data_6FGV # _entry.id 6FGV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FGV pdb_00006fgv 10.2210/pdb6fgv/pdb WWPDB D_1200008179 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-30 2 'Structure model' 1 1 2018-08-29 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FGV _pdbx_database_status.recvd_initial_deposition_date 2018-01-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6FG6 unspecified PDB . 6FGF unspecified PDB . 6FGG unspecified PDB . 6FGH unspecified PDB . 6FGI unspecified PDB . 6FGT unspecified PDB . 6FGU unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dalle Vedove, A.' 1 0000-0001-5127-7737 'Spiliotopoulos, D.' 2 ? 'Lolli, G.' 3 ? 'Caflisch, A.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev ChemMedChem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1860-7187 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 1479 _citation.page_last 1487 _citation.title 'Structural Analysis of Small-Molecule Binding to the BAZ2A and BAZ2B Bromodomains.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cmdc.201800234 _citation.pdbx_database_id_PubMed 29770599 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dalle Vedove, A.' 1 ? primary 'Spiliotopoulos, D.' 2 ? primary ;D'Agostino, V.G. ; 3 ? primary 'Marchand, J.R.' 4 ? primary 'Unzue, A.' 5 ? primary 'Nevado, C.' 6 ? primary 'Lolli, G.' 7 0000-0002-8536-5599 primary 'Caflisch, A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain adjacent to zinc finger domain protein 2A' 12509.048 1 ? ? ? ? 2 non-polymer syn '~{N}-[(1-azanylcyclohexyl)methyl]-1-methyl-6-oxidanylidene-pyridine-3-carboxamide' 263.335 1 ? ? ? ? 3 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Transcription termination factor I-interacting protein 5,Tip5,hWALp3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFN EDDSEVGKAGHIMRRFFESRWEEFYQ ; _entity_poly.pdbx_seq_one_letter_code_can ;SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFN EDDSEVGKAGHIMRRFFESRWEEFYQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[(1-azanylcyclohexyl)methyl]-1-methyl-6-oxidanylidene-pyridine-3-carboxamide' D9T 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 HIS n 1 4 SER n 1 5 ASP n 1 6 LEU n 1 7 THR n 1 8 PHE n 1 9 CYS n 1 10 GLU n 1 11 ILE n 1 12 ILE n 1 13 LEU n 1 14 MET n 1 15 GLU n 1 16 MET n 1 17 GLU n 1 18 SER n 1 19 HIS n 1 20 ASP n 1 21 ALA n 1 22 ALA n 1 23 TRP n 1 24 PRO n 1 25 PHE n 1 26 LEU n 1 27 GLU n 1 28 PRO n 1 29 VAL n 1 30 ASN n 1 31 PRO n 1 32 ARG n 1 33 LEU n 1 34 VAL n 1 35 SER n 1 36 GLY n 1 37 TYR n 1 38 ARG n 1 39 ARG n 1 40 ILE n 1 41 ILE n 1 42 LYS n 1 43 ASN n 1 44 PRO n 1 45 MET n 1 46 ASP n 1 47 PHE n 1 48 SER n 1 49 THR n 1 50 MET n 1 51 ARG n 1 52 GLU n 1 53 ARG n 1 54 LEU n 1 55 LEU n 1 56 ARG n 1 57 GLY n 1 58 GLY n 1 59 TYR n 1 60 THR n 1 61 SER n 1 62 SER n 1 63 GLU n 1 64 GLU n 1 65 PHE n 1 66 ALA n 1 67 ALA n 1 68 ASP n 1 69 