data_6FX6 # _entry.id 6FX6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.302 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6FX6 WWPDB D_1200009080 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 6FWV PDB . unspecified 6FWY PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FX6 _pdbx_database_status.recvd_initial_deposition_date 2018-03-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Miller, O.K.' 1 0000-0003-2486-7680 'Banfield, M.J.' 2 0000-0001-8921-3835 'Schwarz-Linek, U.' 3 0000-0003-0526-223X # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Protein Sci.' PRCIEI 0795 1469-896X ? ? 27 ? 1651 1660 'A new structural class of bacterial thioester domains reveals a slipknot topology.' 2018 ? 10.1002/pro.3478 30052296 ? ? ? ? ? ? ? ? US ? ? 1 Elife ? ? 2050-084X ? ? 4 ? ? ? 'An internal thioester in a pathogen surface protein mediates covalent host binding.' 2015 ? 10.7554/eLife.06638 26032562 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miller, O.K.' 1 ? primary 'Banfield, M.J.' 2 ? primary 'Schwarz-Linek, U.' 3 0000-0003-0526-223X 1 'Walden, M.' 4 ? 1 'Edwards, J.M.' 5 ? 1 'Dziewulska, A.M.' 6 ? 1 'Bergmann, R.' 7 ? 1 'Saalbach, G.' 8 ? 1 'Kan, S.Y.' 9 ? 1 'Miller, O.K.' 10 ? 1 'Weckener, M.' 11 ? 1 'Jackson, R.J.' 12 ? 1 'Shirran, S.L.' 13 ? 1 'Botting, C.H.' 14 ? 1 'Florence, G.J.' 15 ? 1 'Rohde, M.' 16 ? 1 'Banfield, M.J.' 17 ? 1 'Schwarz-Linek, U.' 18 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6FX6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.029 _cell.length_a_esd ? _cell.length_b 73.612 _cell.length_b_esd ? _cell.length_c 74.651 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FX6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man SaTIE-TED 28479.908 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 2 ? ? ? ? 4 water nat water 18.015 61 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GA(MSE)AQQKLDVKWIDKGINWIVYSAKDRENFT(MSE)DRWAKFYVNGEIAFCIEPNKEAAIGAVHTGANLDTLFKDQ ALRNKLT(MSE)ISHFGYIANKDQSDEQYIATQ(MSE)LIWELLGAKYHTIYNGLNYEARKADILKSVKEAEQRASFHKQ KKPIKVGEKGVFVDTNNTLSNVKGIRTPSGVNAKIEGNKLIVTADKNAPDNATIHLDRITIVGTPLVYTSGNAQKVGVLK PFDPLDSWLTLQVIKNGNVKIIKEDTETG ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMAQQKLDVKWIDKGINWIVYSAKDRENFTMDRWAKFYVNGEIAFCIEPNKEAAIGAVHTGANLDTLFKDQALRNKLTM ISHFGYIANKDQSDEQYIATQMLIWELLGAKYHTIYNGLNYEARKADILKSVKEAEQRASFHKQKKPIKVGEKGVFVDTN NTLSNVKGIRTPSGVNAKIEGNKLIVTADKNAPDNATIHLDRITIVGTPLVYTSGNAQKVGVLKPFDPLDSWLTLQVIKN GNVKIIKEDTETG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MSE n 1 4 ALA n 1 5 GLN n 1 6 GLN n 1 7 LYS n 1 8 LEU n 1 9 ASP n 1 10 VAL n 1 11 LYS n 1 12 TRP n 1 13 ILE n 1 14 ASP n 1 15 LYS n 1 16 GLY n 1 17 ILE n 1 18 ASN n 1 19 TRP n 1 20 ILE n 1 21 VAL n 1 22 TYR n 1 23 SER n 1 24 ALA n 1 25 LYS n 1 26 ASP n 1 27 ARG n 1 28 GLU n 1 29 ASN n 1 30 PHE n 1 31 THR n 1 32 MSE n 1 33 ASP n 1 34 ARG n 1 35 TRP n 1 36 ALA n 1 37 LYS n 1 38 PHE n 1 39 TYR n 1 40 VAL n 1 41 ASN n 1 42 GLY n 1 43 GLU n 1 44 ILE n 1 45 ALA n 1 46 PHE n 1 47 CYS n 1 48 ILE n 1 49 GLU n 1 50 PRO n 1 51 ASN n 1 52 LYS n 1 53 GLU n 1 54 ALA n 1 55 ALA n 1 56 ILE n 1 57 GLY n 