data_6FGS # _entry.id 6FGS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FGS pdb_00006fgs 10.2210/pdb6fgs/pdb WWPDB D_1200008277 ? ? BMRB 34233 ? 10.13018/BMR34233 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-30 2 'Structure model' 1 1 2018-08-22 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_nmr_software 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 3 'Structure model' '_pdbx_nmr_software.name' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' 11 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 12 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6FGS _pdbx_database_status.recvd_initial_deposition_date 2018-01-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '6FGN contains the solution structure of p300Taz2-p63TA fusion' 6FGN unspecified BMRB 'Solution structure of p300Taz2-p73TA1' 34233 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gebel, J.' 1 ? 'Kazemi, S.' 2 ? 'Lohr, F.' 3 ? 'Guntert, P.' 4 ? 'Dotsch, V.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 1878-4186 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first 1091 _citation.page_last 1100.e4 _citation.title 'Regulation of the Activity in the p53 Family Depends on the Organization of the Transactivation Domain.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2018.05.013 _citation.pdbx_database_id_PubMed 30099987 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krauskopf, K.' 1 ? primary 'Gebel, J.' 2 ? primary 'Kazemi, S.' 3 ? primary 'Tuppi, M.' 4 ? primary 'Lohr, F.' 5 ? primary 'Schafer, B.' 6 ? primary 'Koch, J.' 7 ? primary 'Guntert, P.' 8 ? primary 'Dotsch, V.' 9 ? primary 'Kehrloesser, S.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone acetyltransferase p300,Tumor protein p73' 13867.793 1 2.3.1.48,2.3.1.- ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;p300 HAT,E1A-associated protein p300,Histone butyryltransferase p300,Histone crotonyltransferase p300,Protein propionyltransferase p300,p53-like transcription factor,p53-related protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCP VPFCLNIKQKGGSGGGTGGGSGTIEGRGDGGTTFEHLWSSLEPDSTYFDL ; _entity_poly.pdbx_seq_one_letter_code_can ;ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCP VPFCLNIKQKGGSGGGTGGGSGTIEGRGDGGTTFEHLWSSLEPDSTYFDL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 GLN n 1 4 SER n 1 5 PRO n 1 6 GLY n 1 7 ASP n 1 8 SER n 1 9 ARG n 1 10 ARG n 1 11 LEU n 1 12 SER n 1 13 ILE n 1 14 GLN n 1 15 ARG n 1 16 ALA n 1 17 ILE n 1 18 GLN n 1 19 SER n 1 20 LEU n 1 21 VAL n 1 22 HIS n 1 23 ALA n 1 24 ALA n 1 25 GLN n 1 26 CYS n 1 27 ARG n 1 28 ASN n 1 29 ALA n 1 30 ASN n 1 31 CYS n 1 32 SER n 1 33 LEU n 1 34 PRO n 1 35 SER n 1 36 CYS n 1 37 GLN n 1 38 LYS n 1 39 MET n 1 40 LYS n 1 41 ARG n 1 42 VAL n 1 43 VAL n 1 44 GLN n 1 45 HIS n 1 46 THR n 1 47 LYS n 1 48 GLY n 1 49 CYS n 1 50 LYS n 1 51 ARG n 1 52 LYS n 1 53 THR n 1 54 ASN n 1 55 GLY n 1 56 GLY n 1 57 CYS n 1 58 PRO n 1 59 ILE n 1 60 CYS n 1 61 LYS n 1 62 GLN n 1 63 LEU n 1 64 ILE n 1 65 ALA n 1 66 LEU n 1 67 ALA n 1 68 ALA n 1 69 