRVNTKTGEIVNRDESLVYRLGKPKANV EEREFELLYDDVGYYISEIIGSGDICDVTGAERMVEIQYVCGGSNSGPSTIQWVRETKICVYEAQVTIPELCNLELLAKN ED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 SER n 1 4 ASN n 1 5 SER n 1 6 GLU n 1 7 LYS n 1 8 THR n 1 9 ALA n 1 10 LEU n 1 11 LEU n 1 12 THR n 1 13 LYS n 1 14 THR n 1 15 LEU n 1 16 ASN n 1 17 GLN n 1 18 GLY n 1 19 VAL n 1 20 LYS n 1 21 THR n 1 22 ILE n 1 23 PHE n 1 24 ASP n 1 25 LYS n 1 26 LEU n 1 27 ASN n 1 28 GLU n 1 29 ARG n 1 30 CYS n 1 31 ILE n 1 32 PHE n 1 33 TYR n 1 34 GLN n 1 35 ALA n 1 36 GLY n 1 37 PHE n 1 38 TRP n 1 39 ILE n 1 40 TYR n 1 41 GLU n 1 42 TYR n 1 43 CYS n 1 44 PRO n 1 45 GLY n 1 46 ILE n 1 47 GLU n 1 48 PHE n 1 49 VAL n 1 50 GLN n 1 51 PHE n 1 52 HIS n 1 53 GLY n 1 54 ARG n 1 55 VAL n 1 56 ASN n 1 57 THR n 1 58 LYS n 1 59 THR n 1 60 GLY n 1 61 GLU n 1 62 ILE n 1 63 VAL n 1 64 ASN n 1 65 ARG n 1 66 ASP n 1 67 GLU n 1 68 SER n 1 69 LEU n 1 70 VAL n 1 71 TYR n 1 72 ARG n 1 73 LEU n 1 74 GLY n 1 75 LYS n 1 76 PRO n 1 77 LYS n 1 78 ALA n 1 79 ASN n 1 80 VAL n 1 81 GLU n 1 82 GLU n 1 83 ARG n 1 84 GLU n 1 85 PHE n 1 86 GLU n 1 87 LEU n 1 88 LEU n 1 89 TYR n 1 90 ASP n 1 91 ASP n 1 92 VAL n 1 93 GLY n 1 94 TYR n 1 95 TYR n 1 96 ILE n 1 97 SER n 1 98 GLU n 1 99 ILE n 1 100 ILE n 1 101 GLY n 1 102 SER n 1 103 GLY n 1 104 ASP n 1 105 ILE n 1 106 CYS n 1 107 ASP n 1 108 VAL n 1 109 THR n 1 110 GLY n 1 111 ALA n 1 112 GLU n 1 113 ARG n 1 114 MET n 1 115 VAL n 1 116 GLU n 1 117 ILE n 1 118 GLN n 1 119 TYR n 1 120 VAL n 1 121 CYS n 1 122 GLY n 1 123 GLY n 1 124 SER n 1 125 ASN n 1 126 SER n 1 127 GLY n 1 128 PRO n 1 129 SER n 1 130 THR n 1 131 ILE n 1 132 GLN n 1 133 TRP n 1 134 VAL n 1 135 ARG n 1 136 GLU n 1 137 THR n 1 138 LYS n 1 139 ILE n 1 140 CYS n 1 141 VAL n 1 142 TYR n 1 143 GLU n 1 144 ALA n 1 145 GLN n 1 146 VAL n 1 147 THR n 1 148 ILE n 1 149 PRO n 1 150 GLU n 1 151 LEU n 1 152 CYS n 1 153 ASN n 1 154 LEU n 1 155 GLU n 1 156 LEU n 1 157 LEU n 1 158 ALA n 1 159 LYS n 1 160 ASN n 1 161 GLU n 1 162 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 162 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'YOS9, SCKG_0443' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 88 88 GLY GLY A . n A 1 2 ALA 2 89 89 ALA ALA A . n A 1 3 SER 3 90 90 SER SER A . n A 1 4 ASN 4 91 91 ASN ASN A . n A 1 5 SER 5 92 92 SER SER A . n A 1 6 GLU 6 93 93 GLU GLU A . n A 1 7 LYS 7 94 94 LYS LYS A . n A 1 8 THR 8 95 95 THR THR A . n A 1 9 ALA 9 96 96 ALA ALA A . n A 1 10 LEU 10 97 97 LEU LEU A . n A 1 11 LEU 11 98 98 LEU LEU A . n A 1 12 THR 12 99 99 THR THR A . n A 1 13 LYS 13 100 100 LYS LYS A . n A 1 14 THR 14 101 101 THR THR