data_6GAI # _entry.id 6GAI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6GAI WWPDB D_1200009657 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GAI _pdbx_database_status.recvd_initial_deposition_date 2018-04-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nass Kovacs, G.' 1 ? 'Colletier, J.-P.' 2 ? 'Gruenbein, M.L.' 3 ? 'Stensitzki, T.' 4 ? 'Batyuk, A.' 5 ? 'Carbajo, S.' 6 ? 'Doak, R.B.' 7 ? 'Ehrenberg, D.' 8 ? 'Foucar, L.' 9 ? 'Gasper, R.' 10 ? 'Gorel, A.' 11 ? 'Hilpert, M.' 12 ? 'Kloos, M.' 13 ? 'Koglin, J.' 14 ? 'Reinstein, J.' 15 ? 'Roome, C.M.' 16 ? 'Schlesinger, R.' 17 ? 'Seaberg, M.' 18 ? 'Shoeman, R.L.' 19 ? 'Stricker, M.' 20 ? 'Boutet, S.' 21 ? 'Haacke, S.' 22 ? 'Heberle, J.' 23 ? 'Domratcheva, T.' 24 ? 'Schlichting, I.' 25 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 3177 _citation.page_last 3177 _citation.title 'Three-dimensional view of ultrafast dynamics in photoexcited bacteriorhodopsin.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-019-10758-0 _citation.pdbx_database_id_PubMed 31320619 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nass Kovacs, G.' 1 ? primary 'Colletier, J.P.' 2 ? primary 'Grunbein, M.L.' 3 ? primary 'Yang, Y.' 4 ? primary 'Stensitzki, T.' 5 0000-0003-2317-4874 primary 'Batyuk, A.' 6 0000-0002-9393-2880 primary 'Carbajo, S.' 7 ? primary 'Doak, R.B.' 8 ? primary 'Ehrenberg, D.' 9 ? primary 'Foucar, L.' 10 ? primary 'Gasper, R.' 11 ? primary 'Gorel, A.' 12 ? primary 'Hilpert, M.' 13 ? primary 'Kloos, M.' 14 ? primary 'Koglin, J.E.' 15 0000-0001-6811-6083 primary 'Reinstein, J.' 16 ? primary 'Roome, C.M.' 17 ? primary 'Schlesinger, R.' 18 0000-0002-7716-4439 primary 'Seaberg, M.' 19 0000-0002-4560-4698 primary 'Shoeman, R.L.' 20 0000-0002-1030-6738 primary 'Stricker, M.' 21 0000-0002-3397-2418 primary 'Boutet, S.' 22 ? primary 'Haacke, S.' 23 0000-0002-6969-4667 primary 'Heberle, J.' 24 ? primary 'Heyne, K.' 25 ? primary 'Domratcheva, T.' 26 ? primary 'Barends, T.R.M.' 27 ? primary 'Schlichting, I.' 28 0000-0002-0936-7496 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6GAI _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.100 _cell.length_a_esd ? _cell.length_b 62.100 _cell.length_b_esd ? _cell.length_c 110.500 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GAI _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Bacteriorhodopsin 26929.500 1 ? ? ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? 3 non-polymer nat 2,3-DI-PHYTANYL-GLYCEROL 653.157 3 ? ? ? ? 4 non-polymer syn TRIDECANE 184.361 1 ? ? ? ? 5 non-polymer syn DECANE 142.282 1 ? ? ? ? 6 non-polymer syn HEPTANE 100.202 1 ? ? ? ? 7 non-polymer syn N-OCTANE 114.229 3 ? ? ? ? 8 non-polymer syn PENTADECANE 212.415 1 ? ? ? ? 9 non-polymer syn UNDECANE 156.308 2 ? ? ? ? 10 non-polymer syn nonane 128.255 1 ? ? ? ? 11 non-polymer syn TETRADECANE 198.388 1 ? ? ? ? 12 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name BR,Bacterioopsin,BO # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYW ARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKA ESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATSD ; _entity_poly.pdbx_seq_one_letter_code_can ;QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYW ARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKA ESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATSD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ALA n 1 3 GLN n 1 4 ILE n 1 5 THR n 1 6 GLY n 1 7 ARG n 1 8 PRO n 1 9 GLU n 1 10 TRP n 1 11 ILE n 1 12 TRP n 1 13 LEU n 1 14 ALA n 1 15 LEU n 1 16 GLY n 1 17 THR n 1 18 ALA n 1 19 LEU n 1 20 MET n 1 21 GLY n 1 22 LEU n 1 23 GLY n 1 24 THR n 1 25 LEU n 1 26 TYR n 1 27 PHE n 1 28 LEU n 1 29 VAL n 1 30 LYS n 1 31 GLY n 1 32 MET n 1 33 GLY n 1 34 VAL n 1 35 SER n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 ALA n 1 40 LYS n 1 41 LYS n 