ALA n 1 70 LEU n 1 71 LEU n 1 72 VAL n 1 73 PHE n 1 74 ASP n 1 75 ASN n 1 76 CYS n 1 77 GLN n 1 78 THR n 1 79 PHE n 1 80 ASN n 1 81 GLU n 1 82 ASP n 1 83 ASP n 1 84 SER n 1 85 GLU n 1 86 VAL n 1 87 GLY n 1 88 LYS n 1 89 ALA n 1 90 GLY n 1 91 HIS n 1 92 ILE n 1 93 MET n 1 94 ARG n 1 95 ARG n 1 96 PHE n 1 97 PHE n 1 98 GLU n 1 99 SER n 1 100 ARG n 1 101 TRP n 1 102 GLU n 1 103 GLU n 1 104 PHE n 1 105 TYR n 1 106 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 106 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BAZ2A, KIAA0314, TIP5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 D9T non-polymer . '~{N}-[(1-azanylcyclohexyl)methyl]-1-methyl-6-oxidanylidene-pyridine-3-carboxamide' ? 'C14 H21 N3 O2' 263.335 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1794 ? ? ? A . n A 1 2 MET 2 1795 ? ? ? A . n A 1 3 HIS 3 1796 1796 HIS HIS A . n A 1 4 SER 4 1797 1797 SER SER A . n A 1 5 ASP 5 1798 1798 ASP ASP A . n A 1 6 LEU 6 1799 1799 LEU LEU A . n A 1 7 THR 7 1800 1800 THR THR A . n A 1 8 PHE 8 1801 1801 PHE PHE A . n A 1 9 CYS 9 1802 1802 CYS CYS A . n A 1 10 GLU 10 1803 1803 GLU GLU A . n A 1 11 ILE 11 1804 1804 ILE ILE A . n A 1 12 ILE 12 1805 1805 ILE ILE A . n A 1 13 LEU 13 1806 1806 LEU LEU A . n A 1 14 MET 14 1807 1807 MET MET A . n A 1 15 GLU 15 1808 1808 GLU GLU A . n A 1 16 MET 16 1809 1809 MET MET A . n A 1 17 GLU 17 1810 1810 GLU GLU A . n A 1 18 SER 18 1811 1811 SER SER A . n A 1 19 HIS 19 1812 1812 HIS HIS A . n A 1 20 ASP 20 1813 1813 ASP ASP A . n A 1 21 ALA 21 1814 1814 ALA ALA A . n A 1 22 ALA 22 1815 1815 ALA ALA A . n A 1 23 TRP 23 1816 1816 TRP TRP A . n A 1 24 PRO 24 1817 1817 PRO PRO A . n A 1 25 PHE 25 1818 1818 PHE PHE A . n A 1 26 LEU 26 1819 1819 LEU LEU A . n A 1 27 GLU 27 1820 1820 GLU GLU A . n A 1 28 PRO 28 1821 1821 PRO PRO A . n A 1 29 VAL 29 1822 1822 VAL VAL A . n A 1 30 ASN 30 1823 1823 ASN ASN A . n A 1 31 PRO 31 1824 1824 PRO PRO A . n A 1 32 ARG 32 1825 1825 ARG ARG A . n A 1 33 LEU 33 1826 1826 LEU LEU A . n A 1 34 VAL 34 1827 1827 VAL VAL A . n A 1 35 SER 35 1828 1828 SER SER A . n A 1 36 GLY 36 1829 1829 GLY GLY A . n A 1 37 TYR 37 1830 1830 TYR TYR A . n A 1 38 ARG 38 1831 1831 ARG ARG A . n A 1 39 ARG 39 1832 1832 ARG ARG A . n A 1 40 ILE 40 1833 1833 ILE ILE A . n A 1 41 ILE 41 1834 1834 ILE ILE A . n A 1 42 LYS 42 1835 1835 LYS LYS A . n A 1 43 ASN 43 1836 1836 ASN ASN A . n A 1 44 PRO 44 1837 1837 PRO PRO A . n A 1 45 MET 45 1838 1838 MET MET A . n A 1 46 ASP 46 1839 1839 ASP ASP A . n A 1 47 PHE 47 1840 1840 PHE PHE A . n A 1 48 SER 48 1841 1841 SER SER A . n A 1 49 THR 49 1842 1842 THR THR A . n A 1 50 MET 50 1843 1843 MET MET A . n A 1 51 ARG 51 1844 1844 ARG ARG A . n A 1 52 GLU 52 1845 1845 GLU GLU A . n A 1 53 ARG 53 1846 1846 ARG ARG A . n A 1 54 LEU 54 1847 1847 LEU LEU A . n A 1 55 LEU 55 1848 1848 LEU LEU A . n A 1 56 ARG 56 1849 1849 ARG ARG A . n A 1 57 GLY 