A . n A 1 15 LEU 15 102 102 LEU LEU A . n A 1 16 ASN 16 103 103 ASN ASN A . n A 1 17 GLN 17 104 104 GLN GLN A . n A 1 18 GLY 18 105 105 GLY GLY A . n A 1 19 VAL 19 106 106 VAL VAL A . n A 1 20 LYS 20 107 107 LYS LYS A . n A 1 21 THR 21 108 108 THR THR A . n A 1 22 ILE 22 109 109 ILE ILE A . n A 1 23 PHE 23 110 110 PHE PHE A . n A 1 24 ASP 24 111 111 ASP ASP A . n A 1 25 LYS 25 112 112 LYS LYS A . n A 1 26 LEU 26 113 113 LEU LEU A . n A 1 27 ASN 27 114 114 ASN ASN A . n A 1 28 GLU 28 115 115 GLU GLU A . n A 1 29 ARG 29 116 116 ARG ARG A . n A 1 30 CYS 30 117 117 CYS CYS A . n A 1 31 ILE 31 118 118 ILE ILE A . n A 1 32 PHE 32 119 119 PHE PHE A . n A 1 33 TYR 33 120 120 TYR TYR A . n A 1 34 GLN 34 121 121 GLN GLN A . n A 1 35 ALA 35 122 122 ALA ALA A . n A 1 36 GLY 36 123 123 GLY GLY A . n A 1 37 PHE 37 124 124 PHE PHE A . n A 1 38 TRP 38 125 125 TRP TRP A . n A 1 39 ILE 39 126 126 ILE ILE A . n A 1 40 TYR 40 127 127 TYR TYR A . n A 1 41 GLU 41 128 128 GLU GLU A . n A 1 42 TYR 42 129 129 TYR TYR A . n A 1 43 CYS 43 130 130 CYS CYS A . n A 1 44 PRO 44 131 131 PRO PRO A . n A 1 45 GLY 45 132 132 GLY GLY A . n A 1 46 ILE 46 133 133 ILE ILE A . n A 1 47 GLU 47 134 134 GLU GLU A . n A 1 48 PHE 48 135 135 PHE PHE A . n A 1 49 VAL 49 136 136 VAL VAL A . n A 1 50 GLN 50 137 137 GLN GLN A . n A 1 51 PHE 51 138 138 PHE PHE A . n A 1 52 HIS 52 139 139 HIS HIS A . n A 1 53 GLY 53 140 140 GLY GLY A . n A 1 54 ARG 54 141 141 ARG ARG A . n A 1 55 VAL 55 142 142 VAL VAL A . n A 1 56 ASN 56 143 143 ASN ASN A . n A 1 57 THR 57 144 144 THR THR A . n A 1 58 LYS 58 145 145 LYS LYS A . n A 1 59 THR 59 146 146 THR THR A . n A 1 60 GLY 60 147 147 GLY GLY A . n A 1 61 GLU 61 148 148 GLU GLU A . n A 1 62 ILE 62 149 149 ILE ILE A . n A 1 63 VAL 63 150 150 VAL VAL A . n A 1 64 ASN 64 151 151 ASN ASN A . n A 1 65 ARG 65 152 152 ARG ARG A . n A 1 66 ASP 66 153 153 ASP ASP A . n A 1 67 GLU 67 154 154 GLU GLU A . n A 1 68 SER 68 155 155 SER SER A . n A 1 69 LEU 69 156 156 LEU LEU A . n A 1 70 VAL 70 157 157 VAL VAL A . n A 1 71 TYR 71 158 158 TYR TYR A . n A 1 72 ARG 72 159 159 ARG ARG A . n A 1 73 LEU 73 160 160 LEU LEU A . n A 1 74 GLY 74 161 161 GLY GLY A . n A 1 75 LYS 75 162 162 LYS LYS A . n A 1 76 PRO 76 163 163 PRO PRO A . n A 1 77 LYS 77 164 164 LYS LYS A . n A 1 78 ALA 78 165 165 ALA ALA A . n A 1 79 ASN 79 166 166 ASN ASN A . n A 1 80 VAL 80 167 167 VAL VAL A . n A 1 81 GLU 81 168 168 GLU GLU A . n A 1 82 GLU 82 169 169 GLU GLU A . n A 1 83 ARG 83 170 170 ARG ARG A . n A 1 84 GLU 84 171 171 GLU GLU A . n A 1 85 PHE 85 172 172 PHE PHE A . n A 1 86 GLU 86 173 173 GLU GLU A . n