1 58 ALA n 1 59 VAL n 1 60 HIS n 1 61 THR n 1 62 GLY n 1 63 ALA n 1 64 ASN n 1 65 LEU n 1 66 ASP n 1 67 THR n 1 68 LEU n 1 69 PHE n 1 70 LYS n 1 71 ASP n 1 72 GLN n 1 73 ALA n 1 74 LEU n 1 75 ARG n 1 76 ASN n 1 77 LYS n 1 78 LEU n 1 79 THR n 1 80 MSE n 1 81 ILE n 1 82 SER n 1 83 HIS n 1 84 PHE n 1 85 GLY n 1 86 TYR n 1 87 ILE n 1 88 ALA n 1 89 ASN n 1 90 LYS n 1 91 ASP n 1 92 GLN n 1 93 SER n 1 94 ASP n 1 95 GLU n 1 96 GLN n 1 97 TYR n 1 98 ILE n 1 99 ALA n 1 100 THR n 1 101 GLN n 1 102 MSE n 1 103 LEU n 1 104 ILE n 1 105 TRP n 1 106 GLU n 1 107 LEU n 1 108 LEU n 1 109 GLY n 1 110 ALA n 1 111 LYS n 1 112 TYR n 1 113 HIS n 1 114 THR n 1 115 ILE n 1 116 TYR n 1 117 ASN n 1 118 GLY n 1 119 LEU n 1 120 ASN n 1 121 TYR n 1 122 GLU n 1 123 ALA n 1 124 ARG n 1 125 LYS n 1 126 ALA n 1 127 ASP n 1 128 ILE n 1 129 LEU n 1 130 LYS n 1 131 SER n 1 132 VAL n 1 133 LYS n 1 134 GLU n 1 135 ALA n 1 136 GLU n 1 137 GLN n 1 138 ARG n 1 139 ALA n 1 140 SER n 1 141 PHE n 1 142 HIS n 1 143 LYS n 1 144 GLN n 1 145 LYS n 1 146 LYS n 1 147 PRO n 1 148 ILE n 1 149 LYS n 1 150 VAL n 1 151 GLY n 1 152 GLU n 1 153 LYS n 1 154 GLY n 1 155 VAL n 1 156 PHE n 1 157 VAL n 1 158 ASP n 1 159 THR n 1 160 ASN n 1 161 ASN n 1 162 THR n 1 163 LEU n 1 164 SER n 1 165 ASN n 1 166 VAL n 1 167 LYS n 1 168 GLY n 1 169 ILE n 1 170 ARG n 1 171 THR n 1 172 PRO n 1 173 SER n 1 174 GLY n 1 175 VAL n 1 176 ASN n 1 177 ALA n 1 178 LYS n 1 179 ILE n 1 180 GLU n 1 181 GLY n 1 182 ASN n 1 183 LYS n 1 184 LEU n 1 185 ILE n 1 186 VAL n 1 187 THR n 1 188 ALA n 1 189 ASP n 1 190 LYS n 1 191 ASN n 1 192 ALA n 1 193 PRO n 1 194 ASP n 1 195 ASN n 1 196 ALA n 1 197 THR n 1 198 ILE n 1 199 HIS n 1 200 LEU n 1 201 ASP n 1 202 ARG n 1 203 ILE n 1 204 THR n 1 205 ILE n 1 206 VAL n 1 207 GLY n 1 208 THR n 1 209 PRO n 1 210 LEU n 1 211 VAL n 1 212 TYR n 1 213 THR n 1 214 SER n 1 215 GLY n 1 216 ASN n 1 217 ALA n 1 218 GLN n 1 219 LYS n 1 220 VAL n 1 221 GLY n 1 222 VAL n 1 223 LEU n 1 224 LYS n 1 225 PRO n 1 226 PHE n 1 227 ASP n 1 228 PRO n 1 229 LEU n 1 230 ASP n 1 231 SER n 1 232 TRP n 1 233 LEU n 1 234 THR n 1 235 LEU n 1 236 GLN n 1 237 VAL n 1 238 ILE n 1 239 LYS n 1 240 ASN n 1 241 GLY n 1 242 ASN n 1 243 VAL n 1 244 LYS n 1 245 ILE n 1 246 ILE n 1 247 LYS n 1 248 GLU n 1 249 ASP n 1 250 THR n 1 251 GLU n 1 252 THR n 1 253 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 253 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pEHisTEV _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6FX6 _struct_ref.pdbx_db_accession 6FX6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FX6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 253 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6FX6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 253 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 253 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FX6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 2000 monomethyl ether, Tris, zinc acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-01-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.920 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 45.25 _reflns.entry_id 6FX6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.25 _reflns.d_resolution_low 74.65 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12054 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 26.8 _reflns.pdbx_Rmerge_I_obs 0.138 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.25 _reflns_shell.d_res_low 2.