57 1850 1850 GLY GLY A . n A 1 58 GLY 58 1851 1851 GLY GLY A . n A 1 59 TYR 59 1852 1852 TYR TYR A . n A 1 60 THR 60 1853 1853 THR THR A . n A 1 61 SER 61 1854 1854 SER SER A . n A 1 62 SER 62 1855 1855 SER SER A . n A 1 63 GLU 63 1856 1856 GLU GLU A . n A 1 64 GLU 64 1857 1857 GLU GLU A . n A 1 65 PHE 65 1858 1858 PHE PHE A . n A 1 66 ALA 66 1859 1859 ALA ALA A . n A 1 67 ALA 67 1860 1860 ALA ALA A . n A 1 68 ASP 68 1861 1861 ASP ASP A . n A 1 69 ALA 69 1862 1862 ALA ALA A . n A 1 70 LEU 70 1863 1863 LEU LEU A . n A 1 71 LEU 71 1864 1864 LEU LEU A . n A 1 72 VAL 72 1865 1865 VAL VAL A . n A 1 73 PHE 73 1866 1866 PHE PHE A . n A 1 74 ASP 74 1867 1867 ASP ASP A . n A 1 75 ASN 75 1868 1868 ASN ASN A . n A 1 76 CYS 76 1869 1869 CYS CYS A . n A 1 77 GLN 77 1870 1870 GLN GLN A . n A 1 78 THR 78 1871 1871 THR THR A . n A 1 79 PHE 79 1872 1872 PHE PHE A . n A 1 80 ASN 80 1873 1873 ASN ASN A . n A 1 81 GLU 81 1874 1874 GLU GLU A . n A 1 82 ASP 82 1875 1875 ASP ASP A . n A 1 83 ASP 83 1876 1876 ASP ASP A . n A 1 84 SER 84 1877 1877 SER SER A . n A 1 85 GLU 85 1878 1878 GLU GLU A . n A 1 86 VAL 86 1879 1879 VAL VAL A . n A 1 87 GLY 87 1880 1880 GLY GLY A . n A 1 88 LYS 88 1881 1881 LYS LYS A . n A 1 89 ALA 89 1882 1882 ALA ALA A . n A 1 90 GLY 90 1883 1883 GLY GLY A . n A 1 91 HIS 91 1884 1884 HIS HIS A . n A 1 92 ILE 92 1885 1885 ILE ILE A . n A 1 93 MET 93 1886 1886 MET MET A . n A 1 94 ARG 94 1887 1887 ARG ARG A . n A 1 95 ARG 95 1888 1888 ARG ARG A . n A 1 96 PHE 96 1889 1889 PHE PHE A . n A 1 97 PHE 97 1890 1890 PHE PHE A . n A 1 98 GLU 98 1891 1891 GLU GLU A . n A 1 99 SER 99 1892 1892 SER SER A . n A 1 100 ARG 100 1893 1893 ARG ARG A . n A 1 101 TRP 101 1894 1894 TRP TRP A . n A 1 102 GLU 102 1895 1895 GLU GLU A . n A 1 103 GLU 103 1896 1896 GLU GLU A . n A 1 104 PHE 104 1897 1897 PHE PHE A . n A 1 105 TYR 105 1898 1898 TYR TYR A . n A 1 106 GLN 106 1899 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 D9T 1 1901 1 D9T LIG A . C 3 HOH 1 2001 14 HOH HOH A . C 3 HOH 2 2002 12 HOH HOH A . C 3 HOH 3 2003 4 HOH HOH A . C 3 HOH 4 2004 18 HOH HOH A . C 3 HOH 5 2005 3 HOH HOH A . C 3 HOH 6 2006 7 HOH HOH A . C 3 HOH 7 2007 5 HOH HOH A . C 3 HOH 8 2008 15 HOH HOH A . C 3 HOH 9 2009 11 HOH HOH A . C 3 HOH 10 2010 6 HOH HOH A . C 3 HOH 11 2011 9 HOH HOH A . C 3 HOH 12 2012 8 HOH HOH A . C 3 HOH 13 2013 2 HOH HOH A . C 3 HOH 14 2014 1 HOH HOH A . C 3 HOH 15 2015 19 HOH HOH A . C 3 HOH 16 2016 16 HOH HOH A . C 3 HOH 17 2017 24 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6FGV _cell.details ? _cell.formula_units_Z ? _cell.length_a 94.786 _cell.length_a_esd ? _cell.length_b 94.786 _cell.length_b_esd ? _cell.length_c 32.780 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FGV _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FGV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG3350, 0.2 M MgCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ELETTRA