TYR n 1 70 HIS n 1 71 ALA n 1 72 LYS n 1 73 HIS n 1 74 CYS n 1 75 GLN n 1 76 GLU n 1 77 ASN n 1 78 LYS n 1 79 CYS n 1 80 PRO n 1 81 VAL n 1 82 PRO n 1 83 PHE n 1 84 CYS n 1 85 LEU n 1 86 ASN n 1 87 ILE n 1 88 LYS n 1 89 GLN n 1 90 LYS n 1 91 GLY n 1 92 GLY n 1 93 SER n 1 94 GLY n 1 95 GLY n 1 96 GLY n 1 97 THR n 1 98 GLY n 1 99 GLY n 1 100 GLY n 1 101 SER n 1 102 GLY n 1 103 THR n 1 104 ILE n 1 105 GLU n 1 106 GLY n 1 107 ARG n 1 108 GLY n 1 109 ASP n 1 110 GLY n 1 111 GLY n 1 112 THR n 1 113 THR n 1 114 PHE n 1 115 GLU n 1 116 HIS n 1 117 LEU n 1 118 TRP n 1 119 SER n 1 120 SER n 1 121 LEU n 1 122 GLU n 1 123 PRO n 1 124 ASP n 1 125 SER n 1 126 THR n 1 127 TYR n 1 128 PHE n 1 129 ASP n 1 130 LEU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 90 Human ? 'EP300, P300' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 91 130 Human ? 'TP73, P73' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 TRP 118 118 118 TRP TRP A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 LEU 130 130 130 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 300 ZN ZN A . C 2 ZN 1 202 400 ZN ZN A . D 2 ZN 1 203 500 ZN ZN A . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6FGS _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FGS _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FGS _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 6FGS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 6FGS _struct.title 'Solution structure of p300Taz2-p73TA1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FGS _struct_keywords.text 'p300, CREB Binding protein, p53 family, p63, p73, ANTITUMOR PROTEIN' _struct_keywords.pdbx_keywords 'ANTITUMOR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP EP300_HUMAN Q09472 ? 1 ;ATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCP VPFCLNIKQK ; 1723 2 UNP P73_HUMAN O15350 O15350-2 1 DGGTTFEHLWSSLEPDSTYFDL 10 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6FGS A 1 ? 90 ? Q09472 1723 ? 1812 ? 1 90 2 2 6FGS A 109 ? 130 ? O15350 10 ? 31 ? 109 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FGS ALA A 16 ? UNP Q09472 CYS 1738 conflict 16 1 1 6FGS ALA A 24 ? UNP Q09472 CYS 1746 conflict 24 2 1 6FGS ALA A 67 ? UNP Q09472 CYS 1789 conflict 67 3 1 6FGS ALA A 68 ? UNP Q09472 CYS 1790 conflict 68 4 1 6FGS GLY A 91 ? UNP Q09472 ? ? linker 91 5 1 6FGS GLY A 92 ? UNP Q09472 ? ? linker 92 6 1 6FGS SER A 93 ? UNP Q09472 ? ? linker 93 7 1 6FGS GLY A 94 ? UNP Q09472 ? ? linker 94 8 1 6FGS GLY A 95 ? UNP Q09472 ? ? linker 95 9 1 6FGS GLY A 96 ? UNP Q09472 ? ? linker 96 10 1 6FGS THR A 97 ? UNP Q09472 ? ? linker 97 11 1 6FGS GLY A 98 ? UNP Q09472 ? ? linker 98 12 1 6FGS GLY A 99 ? UNP Q09472 ? ? linker 99 13 1 6FGS GLY A 100 ? UNP Q09472 ? ? linker 100 14 1 6FGS SER A 101 ? UNP Q09472 ? ? linker 101 15 1 6FGS GLY A 102 ? UNP Q09472 ? ? linker 102 16 1 6FGS THR A 103 ? UNP Q09472 ? ? linker 103 17 1 6FGS ILE A 104 ? UNP Q09472 ? ? linker 104 18 1 6FGS GLU A 105 ? UNP Q09472 ? ? linker 105 19 1 6FGS GLY A 106 ? UNP Q09472 ? ? linker 106 20 1 6FGS ARG A 107 ? UNP Q09472 ? ? linker 107 21 1 6FGS GLY A 108 ? UNP Q09472 ? ? linker 108 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -39 ? 