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1084 _reflns_shell.percent_possible_all 97.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.067 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 21.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.873 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 5.4900 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -4.7100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.7800 _refine.B_iso_max 128.630 _refine.B_iso_mean 45.2540 _refine.B_iso_min 16.930 _refine.correlation_coeff_Fo_to_Fc 0.9490 _refine.correlation_coeff_Fo_to_Fc_free 0.9290 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FX6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2500 _refine.ls_d_res_low 74.6500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11395 _refine.ls_number_reflns_R_free 617 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7700 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2043 _refine.ls_R_factor_R_free 0.2459 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2021 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3420 _refine.pdbx_overall_ESU_R_Free 0.2330 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.7000 _refine.pdbx_solvent_shrinkage_radii 0.7000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 15.3670 _refine.overall_SU_ML 0.1960 _refine.overall_SU_R_Cruickshank_DPI 0.3420 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2500 _refine_hist.d_res_low 74.6500 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 1948 _refine_hist.pdbx_number_residues_total 237 _refine_hist.pdbx_B_iso_mean_ligand 61.85 _refine_hist.pdbx_B_iso_mean_solvent 39.10 _refine_hist.pdbx_number_atoms_protein 1877 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.019 1927 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1820 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.159 1.949 2605 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.822 3.000 4231 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.964 5.000 238 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.224 25.402 87 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.632 15.000 340 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.660 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.068 0.200 292 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 2125 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 370 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2500 _refine_ls_shell.d_res_low 2.3080 _refine_ls_shell.number_reflns_all 858 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 35 _refine_ls_shell.number_reflns_R_work 823 _refine_ls_shell.percent_reflns_obs 97.1700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2860 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3130 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6FX6 _struct.title 'Thioester domain of the Staphylococcus aureus TIE protein' _struct.pdbx_descriptor 'Collagen Adhesion protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FX6 _struct_keywords.text 'LPXTG-anchored, surface protein, thioester domain, TIE protein, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 66 ? LEU A 68 ? ASP A 66 LEU A 68 5 ? 