BEAMLINE 5.2R' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.2R _diffrn_source.pdbx_synchrotron_site ELETTRA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6FGV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 47.393 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6042 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.1 _reflns.pdbx_Rmerge_I_obs 0.106 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.112 _reflns.pdbx_Rpim_I_all 0.035 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.60 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 654 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.354 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.435 _reflns_shell.pdbx_Rpim_I_all 0.470 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.875 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FGV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 47.393 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6013 _refine.ls_number_reflns_R_free 305 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.67 _refine.ls_percent_reflns_R_free 5.07 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2302 _refine.ls_R_factor_R_free 0.2664 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2282 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5MGJ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.22 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 853 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 889 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 47.393 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 895 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.650 ? 1207 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 22.011 ? 526 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 120 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 158 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5001 3.1498 . . 136 2820 100.00 . . . 0.3777 . 0.2982 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1498 47.4015 . . 169 2888 100.00 . . . 0.2424 . 0.2092 . . . . . . . . . . # _struct.entry_id 6FGV _struct.title 'Crystal Structure of BAZ2A bromodomain in complex with 1-methylpyridinone compound 3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FGV _struct_keywords.text 'four helical bundle, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAZ2A_HUMAN _struct_ref.pdbx_db_accession Q9UIF9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNED DSEVGKAGHIMRRFFESRWEEFYQ ; _struct_ref.pdbx_align_begin 1796 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FGV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UIF9 _struct_ref_seq.db_align_beg 1796 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1899 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1796 _struct_ref_seq.pdbx_auth_seq_align_end 1899 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FGV SER A 1 ? UNP Q9UIF9 ? ? 