1 'SSA (A^2)' 9490 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 7 ? ALA A 24 ? ASP A 7 ALA A 24 1 ? 18 HELX_P HELX_P2 AA2 LEU A 33 ? LYS A 47 ? LEU A 33 LYS A 47 1 ? 15 HELX_P HELX_P3 AA3 GLY A 48 ? LYS A 50 ? GLY A 48 LYS A 50 5 ? 3 HELX_P HELX_P4 AA4 ARG A 51 ? GLY A 56 ? ARG A 51 GLY A 56 1 ? 6 HELX_P HELX_P5 AA5 CYS A 57 ? ALA A 71 ? CYS A 57 ALA A 71 1 ? 15 HELX_P HELX_P6 AA6 VAL A 81 ? GLY A 91 ? VAL A 81 GLY A 91 1 ? 11 HELX_P HELX_P7 AA7 THR A 112 ? LEU A 121 ? THR A 112 LEU A 121 5 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 22 A ZN 201 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc2 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 201 1_555 ? ? ? ? ? ? ? 2.212 ? ? metalc3 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.217 ? ? metalc4 metalc ? ? A CYS 36 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 36 A ZN 201 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc5 metalc ? ? A HIS 45 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 45 A ZN 202 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc6 metalc ? ? A CYS 49 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 49 A ZN 202 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc7 metalc ? ? A CYS 57 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 57 A ZN 202 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc8 metalc ? ? A CYS 60 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 60 A ZN 202 1_555 ? ? ? ? ? ? ? 2.375 ? ? metalc9 metalc ? ? A HIS 70 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 70 A ZN 203 1_555 ? ? ? ? ? ? ? 2.196 ? ? metalc10 metalc ? ? A CYS 74 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 74 A ZN 203 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc11 metalc ? ? A CYS 79 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 79 A ZN 203 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc12 metalc ? ? A CYS 84 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 84 A ZN 203 1_555 ? ? ? ? ? ? ? 2.380 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 100.2 ? 2 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 97.7 ? 3 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 118.1 ? 4 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 107.7 ? 5 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 124.0 ? 6 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 105.1 ? 7 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 86.7 ? 8 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 84.7 ? 9 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 161.7 ? 10 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 147.2 ? 11 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 91.2 ? 12 SG ? A CYS 57 ? A CYS 57 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 87.3 ? 13 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 SG ? A CYS 74 ? A CYS 74 ? 1_555 91.9 ? 