3 HELX_P HELX_P2 AA2 ASP A 71 ? TYR A 86 ? ASP A 71 TYR A 86 1 ? 16 HELX_P HELX_P3 AA3 SER A 93 ? LEU A 108 ? SER A 93 LEU A 108 1 ? 16 HELX_P HELX_P4 AA4 ASN A 117 ? LEU A 119 ? ASN A 117 LEU A 119 5 ? 3 HELX_P HELX_P5 AA5 ASN A 120 ? ALA A 135 ? ASN A 120 ALA A 135 1 ? 16 HELX_P HELX_P6 AA6 THR A 162 ? VAL A 166 ? THR A 162 VAL A 166 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 14 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 14 A ZN 301 1_555 ? ? ? ? ? ? ? 1.995 ? covale1 covale both ? A THR 31 C ? ? ? 1_555 A MSE 32 N ? ? A THR 31 A MSE 32 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? A MSE 32 C ? ? ? 1_555 A ASP 33 N ? ? A MSE 32 A ASP 33 1_555 ? ? ? ? ? ? ? 1.336 ? metalc2 metalc ? ? A ASP 33 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 33 A ZN 302 1_555 ? ? ? ? ? ? ? 1.965 ? covale3 covale both ? A THR 79 C ? ? ? 1_555 A MSE 80 N ? ? A THR 79 A MSE 80 1_555 ? ? ? ? ? ? ? 1.335 ? covale4 covale both ? A MSE 80 C ? ? ? 1_555 A ILE 81 N ? ? A MSE 80 A ILE 81 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale both ? A GLN 101 C ? ? ? 1_555 A MSE 102 N ? ? A GLN 101 A MSE 102 1_555 ? ? ? ? ? ? ? 1.331 ? covale6 covale both ? A MSE 102 C ? ? ? 1_555 A LEU 103 N ? ? A MSE 102 A LEU 103 1_555 ? ? ? ? ? ? ? 1.335 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 301 A HOH 459 1_555 ? ? ? ? ? ? ? 2.141 ? metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 302 A HOH 451 1_555 ? ? ? ? ? ? ? 2.199 ? metalc5 metalc ? ? A HIS 199 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 199 A ZN 302 3_545 ? ? ? ? ? ? ? 2.054 ? metalc6 metalc ? ? A ASP 230 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 230 A ZN 301 3_545 ? ? ? ? ? ? ? 2.002 ? metalc7 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 301 A HOH 425 3_555 ? ? ? ? ? ? ? 1.935 ? metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 302 A HOH 448 3_555 ? ? ? ? ? ? ? 2.095 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 5 ? ILE A 13 ? GLN A 5 ILE A 13 AA1 2 TRP A 35 ? VAL A 40 ? TRP A 35 VAL A 40 AA1 3 GLU A 43 ? CYS A 47 ? GLU A 43 CYS A 47 AA1 4 VAL A 220 ? VAL A 222 ? VAL A 220 VAL A 222 AA1 5 LEU A 210 ? THR A 213 ? LEU A 210 THR A 213 AA1 6 VAL A 59 ? ASN A 64 ? VAL A 59 ASN A 64 AA1 7 GLN A 5 ? ILE A 13 ? GLN A 5 ILE A 13 AA2 1 ARG A 27 ? MSE A 32 ? ARG A 27 MSE A 32 AA2 2 ILE A 20 ? ALA A 24 ? ILE A 20 ALA A 24 AA2 3 LYS A 111 ? ILE A 115 ? LYS A 111 ILE A 115 AA3 1 LYS A 145 ? LYS A 149 ? LYS A 145 LYS A 149 AA3 2 SER A 231 ? ILE A 238 ? SER A 231 ILE A 238 AA3 3 ASN A 195 ? ASP A 201 ? ASN A 195 ASP A 201 AA3 4 GLY A 168 ? ARG A 170 ? GLY A 168 ARG A 170 AA4 1 GLY A 154 ? VAL A 157 ? GLY A 154 VAL A 157 AA4 2 