A 1 87 LEU 87 174 174 LEU LEU A . n A 1 88 LEU 88 175 175 LEU LEU A . n A 1 89 TYR 89 176 176 TYR TYR A . n A 1 90 ASP 90 177 177 ASP ASP A . n A 1 91 ASP 91 178 178 ASP ASP A . n A 1 92 VAL 92 179 179 VAL VAL A . n A 1 93 GLY 93 180 180 GLY GLY A . n A 1 94 TYR 94 181 181 TYR TYR A . n A 1 95 TYR 95 182 182 TYR TYR A . n A 1 96 ILE 96 183 183 ILE ILE A . n A 1 97 SER 97 184 184 SER SER A . n A 1 98 GLU 98 185 185 GLU GLU A . n A 1 99 ILE 99 186 186 ILE ILE A . n A 1 100 ILE 100 187 187 ILE ILE A . n A 1 101 GLY 101 188 188 GLY GLY A . n A 1 102 SER 102 189 189 SER SER A . n A 1 103 GLY 103 190 190 GLY GLY A . n A 1 104 ASP 104 191 191 ASP ASP A . n A 1 105 ILE 105 192 192 ILE ILE A . n A 1 106 CYS 106 193 193 CYS CYS A . n A 1 107 ASP 107 194 194 ASP ASP A . n A 1 108 VAL 108 195 195 VAL VAL A . n A 1 109 THR 109 196 196 THR THR A . n A 1 110 GLY 110 197 197 GLY GLY A . n A 1 111 ALA 111 198 198 ALA ALA A . n A 1 112 GLU 112 199 199 GLU GLU A . n A 1 113 ARG 113 200 200 ARG ARG A . n A 1 114 MET 114 201 201 MET MET A . n A 1 115 VAL 115 202 202 VAL VAL A . n A 1 116 GLU 116 203 203 GLU GLU A . n A 1 117 ILE 117 204 204 ILE ILE A . n A 1 118 GLN 118 205 205 GLN GLN A . n A 1 119 TYR 119 206 206 TYR TYR A . n A 1 120 VAL 120 207 207 VAL VAL A . n A 1 121 CYS 121 208 208 CYS CYS A . n A 1 122 GLY 122 209 209 GLY GLY A . n A 1 123 GLY 123 210 210 GLY GLY A . n A 1 124 SER 124 211 211 SER SER A . n A 1 125 ASN 125 212 212 ASN ASN A . n A 1 126 SER 126 213 213 SER SER A . n A 1 127 GLY 127 214 214 GLY GLY A . n A 1 128 PRO 128 215 215 PRO PRO A . n A 1 129 SER 129 216 216 SER SER A . n A 1 130 THR 130 217 217 THR THR A . n A 1 131 ILE 131 218 218 ILE ILE A . n A 1 132 GLN 132 219 219 GLN GLN A . n A 1 133 TRP 133 220 220 TRP TRP A . n A 1 134 VAL 134 221 221 VAL VAL A . n A 1 135 ARG 135 222 222 ARG ARG A . n A 1 136 GLU 136 223 223 GLU GLU A . n A 1 137 THR 137 224 224 THR THR A . n A 1 138 LYS 138 225 225 LYS LYS A . n A 1 139 ILE 139 226 226 ILE ILE A . n A 1 140 CYS 140 227 227 CYS CYS A . n A 1 141 VAL 141 228 228 VAL VAL A . n A 1 142 TYR 142 229 229 TYR TYR A . n A 1 143 GLU 143 230 230 GLU GLU A . n A 1 144 ALA 144 231 231 ALA ALA A . n A 1 145 GLN 145 232 232 GLN GLN A . n A 1 146 VAL 146 233 233 VAL VAL A . n A 1 147 THR 147 234 234 THR THR A . n A 1 148 ILE 148 235 235 ILE ILE A . n A 1 149 PRO 149 236 236 PRO PRO A . n A 1 150 GLU 150 237 237 GLU GLU A . n A 1 151 LEU 151 238 238 LEU LEU A . n A 1 152 CYS 152 239 239 CYS CYS A . n A 1 153 ASN 153 240 240 ASN ASN A . n A 1 154 LEU 154 241 241 LEU LEU A . n A 1 155 GLU 155 242 242 GLU GLU A . n