'expression tag' 1794 1 1 6FGV MET A 2 ? UNP Q9UIF9 ? ? 'expression tag' 1795 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6340 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 3 ? HIS A 19 ? HIS A 1796 HIS A 1812 1 ? 17 HELX_P HELX_P2 AA2 ASP A 20 ? LEU A 26 ? ASP A 1813 LEU A 1819 5 ? 7 HELX_P HELX_P3 AA3 GLY A 36 ? ILE A 41 ? GLY A 1829 ILE A 1834 1 ? 6 HELX_P HELX_P4 AA4 ASP A 46 ? ARG A 56 ? ASP A 1839 ARG A 1849 1 ? 11 HELX_P HELX_P5 AA5 SER A 61 ? ASN A 80 ? SER A 1854 ASN A 1873 1 ? 20 HELX_P HELX_P6 AA6 SER A 84 ? TYR A 105 ? SER A 1877 TYR A 1898 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id D9T _struct_site.pdbx_auth_seq_id 1901 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue D9T A 1901' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 PRO A 24 ? PRO A 1817 . ? 1_555 ? 2 AC1 6 VAL A 29 ? VAL A 1822 . ? 1_555 ? 3 AC1 6 TYR A 37 ? TYR A 1830 . ? 1_555 ? 4 AC1 6 ASN A 80 ? ASN A 1873 . ? 1_555 ? 5 AC1 6 VAL A 86 ? VAL A 1879 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 2005 . ? 1_555 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1794 ? A SER 1 2 1 Y 1 A MET 1795 ? A MET 2 3 1 Y 1 A GLN 1899 ? A GLN 106 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 D9T C13 C N N 88 D9T C15 C N N 89 D9T C17 C N N 90 D9T C01 C N N 91 D9T C03 C N N 92 D9T C04 C N N 93 D9T C05 C N N 94 D9T C06 C N N 95 D9T C07 C N N 96 D9T C09 C N N 97 D9T C12 C N N 98 D9T C16 C N N 99 D9T C18 C N N 100 D9T C19 C N N 101 D9T N02 N N N 102 D9T N11 N N N 103 D9T N14 N N N 104 D9T O08 O N N 105 D9T O10 O N N 106 D9T H1 H N N 107 D9T H2 H N N 108 D9T H3 H N N 109 D9T H4 H N N 110 D9T H5 H N N 111 D9T H6 H N N 112 D9T H7 H N N 113 D9T H8 H N N 114 D9T H9 H N N 115 D9T H10 H N N 116 D9T H11 H N N 117 D9T H12 H N N 118 D9T H13 H N N 119 D9T H14 H N N 120 D9T H15 H N N 121 D9T H16 H N N 122 D9T H17 H N N 123 D9T H18 H N N 124 D9T H19 H N N 125 D9T H20 H N N 126 D9T H21 H N N 127 GLN N N N N 128 GLN CA C N S 129 GLN C C N N 130 GLN O O N N 131 GLN CB C N N 132 GLN CG C N N 133 GLN CD C N N 134 GLN OE1 O N N 135 GLN NE2 N N N 136 GLN OXT O N N 137 GLN H H N N 138 GLN H2 H N N 139 GLN HA H N N 140 GLN HB2 H N N 141 GLN HB3 H N N 142 GLN HG2 H N N 143 GLN HG3 H N N 144 GLN HE21 H N N 145 GLN HE22 H N N 146 GLN HXT H N N 147 GLU N N N N 148 GLU CA C N S 149 GLU C C N N 150 GLU O O N N 151 GLU CB C N N 152 GLU CG C N N 153 GLU CD C N N 154 GLU OE1 O N N 155 GLU OE2 O N N 156 GLU OXT O N N 157 GLU H H N N 158 GLU H2 H N N 159 GLU HA H N N 160 GLU HB2 H N N 161 GLU HB3 H N N 162 GLU HG2 H N N 163 GLU HG3 H N N 164 GLU HE2 H N N 165 GLU HXT H N N 166 GLY N N N N 167 GLY CA C N N 168 GLY C C N N 169 GLY O O N N 170 GLY OXT O N N 171 GLY H H N N 172 GLY H2 H N N 173 GLY HA2 H N N 174 GLY HA3 H N N 175 GLY HXT H N N 176 HIS N N N N 177 HIS CA C N S 178 