LYS A 183 ? ALA A 188 ? LYS A 183 ALA A 188 AA4 3 VAL A 175 ? GLU A 180 ? VAL A 175 GLU A 180 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 13 ? N ILE A 13 O TRP A 35 ? O TRP A 35 AA1 2 3 N PHE A 38 ? N PHE A 38 O ALA A 45 ? O ALA A 45 AA1 3 4 N PHE A 46 ? N PHE A 46 O GLY A 221 ? O GLY A 221 AA1 4 5 O VAL A 220 ? O VAL A 220 N TYR A 212 ? N TYR A 212 AA1 5 6 O VAL A 211 ? O VAL A 211 N ALA A 63 ? N ALA A 63 AA1 6 7 O HIS A 60 ? O HIS A 60 N GLN A 6 ? N GLN A 6 AA2 1 2 O ARG A 27 ? O ARG A 27 N ALA A 24 ? N ALA A 24 AA2 2 3 N SER A 23 ? N SER A 23 O LYS A 111 ? O LYS A 111 AA3 1 2 N ILE A 148 ? N ILE A 148 O ILE A 238 ? O ILE A 238 AA3 2 3 O LEU A 235 ? O LEU A 235 N ALA A 196 ? N ALA A 196 AA3 3 4 O HIS A 199 ? O HIS A 199 N ARG A 170 ? N ARG A 170 AA4 1 2 N GLY A 154 ? N GLY A 154 O VAL A 186 ? O VAL A 186 AA4 2 3 O ILE A 185 ? O ILE A 185 N LYS A 178 ? N LYS A 178 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 4 'binding site for residue ZN A 301' AC2 Software A ZN 302 ? 4 'binding site for residue ZN A 302' AC3 Software A ACT 303 ? 2 'binding site for residue ACT A 303' AC4 Software A ACT 304 ? 1 'binding site for residue ACT A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 14 ? ASP A 14 . ? 1_555 ? 2 AC1 4 ASP A 230 ? ASP A 230 . ? 3_555 ? 3 AC1 4 HOH F . ? HOH A 425 . ? 3_555 ? 4 AC1 4 HOH F . ? HOH A 459 . ? 1_555 ? 5 AC2 4 ASP A 33 ? ASP A 33 . ? 1_555 ? 6 AC2 4 HIS A 199 ? HIS A 199 . ? 3_555 ? 7 AC2 4 HOH F . ? HOH A 448 . ? 3_555 ? 8 AC2 4 HOH F . ? HOH A 451 . ? 1_555 ? 9 AC3 2 ARG A 27 ? ARG A 27 . ? 1_555 ? 10 AC3 2 ASP A 194 ? ASP A 194 . ? 3_555 ? 11 AC4 1 ARG A 27 ? ARG A 27 . ? 1_555 ? # _atom_sites.entry_id 6FX6 _atom_sites.fract_transf_matrix[1][1] 0.022712 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013585 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013396 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 MSE 3 3 ? ? ? A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 MSE 32 32 32 MSE MSE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 MSE 80 80 80 MSE MSE A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 MSE 102 102 102 MSE MSE A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 PRO 193 193 193 PRO PRO A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 TRP 232 232 232 TRP TRP A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 THR 234 234 234 THR THR A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 ASN 240 240 240 ASN ASN A . n A 1 241 GLY 241 241 ? ? ? A . n A 1 242 ASN 242 242 ? ? ? A . n A 1 243 VAL 243 243 ? ? ? A . n A 1 244 LYS 244 244 ? ? ? A . n A 1 245 ILE 245 245 ? ? ? A . n A 1 246 ILE 246 246 ? ? ? A . n A 1 247 LYS 247 247 ? ? ? A . n A 1 248 GLU 248 248 ? ? ? A . n A 1 249 ASP 249 249 ? ? ? A . n A 1 250 THR 250 250 ? ? ? A . n A 1 251 GLU 251 251 ? ? ? A . n A 1 252 THR 252 252 ? ? ? A . n A 1 253 GLY 253 253 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 1 ZN ZN A . C 2 ZN 1 302 2 ZN ZN A . D 3 ACT 1 303 1 ACT ACT A . E 3 ACT 1 304 2 ACT ACT A . F 4 HOH 1 401 39 HOH HOH A . F 4 HOH 2 402 2 HOH HOH A . F 4 HOH 3 403 38 HOH HOH A . F 4 HOH 4 404 42 HOH