A 1 156 LEU 156 243 243 LEU LEU A . n A 1 157 LEU 157 244 244 LEU LEU A . n A 1 158 ALA 158 245 245 ALA ALA A . n A 1 159 LYS 159 246 246 LYS LYS A . n A 1 160 ASN 160 247 247 ASN ASN A . n A 1 161 GLU 161 248 248 GLU GLU A . n A 1 162 ASP 162 249 249 ASP ASP A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6F99 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6F99 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6F99 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 6F99 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 6F99 _struct.title 'Solution structure of the MRH domain of Yos9' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6F99 _struct_keywords.text 'MRH domain, beta barrell, lectin, sugar binding protein' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A250W9K2_YEASX _struct_ref.pdbx_db_accession A0A250W9K2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SNSEKTALLTKTLNQGVKTIFDKLNERCIFYQAGFWIYEYCPGIEFVQFHGRVNTKTGEIVNRDESLVYRLGKPKANVEE REFELLYDDVGYYISEIIGSGDICDVTGAERMVEIQYVCGGSNSGPSTIQWVRETKICVYEAQVTIPELCNLELLAKNED ; _struct_ref.pdbx_align_begin 90 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6F99 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A250W9K2 _struct_ref_seq.db_align_beg 90 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 249 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 90 _struct_ref_seq.pdbx_auth_seq_align_end 249 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6F99 GLY A 1 ? UNP A0A250W9K2 ? ? 'expression tag' 88 1 1 6F99 ALA A 2 ? UNP A0A250W9K2 ? ? 'expression tag' 89 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10190 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 4 ? ASN A 27 ? ASN A 91 ASN A 114 1 ? 24 HELX_P HELX_P2 AA2 PRO A 149 ? LEU A 154 ? PRO A 236 LEU A 241 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 117 A CYS 130 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 106 SG ? ? ? 1_555 A CYS 140 SG ? ? A CYS 193 A CYS 227 1_555 ? ? ? ? ? ? ? 2.012 ? ? disulf3 disulf ? ? A CYS 121 SG ? ? ? 1_555 A CYS 152 SG ? ? A CYS 208 A CYS 239 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 30 ? CYS A 43 ? CYS A 117 ? 1_555 CYS A 130 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 106 ? CYS A 140 ? CYS A 193 ? 1_555 CYS A 227 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 121 ? CYS A 152 ? CYS A 208 ? 