HIS C C N N 179 HIS O O N N 180 HIS CB C N N 181 HIS CG C Y N 182 HIS ND1 N Y N 183 HIS CD2 C Y N 184 HIS CE1 C Y N 185 HIS NE2 N Y N 186 HIS OXT O N N 187 HIS H H N N 188 HIS H2 H N N 189 HIS HA H N N 190 HIS HB2 H N N 191 HIS HB3 H N N 192 HIS HD1 H N N 193 HIS HD2 H N N 194 HIS HE1 H N N 195 HIS HE2 H N N 196 HIS HXT H N N 197 HOH O O N N 198 HOH H1 H N N 199 HOH H2 H N N 200 ILE N N N N 201 ILE CA C N S 202 ILE C C N N 203 ILE O O N N 204 ILE CB C N S 205 ILE CG1 C N N 206 ILE CG2 C N N 207 ILE CD1 C N N 208 ILE OXT O N N 209 ILE H H N N 210 ILE H2 H N N 211 ILE HA H N N 212 ILE HB H N N 213 ILE HG12 H N N 214 ILE HG13 H N N 215 ILE HG21 H N N 216 ILE HG22 H N N 217 ILE HG23 H N N 218 ILE HD11 H N N 219 ILE HD12 H N N 220 ILE HD13 H N N 221 ILE HXT H N N 222 LEU N N N N 223 LEU CA C N S 224 LEU C C N N 225 LEU O O N N 226 LEU CB C N N 227 LEU CG C N N 228 LEU CD1 C N N 229 LEU CD2 C N N 230 LEU OXT O N N 231 LEU H H N N 232 LEU H2 H N N 233 LEU HA H N N 234 LEU HB2 H N N 235 LEU HB3 H N N 236 LEU HG H N N 237 LEU HD11 H N N 238 LEU HD12 H N N 239 LEU HD13 H N N 240 LEU HD21 H N N 241 LEU HD22 H N N 242 LEU HD23 H N N 243 LEU HXT H N N 244 LYS N N N N 245 LYS CA C N S 246 LYS C C N N 247 LYS O O N N 248 LYS CB C N N 249 LYS CG C N N 250 LYS CD C N N 251 LYS CE C N N 252 LYS NZ N N N 253 LYS OXT O N N 254 LYS H H N N 255 LYS H2 H N N 256 LYS HA H N N 257 LYS HB2 H N N 258 LYS HB3 H N N 259 LYS HG2 H N N 260 LYS HG3 H N N 261 LYS HD2 H N N 262 LYS HD3 H N N 263 LYS HE2 H N N 264 LYS HE3 H N N 265 LYS HZ1 H N N 266 LYS HZ2 H N N 267 LYS HZ3 H N N 268 LYS HXT H N N 269 MET N N N N 270 MET CA C N S 271 MET C C N N 272 MET O O N N 273 MET CB C N N 274 MET CG C N N 275 MET SD S N N 276 MET CE C N N 277 MET OXT O N N 278 MET H H N N 279 MET H2 H N N 280 MET HA H N N 281 MET HB2 H N N 282 MET HB3 H N N 283 MET HG2 H N N 284 MET HG3 H N N 285 MET HE1 H N N 286 MET HE2 H N N 287 MET HE3 H N N 288 MET HXT H N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 D9T O10 C09 doub N N 83 D9T C09 N11 sing N N 84 D9T C09 C04 sing N N 85 D9T N14 C13 sing N N 86 D9T C12 N11 sing N N 87 D9T C12 C13 sing N N 88 D9T C04 C03 doub N N 89 D9T C04 C05 sing N N 90 D9T C03 N02 sing N N 91 D9T C15 C13 sing N N 92 D9T C15 C16 sing N N 93 D9T C05 C06 doub N N 94 D9T C13 C19 sing N N 95 D9T N02 C01 sing N N 96 D9T N02 C07 sing N N 97 D9T C06 C07 sing N N 98 D9T C07 O08 doub N N 99 D9T C16 C17 sing N N 100 D9T C19 C18 sing N N 101 D9T C17 C18 sing N N 102 D9T C15 H1 sing N N 103 D9T C15 H2 sing N N 104 D9T C17 H3 sing N N 105 D9T C17 H4 sing N N 106 D9T C01 H5 sing N N 107 D9T C01 H6 sing N N 108 D9T C01 H7 sing N N 109 D9T C03 H8 sing N N 110 D9T C05 H9 sing N N 111 D9T C06 H10 sing N N 112 D9T C12 H11 sing N N 113 D9T C12 H12 sing N N 114 D9T C16 H13 sing N N 115 D9T C16 H14 sing N N 116 D9T C18 H15 sing N N 117 D9T C18 H16 sing N N 118 D9T C19 H17 