14 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 SG ? A CYS 79 ? A CYS 79 ? 1_555 165.7 ? 15 SG ? A CYS 74 ? A CYS 74 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 SG ? A CYS 79 ? A CYS 79 ? 1_555 95.9 ? 16 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 SG ? A CYS 84 ? A CYS 84 ? 1_555 86.9 ? 17 SG ? A CYS 74 ? A CYS 74 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 SG ? A CYS 84 ? A CYS 84 ? 1_555 166.5 ? 18 SG ? A CYS 79 ? A CYS 79 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 SG ? A CYS 84 ? A CYS 84 ? 1_555 88.2 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 4 'binding site for residue ZN A 202' AC3 Software A ZN 203 ? 4 'binding site for residue ZN A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 22 ? HIS A 22 . ? 1_555 ? 2 AC1 4 CYS A 26 ? CYS A 26 . ? 1_555 ? 3 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 4 AC1 4 CYS A 36 ? CYS A 36 . ? 1_555 ? 5 AC2 4 HIS A 45 ? HIS A 45 . ? 1_555 ? 6 AC2 4 CYS A 49 ? CYS A 49 . ? 1_555 ? 7 AC2 4 CYS A 57 ? CYS A 57 . ? 1_555 ? 8 AC2 4 CYS A 60 ? CYS A 60 . ? 1_555 ? 9 AC3 4 HIS A 70 ? HIS A 70 . ? 1_555 ? 10 AC3 4 CYS A 74 ? CYS A 74 . ? 1_555 ? 11 AC3 4 CYS A 79 ? CYS A 79 . ? 1_555 ? 12 AC3 4 CYS A 84 ? CYS A 84 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 HG1 A THR 112 ? ? OE2 A GLU 115 ? ? 1.54 2 6 O A HIS 116 ? ? HG A SER 119 ? ? 1.56 3 10 HG1 A THR 112 ? ? OE2 A GLU 115 ? ? 1.57 4 11 HG1 A THR 112 ? ? OE2 A GLU 115 ? ? 1.55 5 13 HG1 A THR 112 ? ? OE2 A GLU 115 ? ? 1.53 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 7 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 51 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 51 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 51 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.03 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.27 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 78 ? ? -104.84 70.92 2 1 THR A 97 ? ? -69.74 0.91 3 1 ILE A 104 ? ? -97.47 -65.43 4 1 THR A 113 ? ? -39.35 -38.80 5 1 SER A 125 ? ? 27.66 53.38 6 1 THR A 126 ? ? -63.67 3.86 7 2 PRO A 5 ? ? -69.40 44.78 8 2 ASP A 7 ? ? -38.35 99.57 9 2 CYS A 26 ? ? -57.56 107.62 10 2 ASN A 54 ? ? -120.47 -51.87 11 2 GLN A 75 ? ? -70.67 -83.07 12 2 LYS A 78 ? ? -95.20 59.68 13 2 GLU A 105 ? ? -66.95 -178.34 14 2 PRO A 123 ? ? -72.39 39.37 15 2 SER A 125 ? ? 48.75 20.83 16 3 ASP A 7 ? ? -68.79 88.14 17 3 SER A 93 ? ? -60.98 3.84 18 3 SER A 125 ? ? -24.05 88.50 19 4 THR A 2 ? ? -140.32 -27.50 20 4 GLN A 3 ? ? -143.45 23.41 21 4 CYS A 26 ? ? -66.37 95.05 22 4 SER A 32 ? ? -160.65 97.25 23 4 ASN A 77 ? ? -72.04 32.57 24 4 THR A 97 ? ? -68.88 72.97 25 4 GLU A 105 ? ? -128.67 -163.22 26 4 ASP A 109 ? ? -7.26 90.28 27 4 SER A 125 ? ? 55.68 11.99 28 5 SER A 4 ? ? 60.68 153.82 29 5 ASP A 7 ? ? -83.00 39.24 30 5 LYS A 90 ? ? -85.90 38.73 31 5 THR A 97 ? ? 41.49 74.65 32 6 SER A 32 ? ? -161.67 96.22 33 6 CYS A 49 ? ? -65.41 97.68 34 6 CYS A 57 ? ? -40.26 153.92 35 6 LYS A 78 ? ? -118.65 53.41 36 6 TYR A 127 ? ? -104.15 -64.70 37 7 ASP A 7 ? ? -152.51 33.74 38 7 LYS A 78 ? ? -157.40 55.62 39 7 THR A 97 ? ? 