1_555 CYS A 239 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 31 ? ALA A 35 ? ILE A 118 ALA A 122 AA1 2 TRP A 38 ? TYR A 42 ? TRP A 125 TYR A 129 AA1 3 PHE A 48 ? PHE A 51 ? PHE A 135 PHE A 138 AA2 1 GLU A 86 ? TYR A 89 ? GLU A 173 TYR A 176 AA2 2 TYR A 94 ? ILE A 100 ? TYR A 181 ILE A 187 AA2 3 VAL A 115 ? CYS A 121 ? VAL A 202 CYS A 208 AA2 4 TYR A 142 ? ILE A 148 ? TYR A 229 ILE A 235 AA2 5 THR A 130 ? GLU A 136 ? THR A 217 GLU A 223 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 31 ? N ILE A 118 O TYR A 42 ? O TYR A 129 AA1 2 3 N ILE A 39 ? N ILE A 126 O PHE A 51 ? O PHE A 138 AA2 1 2 N GLU A 86 ? N GLU A 173 O SER A 97 ? O SER A 184 AA2 2 3 N GLU A 98 ? N GLU A 185 O ILE A 117 ? O ILE A 204 AA2 3 4 N GLU A 116 ? N GLU A 203 O TYR A 142 ? O TYR A 229 AA2 4 5 O GLN A 145 ? O GLN A 232 N GLN A 132 ? N GLN A 219 # _pdbx_entry_details.entry_id 6F99 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.55 2 2 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.58 3 3 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.58 4 4 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.59 5 5 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.55 6 5 HG1 A THR 224 ? ? OE2 A GLU 230 ? ? 1.58 7 6 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.58 8 7 OE2 A GLU 185 ? ? HH A TYR 206 ? ? 1.58 9 8 HG1 A THR 224 ? ? OE2 A GLU 230 ? ? 1.59 10 9 O A GLN 104 ? ? HG1 A THR 108 ? ? 1.58 11 10 HG1 A THR 224 ? ? OE2 A GLU 230 ? ? 1.57 12 10 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.58 13 11 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.54 14 11 HG1 A THR 224 ? ? OE2 A GLU 230 ? ? 1.57 15 13 OE2 A GLU 185 ? ? HH A TYR 206 ? ? 1.57 16 13 OE1 A GLU 154 ? ? HG A SER 155 ? ? 1.59 17 14 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.56 18 14 HG1 A THR 224 ? ? OE2 A GLU 230 ? ? 1.60 19 15 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.54 20 16 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.57 21 17 HG1 A THR 224 ? ? OE2 A GLU 230 ? ? 1.54 22 18 HG1 A THR 224 ? ? OE2 A GLU 230 ? ? 1.55 23 18 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.55 24 18 O A LEU 97 ? ? HG1 A THR 101 ? ? 1.59 25 19 OE1 A GLU 185 ? ? HH A TYR 206 ? ? 1.52 26 20 HG1 A THR 224 ? ? OE2 A GLU 230 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 NE A ARG 170 ? ? CZ A ARG 170 ? ? NH1 A ARG 170 ? ? 123.36 120.30 3.06 0.50 N 2 8 NE A ARG 159 ? ? CZ A ARG 159 ? ? NH1 A ARG 159 ? ? 123.45 120.30 3.15 0.50 N 3 16 CB A TYR 181 ? ? CG A TYR 181 ? ? CD2 A TYR 181 ? ? 117.05 121.00 -3.95 0.60 N 4 19 NE A ARG 152 ? ? CZ A ARG 152 ? ? NH2 A ARG 152 ? ? 116.92 120.30 -3.38 0.50 N 5 20 NE A ARG 200 ? ? CZ A ARG 200 ? ? NH2 A ARG 200 ? ? 