HOH A . F 4 HOH 5 405 28 HOH HOH A . F 4 HOH 6 406 55 HOH HOH A . F 4 HOH 7 407 74 HOH HOH A . F 4 HOH 8 408 59 HOH HOH A . F 4 HOH 9 409 53 HOH HOH A . F 4 HOH 10 410 60 HOH HOH A . F 4 HOH 11 411 73 HOH HOH A . F 4 HOH 12 412 70 HOH HOH A . F 4 HOH 13 413 19 HOH HOH A . F 4 HOH 14 414 14 HOH HOH A . F 4 HOH 15 415 71 HOH HOH A . F 4 HOH 16 416 35 HOH HOH A . F 4 HOH 17 417 5 HOH HOH A . F 4 HOH 18 418 22 HOH HOH A . F 4 HOH 19 419 20 HOH HOH A . F 4 HOH 20 420 6 HOH HOH A . F 4 HOH 21 421 23 HOH HOH A . F 4 HOH 22 422 15 HOH HOH A . F 4 HOH 23 423 32 HOH HOH A . F 4 HOH 24 424 1 HOH HOH A . F 4 HOH 25 425 62 HOH HOH A . F 4 HOH 26 426 8 HOH HOH A . F 4 HOH 27 427 16 HOH HOH A . F 4 HOH 28 428 21 HOH HOH A . F 4 HOH 29 429 10 HOH HOH A . F 4 HOH 30 430 56 HOH HOH A . F 4 HOH 31 431 61 HOH HOH A . F 4 HOH 32 432 37 HOH HOH A . F 4 HOH 33 433 17 HOH HOH A . F 4 HOH 34 434 47 HOH HOH A . F 4 HOH 35 435 52 HOH HOH A . F 4 HOH 36 436 11 HOH HOH A . F 4 HOH 37 437 51 HOH HOH A . F 4 HOH 38 438 44 HOH HOH A . F 4 HOH 39 439 72 HOH HOH A . F 4 HOH 40 440 41 HOH HOH A . F 4 HOH 41 441 43 HOH HOH A . F 4 HOH 42 442 9 HOH HOH A . F 4 HOH 43 443 13 HOH HOH A . F 4 HOH 44 444 48 HOH HOH A . F 4 HOH 45 445 75 HOH HOH A . F 4 HOH 46 446 27 HOH HOH A . F 4 HOH 47 447 12 HOH HOH A . F 4 HOH 48 448 66 HOH HOH A . F 4 HOH 49 449 57 HOH HOH A . F 4 HOH 50 450 64 HOH HOH A . F 4 HOH 51 451 65 HOH HOH A . F 4 HOH 52 452 68 HOH HOH A . F 4 HOH 53 453 18 HOH HOH A . F 4 HOH 54 454 40 HOH HOH A . F 4 HOH 55 455 54 HOH HOH A . F 4 HOH 56 456 58 HOH HOH A . F 4 HOH 57 457 46 HOH HOH A . F 4 HOH 58 458 33 HOH HOH A . F 4 HOH 59 459 63 HOH HOH A . F 4 HOH 60 460 69 HOH HOH A . F 4 HOH 61 461 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 530 ? 1 MORE -37 ? 1 'SSA (A^2)' 12180 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 459 ? 1_555 109.8 ? 2 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD1 ? A ASP 230 ? A ASP 230 ? 1_555 91.7 ? 3 O ? F HOH . ? A HOH 459 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD1 ? A ASP 230 ? A ASP 230 ? 1_555 48.2 ? 4 OD2 ? A ASP 14 ? A ASP 14 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 3_555 114.1 ? 5 O ? F HOH . ? A HOH 459 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 3_555 115.3 ? 6 OD1 ? A ASP 230 ? A ASP 230 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 3_555 85.2 ? 7 OD1 ? A ASP 33 ? A ASP 33 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 451 ? 1_555 109.2 ? 8 OD1 ? A ASP 33 ? A ASP 33 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 199 ? A HIS 199 ? 1_555 71.7 ? 9 O ? F HOH . ? A HOH 451 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 199 ? A HIS 199 ? 1_555 39.3 ? 10 OD1 ? A ASP 33 ? A ASP 33 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 448 ? 3_555 94.4 ? 11 O ? F HOH . ? A HOH 451 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 448 ? 3_555 125.7 ? 12 NE2 ? A HIS 199 ? A HIS 199 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? F HOH . ? A HOH 448 ? 3_555 140.