59.02 13.80 40 7 SER A 101 ? ? -65.79 -179.97 41 7 PRO A 123 ? ? -64.75 0.06 42 7 SER A 125 ? ? 50.84 19.77 43 8 ASP A 7 ? ? -82.55 31.23 44 8 CYS A 26 ? ? -62.81 84.29 45 8 GLN A 75 ? ? -61.12 -74.32 46 8 PRO A 123 ? ? -66.04 3.23 47 8 SER A 125 ? ? 47.83 24.23 48 8 TYR A 127 ? ? -133.47 -41.93 49 9 SER A 4 ? ? 37.52 59.18 50 9 CYS A 26 ? ? -57.66 104.43 51 9 ASN A 54 ? ? -121.72 -55.50 52 9 LYS A 78 ? ? 72.24 96.52 53 9 THR A 97 ? ? -80.01 -96.80 54 9 SER A 101 ? ? -56.00 109.72 55 9 SER A 119 ? ? -66.92 3.10 56 9 PRO A 123 ? ? -72.41 25.46 57 9 SER A 125 ? ? 38.67 31.94 58 9 TYR A 127 ? ? -130.06 -63.16 59 10 CYS A 49 ? ? -66.82 94.44 60 10 GLN A 89 ? ? -68.10 0.38 61 10 SER A 101 ? ? 54.29 13.33 62 10 ILE A 104 ? ? -132.02 -31.27 63 10 GLU A 105 ? ? -132.75 -148.34 64 10 SER A 125 ? ? -54.45 69.24 65 10 THR A 126 ? ? -69.38 10.22 66 11 CYS A 26 ? ? -60.89 92.83 67 11 CYS A 49 ? ? -66.69 82.92 68 11 CYS A 57 ? ? -49.61 163.82 69 11 SER A 93 ? ? -54.83 -9.09 70 11 ARG A 107 ? ? 48.42 26.06 71 11 ASP A 109 ? ? -106.02 -169.20 72 12 THR A 2 ? ? -64.16 1.85 73 12 CYS A 26 ? ? -55.07 95.39 74 12 CYS A 57 ? ? -31.14 134.51 75 12 SER A 93 ? ? -84.73 -76.27 76 12 ASP A 109 ? ? -58.41 0.08 77 12 PRO A 123 ? ? -59.27 -5.78 78 12 SER A 125 ? ? 46.83 25.63 79 13 ASP A 7 ? ? -148.68 17.51 80 13 CYS A 26 ? ? -56.90 100.56 81 13 LYS A 78 ? ? -91.38 51.09 82 13 THR A 97 ? ? 49.75 29.58 83 13 GLU A 105 ? ? -110.95 -169.33 84 13 SER A 119 ? ? -68.70 7.89 85 13 PRO A 123 ? ? -65.23 4.11 86 13 SER A 125 ? ? 40.44 28.74 87 14 ASP A 7 ? ? -141.27 55.31 88 14 CYS A 26 ? ? -61.10 99.18 89 14 CYS A 49 ? ? -63.09 97.62 90 14 GLU A 105 ? ? -91.27 -149.54 91 14 THR A 126 ? ? -66.26 0.10 92 15 CYS A 26 ? ? -57.64 107.42 93 15 CYS A 57 ? ? -56.90 170.46 94 15 LYS A 78 ? ? -103.01 70.29 95 15 THR A 112 ? ? -96.29 39.98 96 15 SER A 125 ? ? -53.81 72.29 97 16 CYS A 26 ? ? -65.88 87.43 98 16 CYS A 49 ? ? -65.79 93.34 99 16 ARG A 107 ? ? -171.15 -167.59 100 16 ASP A 109 ? ? 48.63 8.89 101 16 THR A 112 ? ? -66.23 7.15 102 16 SER A 125 ? ? -36.21 97.80 103 17 CYS A 26 ? ? -67.09 79.00 104 17 CYS A 49 ? ? -64.93 64.16 105 17 ASN A 54 ? ? -120.05 -52.47 106 17 THR A 97 ? ? -54.76 10.67 107 17 ILE A 104 ? ? -136.50 -40.00 108 17 SER A 125 ? ? -48.72 84.64 109 17 THR A 126 ? ? -59.22 -7.23 110 18 THR A 2 ? ? -132.33 -67.29 111 18 SER A 4 ? ? 174.45 72.83 112 18 ASP A 7 ? ? -150.35 85.96 113 18 CYS A 49 ? ? -67.89 70.57 114 18 LYS A 78 ? ? -151.26 52.63 115 18 SER A 93 ? ? -74.89 32.02 116 18 THR A 113 ? ? -39.49 -30.68 117 18 SER A 125 ? ? 46.34 22.50 118 18 TYR A 127 ? ? -133.20 -49.00 119 19 CYS A 49 ? ? -62.42 99.74 120 19 ILE A 104 ? ? -138.32 -35.54 121 19 ARG A 107 ? ? 49.51 24.57 122 19 PRO A 123 ? ? -68.04 6.80 123 20 SER A 4 ? ? -152.28 -63.80 124 20 CYS A 26 ? ? -50.45 104.25 125 20 ASN A 54 ? ? -75.82 26.80 126 20 SER A 93 ? ? -63.14 -72.32 127 20 ARG A 107 ? ? -53.53 108.88 128 20 THR A 112 ? ? 47.22 25.65 129 20 SER A 125 ? ? 14.52 74.44 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 69 ? ? 