117.07 120.30 -3.23 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 131 ? ? -63.60 76.68 2 1 ILE A 133 ? ? -130.57 -71.46 3 1 ARG A 200 ? ? -72.60 29.11 4 1 PRO A 215 ? ? -85.43 -113.85 5 2 GLU A 115 ? ? -68.01 -74.71 6 2 ILE A 133 ? ? -120.84 -72.30 7 2 GLU A 134 ? ? -179.20 141.91 8 2 SER A 189 ? ? 71.58 35.25 9 2 ARG A 200 ? ? -69.04 29.18 10 2 PRO A 215 ? ? -72.68 -75.37 11 3 PRO A 131 ? ? -60.53 85.35 12 3 ILE A 133 ? ? -115.65 -72.49 13 3 SER A 189 ? ? 70.22 51.64 14 3 ARG A 200 ? ? -77.22 28.76 15 3 PRO A 215 ? ? -75.85 -110.30 16 3 GLU A 248 ? ? -142.07 59.32 17 4 PRO A 131 ? ? -63.73 86.28 18 4 ILE A 133 ? ? -118.59 -71.62 19 4 ASN A 151 ? ? -164.32 108.58 20 4 PRO A 163 ? ? -77.22 -168.36 21 4 ASP A 178 ? ? -68.38 2.20 22 4 SER A 189 ? ? 80.42 22.80 23 4 ARG A 200 ? ? -70.10 26.77 24 4 PRO A 215 ? ? -81.23 -115.83 25 4 ASN A 247 ? ? -97.34 -76.16 26 4 GLU A 248 ? ? -144.89 39.18 27 5 SER A 90 ? ? -66.34 93.30 28 5 PRO A 131 ? ? -67.78 85.96 29 5 ILE A 133 ? ? -117.15 -73.62 30 5 ASP A 153 ? ? 27.10 53.58 31 5 ASN A 166 ? ? -68.72 64.60 32 5 ASP A 191 ? ? 153.83 -174.14 33 5 ARG A 200 ? ? -67.47 29.00 34 5 SER A 211 ? ? -73.06 -163.51 35 5 SER A 213 ? ? -64.68 93.85 36 5 PRO A 215 ? ? -68.87 -91.10 37 6 ASN A 91 ? ? 54.22 7.50 38 6 GLU A 115 ? ? -64.62 -72.77 39 6 PRO A 131 ? ? -63.77 78.46 40 6 ILE A 133 ? ? -130.86 -71.44 41 6 THR A 144 ? ? -58.06 -8.61 42 6 ASN A 151 ? ? 159.70 177.79 43 6 ARG A 152 ? ? 81.56 70.05 44 6 ASP A 153 ? ? -101.23 -82.12 45 6 SER A 189 ? ? 75.19 33.39 46 6 ARG A 200 ? ? -71.10 27.78 47 6 PRO A 215 ? ? -78.93 -104.96 48 7 PRO A 131 ? ? -62.61 84.53 49 7 ARG A 152 ? ? -102.33 -77.61 50 7 ARG A 200 ? ? -74.52 28.58 51 7 PRO A 215 ? ? -80.15 -101.97 52 7 ASN A 247 ? ? -101.77 -69.63 53 8 GLU A 115 ? ? -51.18 -74.77 54 8 PRO A 131 ? ? -67.97 81.31 55 8 ILE A 133 ? ? -131.04 -72.02 56 8 ARG A 152 ? ? -79.75 -155.97 57 8 ASP A 153 ? ? -67.04 90.53 58 8 PRO A 163 ? ? -75.60 -167.98 59 8 ARG A 200 ? ? -70.05 30.98 60 8 SER A 211 ? ? -63.16 80.16 61 8 ASN A 212 ? ? -140.29 59.40 62 8 PRO A 215 ? ? -67.10 -95.03 63 8 ASN A 247 ? ? -144.05 -13.89 64 9 ALA A 89 ? ? -147.37 -143.69 65 9 PRO A 131 ? ? -64.21 76.68 66 9 ILE A 133 ? ? -128.12 -71.24 67 9 ASN A 151 ? ? 36.61 84.10 68 9 ARG A 152 ? ? -140.85 -34.64 69 9 ARG A 200 ? ? -71.62 29.34 70 9 SER A 213 ? ? -59.72 104.84 71 9 PRO A 215 ? ? -68.95 -92.50 72 10 ASN A 91 ? ? -60.21 90.45 73 10 PRO A 131 ? ? -65.69 84.86 74 10 ILE A 133 ? ? -114.67 -72.59 75 10 SER A 189 ? ? 84.25 56.64 76 10 SER A 211 ? ? -74.48 -149.71 77 10 SER A 213 ? ? -41.39 100.14 78 10 SER A 216 ? ? -171.19 145.57 79 11 PRO A 131 ? ? -61.99 80.56 80 11 ILE A 133 ? ? -122.93 -69.43 81 11 ASN A 151 ? ? 176.08 149.31 82 11 SER A 189 ? ? 