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-08 2 'Structure model' 1 1 2018-10-31 3 'Structure model' 2 0 2019-01-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' Advisory 4 3 'Structure model' 'Atomic model' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_site 3 3 'Structure model' pdbx_data_processing_status 4 3 'Structure model' pdbx_nonpoly_scheme 5 3 'Structure model' pdbx_solvent_atom_site_mapping 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 8 3 'Structure model' pdbx_validate_close_contact 9 3 'Structure model' struct_conn 10 3 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_atom_site.B_iso_or_equiv' 5 3 'Structure model' '_atom_site.Cartn_x' 6 3 'Structure model' '_atom_site.Cartn_y' 7 3 'Structure model' '_atom_site.Cartn_z' 8 3 'Structure model' '_atom_site.pdbx_auth_seq_id' 9 3 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 10 3 'Structure model' '_pdbx_solvent_atom_site_mapping.auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 3 'Structure model' '_struct_site_gen.auth_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -3.7055 -9.3777 25.4260 0.0607 0.0617 0.0604 -0.0449 0.0172 -0.0115 3.3592 5.2963 4.9418 -0.3529 -0.0863 2.6108 -0.0205 -0.2860 0.3065 -0.1614 -0.1376 0.4899 0.3692 0.2727 -0.2762 'X-RAY DIFFRACTION' 2 ? refined -5.0509 -26.9246 1.3080 0.0130 0.0423 0.0652 -0.0055 0.0144 0.0187 1.3942 2.9356 4.7264 0.8300 1.4756 2.2240 -0.0533 -0.0422 0.0955 0.1619 -0.0421 0.0073 -0.0440 0.0916 0.0438 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 4 A 134 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 135 A 240 ? ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXD ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 SG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 47 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CD _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 218 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.62 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 24 ? ? -161.92 112.02 2 1 LYS A 25 ? ? 58.76 -136.93 3 1 TYR A 86 ? ? -131.51 -56.59 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id GLN _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 218 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id NE2 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id GLN _pdbx_unobs_or_zero_occ_atoms.label_seq_id 218 _pdbx_unobs_or_zero_occ_atoms.label_atom_id NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A MSE 3 ? A MSE 3 4 1 Y 1 A GLY 241 ? A GLY 241 5 1 Y 1 A ASN 242 ? A ASN 242 6 1 Y 1 A VAL 243 ? A VAL 243 7 1 Y 1 A LYS 244 ? A LYS 244 8 1 Y 1 A ILE 245 ? A ILE 245 9 1 Y 1 A ILE 246 ? A ILE 246 10 1 Y 1 A LYS 247 ? A LYS 247 11 1 Y 1 A GLU 248 ? A GLU 248 12 1 Y 1 A ASP 249 ? A ASP 249 13 1 Y 1 A THR 250 ? A THR 250 14 1 Y 1 A GLU 251 ? A GLU 251 15 1 Y 1 A THR 252 ? A THR 252 16 1 Y 1 A GLY 253 ? A GLY 253 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Medical Research Council (United Kingdom)' 'United Kingdom' MR/K001485 1 'Royal Society of Edinburgh' 'United Kingdom' ? 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'ACETATE ION' ACT 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Gel filtration indicates monomer in solution' #