0.072 'SIDE CHAIN' 2 2 GLU A 76 ? ? 0.082 'SIDE CHAIN' 3 2 GLU A 105 ? ? 0.078 'SIDE CHAIN' 4 2 ASP A 129 ? ? 0.088 'SIDE CHAIN' 5 4 ASP A 7 ? ? 0.070 'SIDE CHAIN' 6 5 ASP A 7 ? ? 0.076 'SIDE CHAIN' 7 5 ARG A 107 ? ? 0.124 'SIDE CHAIN' 8 5 GLU A 115 ? ? 0.074 'SIDE CHAIN' 9 5 ASP A 129 ? ? 0.073 'SIDE CHAIN' 10 7 ASP A 7 ? ? 0.080 'SIDE CHAIN' 11 7 ARG A 9 ? ? 0.093 'SIDE CHAIN' 12 7 TYR A 69 ? ? 0.078 'SIDE CHAIN' 13 7 ASP A 129 ? ? 0.081 'SIDE CHAIN' 14 8 ASP A 7 ? ? 0.069 'SIDE CHAIN' 15 8 TYR A 69 ? ? 0.070 'SIDE CHAIN' 16 9 ARG A 9 ? ? 0.115 'SIDE CHAIN' 17 10 GLU A 105 ? ? 0.077 'SIDE CHAIN' 18 10 ASP A 129 ? ? 0.077 'SIDE CHAIN' 19 12 ASP A 129 ? ? 0.082 'SIDE CHAIN' 20 13 ASP A 129 ? ? 0.070 'SIDE CHAIN' 21 16 TYR A 69 ? ? 0.084 'SIDE CHAIN' 22 16 ASP A 129 ? ? 0.106 'SIDE CHAIN' 23 17 ARG A 9 ? ? 0.088 'SIDE CHAIN' 24 17 TYR A 69 ? ? 0.079 'SIDE CHAIN' 25 17 ASP A 129 ? ? 0.120 'SIDE CHAIN' 26 18 GLU A 105 ? ? 0.070 'SIDE CHAIN' 27 18 ASP A 124 ? ? 0.081 'SIDE CHAIN' 28 19 ASP A 109 ? ? 0.075 'SIDE CHAIN' 29 19 PHE A 114 ? ? 0.088 'SIDE CHAIN' 30 20 GLU A 115 ? ? 0.071 'SIDE CHAIN' # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 9 ASN A 54 ? ? -11.06 2 11 LYS A 50 ? ? -10.88 3 13 LYS A 50 ? ? -10.61 4 19 PHE A 128 ? ? 10.46 # _pdbx_nmr_ensemble.entry_id 6FGS _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6FGS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;700 uM [U-13C; U-15N] Fusion construct of p300 Taz2 and the transactivation domain 1 of p73, 25 mM MES, 50 mM NaCl, 0.5 mM TCEP, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 13C15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Fusion construct of p300 Taz2 and the transactivation domain 1 of p73' 700 ? uM '[U-13C; U-15N]' 1 MES 25 ? mM 'natural abundance' 1 NaCl 50 ? mM 'natural abundance' 1 TCEP 0.5 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units mbar _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 8 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 9 isotropic 3 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D HN(COCA)CB' 2 isotropic 9 1 1 '2D 1H-15N HSQC' 2 isotropic 8 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 7 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 6 1 1 '[13Cmethyl,1H]-SOFAST-HMQC-NOESY-[13Carom,1H]-HMQC' 2 isotropic 11 1 1 '3D H(CCO)NH' 2 isotropic 10 1 1 '3D C(CO)NH' 2 isotropic # _pdbx_nmr_refine.entry_id 6FGS _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' Sparky 3.114 'T. D. Goddard and D. G. Kneller' 2 'structure calculation' CYANA 3.9 'Guntert, Mumenthaler and Wuthrich' 3 refinement OPAL ? 'Luginbuhl, Guntert, Billeter and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Deutsche Fortschungsgemeinschaft' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 'DO 545/13 1' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVNCE III' ? Bruker 600 ? 2 'AVANCE III HD' ? Bruker 700 ? 9 'AVANCE III HD' ? Bruker 800 ? 8 'AVANCE II' ? Bruker 950 ? # _atom_sites.entry_id 6FGS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_