85.29 3.61 83 11 ARG A 200 ? ? -71.00 28.65 84 11 PRO A 215 ? ? -78.88 -113.67 85 12 GLU A 115 ? ? -64.85 -70.34 86 12 PRO A 131 ? ? -63.26 70.75 87 12 ILE A 133 ? ? -124.65 -71.72 88 12 GLU A 134 ? ? -175.21 138.29 89 12 PRO A 163 ? ? -73.30 -169.44 90 12 ARG A 200 ? ? -69.94 30.52 91 12 PRO A 215 ? ? -79.10 -99.14 92 12 GLU A 248 ? ? -146.43 26.59 93 13 PRO A 131 ? ? -63.13 83.25 94 13 ILE A 133 ? ? -122.70 -70.25 95 13 ASP A 153 ? ? 38.58 81.57 96 13 GLU A 154 ? ? -60.95 -79.65 97 13 ARG A 200 ? ? -66.64 27.71 98 13 PRO A 215 ? ? -75.63 -104.06 99 14 SER A 90 ? ? -149.85 -74.29 100 14 ASN A 91 ? ? -76.77 37.20 101 14 PRO A 131 ? ? -64.36 82.04 102 14 ILE A 133 ? ? -125.18 -68.28 103 14 SER A 189 ? ? 162.83 25.21 104 14 ARG A 200 ? ? -87.75 30.80 105 14 PRO A 215 ? ? -65.08 -92.22 106 15 ALA A 89 ? ? 65.02 -16.63 107 15 SER A 90 ? ? -63.97 83.59 108 15 GLU A 115 ? ? -49.32 -72.01 109 15 PRO A 131 ? ? -67.17 74.10 110 15 ILE A 133 ? ? -121.06 -66.96 111 15 ARG A 200 ? ? -67.56 29.71 112 15 PRO A 215 ? ? -69.06 -94.34 113 15 GLU A 248 ? ? -140.97 51.18 114 16 ALA A 89 ? ? 51.31 7.64 115 16 PRO A 131 ? ? -66.23 80.25 116 16 ILE A 133 ? ? -117.18 -71.99 117 16 ASP A 153 ? ? 8.68 61.32 118 16 GLU A 154 ? ? -59.72 -79.98 119 16 SER A 189 ? ? 81.33 18.51 120 16 ARG A 200 ? ? -71.27 29.75 121 16 PRO A 215 ? ? -79.93 -89.84 122 16 SER A 216 ? ? -170.80 146.94 123 17 PRO A 131 ? ? -64.63 91.33 124 17 ILE A 133 ? ? -115.14 -71.58 125 17 ASN A 151 ? ? -175.75 148.78 126 17 ASP A 191 ? ? 157.29 179.98 127 17 ARG A 200 ? ? -70.06 27.01 128 17 PRO A 215 ? ? -78.37 -118.26 129 18 ALA A 89 ? ? 35.16 66.14 130 18 PRO A 131 ? ? -68.19 72.42 131 18 ILE A 133 ? ? -131.03 -72.31 132 18 GLU A 134 ? ? -173.65 136.90 133 18 ASN A 166 ? ? -68.88 65.36 134 18 SER A 189 ? ? 85.44 32.13 135 18 ARG A 200 ? ? -67.60 29.45 136 18 PRO A 215 ? ? -70.91 -90.67 137 19 ALA A 122 ? ? -100.54 79.99 138 19 PRO A 131 ? ? -63.90 74.46 139 19 ILE A 133 ? ? -124.31 -65.98 140 19 SER A 189 ? ? 76.73 40.54 141 19 ARG A 200 ? ? -76.61 28.71 142 19 PRO A 215 ? ? -80.02 -114.89 143 20 ALA A 89 ? ? -99.89 -111.99 144 20 PRO A 131 ? ? -68.96 74.34 145 20 ILE A 133 ? ? -124.83 -72.16 146 20 GLU A 134 ? ? 177.73 145.28 147 20 SER A 189 ? ? 71.30 47.87 148 20 ARG A 200 ? ? -69.91 27.23 149 20 SER A 211 ? ? -69.72 78.75 150 20 PRO A 215 ? ? -67.22 -82.64 151 20 ASN A 247 ? ? 63.11 -13.01 152 20 GLU A 248 ? ? -72.58 22.40 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 222 ? ? 0.114 'SIDE CHAIN' 2 3 ARG A 170 ? ? 0.080 'SIDE CHAIN' 3 4 TYR A 127 ? ? 0.083 'SIDE CHAIN' 4 4 ARG A 200 ? ? 