sing N N 119 D9T C19 H18 sing N N 120 D9T N11 H19 sing N N 121 D9T N14 H20 sing N N 122 D9T N14 H21 sing N N 123 GLN N CA sing N N 124 GLN N H sing N N 125 GLN N H2 sing N N 126 GLN CA C sing N N 127 GLN CA CB sing N N 128 GLN CA HA sing N N 129 GLN C O doub N N 130 GLN C OXT sing N N 131 GLN CB CG sing N N 132 GLN CB HB2 sing N N 133 GLN CB HB3 sing N N 134 GLN CG CD sing N N 135 GLN CG HG2 sing N N 136 GLN CG HG3 sing N N 137 GLN CD OE1 doub N N 138 GLN CD NE2 sing N N 139 GLN NE2 HE21 sing N N 140 GLN NE2 HE22 sing N N 141 GLN OXT HXT sing N N 142 GLU N CA sing N N 143 GLU N H sing N N 144 GLU N H2 sing N N 145 GLU CA C sing N N 146 GLU CA CB sing N N 147 GLU CA HA sing N N 148 GLU C O doub N N 149 GLU C OXT sing N N 150 GLU CB CG sing N N 151 GLU CB HB2 sing N N 152 GLU CB HB3 sing N N 153 GLU CG CD sing N N 154 GLU CG HG2 sing N N 155 GLU CG HG3 sing N N 156 GLU CD OE1 doub N N 157 GLU CD OE2 sing N N 158 GLU OE2 HE2 sing N N 159 GLU OXT HXT sing N N 160 GLY N CA sing N N 161 GLY N H sing N N 162 GLY N H2 sing N N 163 GLY CA C sing N N 164 GLY CA HA2 sing N N 165 GLY CA HA3 sing N N 166 GLY C O doub N N 167 GLY C OXT sing N N 168 GLY OXT HXT sing N N 169 HIS N CA sing N N 170 HIS N H sing N N 171 HIS N H2 sing N N 172 HIS CA C sing N N 173 HIS CA CB sing N N 174 HIS CA HA sing N N 175 HIS C O doub N N 176 HIS C OXT sing N N 177 HIS CB CG sing N N 178 HIS CB HB2 sing N N 179 HIS CB HB3 sing N N 180 HIS CG ND1 sing Y N 181 HIS CG CD2 doub Y N 182 HIS ND1 CE1 doub Y N 183 HIS ND1 HD1 sing N N 184 HIS CD2 NE2 sing Y N 185 HIS CD2 HD2 sing N N 186 HIS CE1 NE2 sing Y N 187 HIS CE1 HE1 sing N N 188 HIS NE2 HE2 sing N N 189 HIS OXT HXT sing N N 190 HOH O H1 sing N N 191 HOH O H2 sing N N 192 ILE N CA sing N N 193 ILE N H sing N N 194 ILE N H2 sing N N 195 ILE CA C sing N N 196 ILE CA CB sing N N 197 ILE CA HA sing N N 198 ILE C O doub N N 199 ILE C OXT sing N N 200 ILE CB CG1 sing N N 201 ILE CB CG2 sing N N 202 ILE CB HB sing N N 203 ILE CG1 CD1 sing N N 204 ILE CG1 HG12 sing N N 205 ILE CG1 HG13 sing N N 206 ILE CG2 HG21 sing N N 207 ILE CG2 HG22 sing N N 208 ILE CG2 HG23 sing N N 209 ILE CD1 HD11 sing N N 210 ILE CD1 HD12 sing N N 211 ILE CD1 HD13 sing N N 212 ILE OXT HXT sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'Swiss National Science Foundation' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number 31003A_169007 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id D9T _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id D9T _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5MGJ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6FGV _atom_sites.fract_transf_matrix[1][1] 0.010550 _atom_sites.fract_transf_matrix[1][2] 0.006091 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012182 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030506 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_