0.083 'SIDE CHAIN' 5 4 TYR A 206 ? ? 0.080 'SIDE CHAIN' 6 5 ARG A 170 ? ? 0.102 'SIDE CHAIN' 7 5 TYR A 229 ? ? 0.071 'SIDE CHAIN' 8 7 ARG A 116 ? ? 0.089 'SIDE CHAIN' 9 8 ARG A 222 ? ? 0.086 'SIDE CHAIN' 10 9 TYR A 206 ? ? 0.112 'SIDE CHAIN' 11 10 TYR A 127 ? ? 0.081 'SIDE CHAIN' 12 10 ARG A 141 ? ? 0.102 'SIDE CHAIN' 13 12 TYR A 206 ? ? 0.088 'SIDE CHAIN' 14 12 ARG A 222 ? ? 0.116 'SIDE CHAIN' 15 14 ARG A 116 ? ? 0.086 'SIDE CHAIN' 16 14 TYR A 158 ? ? 0.074 'SIDE CHAIN' 17 15 ARG A 141 ? ? 0.111 'SIDE CHAIN' 18 15 TYR A 206 ? ? 0.095 'SIDE CHAIN' 19 15 ARG A 222 ? ? 0.081 'SIDE CHAIN' 20 16 TYR A 127 ? ? 0.081 'SIDE CHAIN' 21 17 TYR A 176 ? ? 0.068 'SIDE CHAIN' 22 18 ARG A 159 ? ? 0.080 'SIDE CHAIN' 23 18 ARG A 222 ? ? 0.096 'SIDE CHAIN' 24 19 TYR A 206 ? ? 0.107 'SIDE CHAIN' 25 20 TYR A 127 ? ? 0.085 'SIDE CHAIN' 26 20 TYR A 176 ? ? 0.074 'SIDE CHAIN' 27 20 TYR A 206 ? ? 0.084 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 6F99 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6F99 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1.2 mM [U-98% 13C; U-98% 15N] MRH domain of Yos9, 95% H2O/5% D2O' '95% H2O/5% D2O' 13C_15N_sample solution '25 mM HEPES, pH 7.0, 50 mM NaCl, PIC, NaN3, DSS, 5% D2O' 2 '1 mM [U-98% 15N] MRH domain of Yos9, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_sample solution '25 mM HEPES, pH 7.0, 50 mM NaCl, PIC, NaN3, DSS, 5% D2O' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'MRH domain of Yos9' 1.2 ? mM '[U-98% 13C; U-98% 15N]' 2 'MRH domain of Yos9' 1 ? mM '[U-98% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '3D 1H-15N NOESY' 4 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 3 isotropic 3 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic 4 1 1 '3D HCCH-TOCSY' 2 isotropic 5 1 1 '3D 1H TOCSY' 1 isotropic 6 1 1 '3D 13C TOCSY' 1 isotropic 7 1 1 '2D 1H-15N HSQC' 4 isotropic 8 1 1 '2D 1H-13C HSQC aliphatic' 3 isotropic 9 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 10 1 1 '3D HNCO' 1 isotropic 11 1 1 '3D HNCACB' 1 isotropic 12 1 1 '3D HN(COCA)CB' 1 isotropic 13 1 1 '3D HN(CA)CO' 1 isotropic 14 1 1 '2D (H)CB(CGCC)H TOCSY' 2 isotropic 15 1 1 '2D (H)CB(CGCD)HD' 2 isotropic # _pdbx_nmr_refine.entry_id 6F99 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' Sparky 3.13 Goddard 2 'structure calculation' CYANA 3.9 'Guntert, P.' 3 refinement OPAL ? 'Luginbuhl, Guntert, Billeter and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 ? 2 AVANCE ? Bruker 700 ? 3 AVANCE ? Bruker 800 ? 4 AVANCE ? Bruker 950 ? # _atom_sites.entry_id 6F99 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_