1 42 PHE n 1 43 TYR n 1 44 ALA n 1 45 ILE n 1 46 THR n 1 47 THR n 1 48 LEU n 1 49 VAL n 1 50 PRO n 1 51 ALA n 1 52 ILE n 1 53 ALA n 1 54 PHE n 1 55 THR n 1 56 MET n 1 57 TYR n 1 58 LEU n 1 59 SER n 1 60 MET n 1 61 LEU n 1 62 LEU n 1 63 GLY n 1 64 TYR n 1 65 GLY n 1 66 LEU n 1 67 THR n 1 68 MET n 1 69 VAL n 1 70 PRO n 1 71 PHE n 1 72 GLY n 1 73 GLY n 1 74 GLU n 1 75 GLN n 1 76 ASN n 1 77 PRO n 1 78 ILE n 1 79 TYR n 1 80 TRP n 1 81 ALA n 1 82 ARG n 1 83 TYR n 1 84 ALA n 1 85 ASP n 1 86 TRP n 1 87 LEU n 1 88 PHE n 1 89 THR n 1 90 THR n 1 91 PRO n 1 92 LEU n 1 93 LEU n 1 94 LEU n 1 95 LEU n 1 96 ASP n 1 97 LEU n 1 98 ALA n 1 99 LEU n 1 100 LEU n 1 101 VAL n 1 102 ASP n 1 103 ALA n 1 104 ASP n 1 105 GLN n 1 106 GLY n 1 107 THR n 1 108 ILE n 1 109 LEU n 1 110 ALA n 1 111 LEU n 1 112 VAL n 1 113 GLY n 1 114 ALA n 1 115 ASP n 1 116 GLY n 1 117 ILE n 1 118 MET n 1 119 ILE n 1 120 GLY n 1 121 THR n 1 122 GLY n 1 123 LEU n 1 124 VAL n 1 125 GLY n 1 126 ALA n 1 127 LEU n 1 128 THR n 1 129 LYS n 1 130 VAL n 1 131 TYR n 1 132 SER n 1 133 TYR n 1 134 ARG n 1 135 PHE n 1 136 VAL n 1 137 TRP n 1 138 TRP n 1 139 ALA n 1 140 ILE n 1 141 SER n 1 142 THR n 1 143 ALA n 1 144 ALA n 1 145 MET n 1 146 LEU n 1 147 TYR n 1 148 ILE n 1 149 LEU n 1 150 TYR n 1 151 VAL n 1 152 LEU n 1 153 PHE n 1 154 PHE n 1 155 GLY n 1 156 PHE n 1 157 THR n 1 158 SER n 1 159 LYS n 1 160 ALA n 1 161 GLU n 1 162 SER n 1 163 MET n 1 164 ARG n 1 165 PRO n 1 166 GLU n 1 167 VAL n 1 168 ALA n 1 169 SER n 1 170 THR n 1 171 PHE n 1 172 LYS n 1 173 VAL n 1 174 LEU n 1 175 ARG n 1 176 ASN n 1 177 VAL n 1 178 THR n 1 179 VAL n 1 180 VAL n 1 181 LEU n 1 182 TRP n 1 183 SER n 1 184 ALA n 1 185 TYR n 1 186 PRO n 1 187 VAL n 1 188 VAL n 1 189 TRP n 1 190 LEU n 1 191 ILE n 1 192 GLY n 1 193 SER n 1 194 GLU n 1 195 GLY n 1 196 ALA n 1 197 GLY n 1 198 ILE n 1 199 VAL n 1 200 PRO n 1 201 LEU n 1 202 ASN n 1 203 ILE n 1 204 GLU n 1 205 THR n 1 206 LEU n 1 207 LEU n 1 208 PHE n 1 209 MET n 1 210 VAL n 1 211 LEU n 1 212 ASP n 1 213 VAL n 1 214 SER n 1 215 ALA n 1 216 LYS n 1 217 VAL n 1 218 GLY n 1 219 PHE n 1 220 GLY n 1 221 LEU n 1 222 ILE n 1 223 LEU n 1 224 LEU n 1 225 ARG n 1 226 SER n 1 227 ARG n 1 228 ALA n 1 229 ILE n 1 230 PHE n 1 231 GLY n 1 232 GLU n 1 233 ALA n 1 234 GLU n 1 235 ALA n 1 236 PRO n 1 237 GLU n 1 238 PRO n 1 239 SER n 1 240 ALA n 1 241 GLY n 1 242 ASP n 1 243 GLY n 1 244 ALA n 1 245 ALA n 1 246 ALA n 1 247 THR n 1 248 SER n 1 249 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 249 _entity_src_gen.gene_src_common_name 'Halobacterium halobium' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'bop, VNG_1467G' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700922 / JCM 11081 / NRC-1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 64091 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Halobacterium salinarum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 2242 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BACR_HALSA _struct_ref.pdbx_db_accession P02945 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYW ARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKA ESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATSD ; _struct_ref.pdbx_align_begin 14 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GAI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 249 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02945 _struct_ref_seq.db_align_beg 14 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 249 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C14 non-polymer . TETRADECANE ? 'C14 H30' 198.388 D10 non-polymer . DECANE ? 'C10 H22' 142.282 DD9 non-polymer . nonane ? 'C9 H20' 128.255 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 HP6 non-polymer . HEPTANE ? 'C7 H16' 100.202 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 L2P non-polymer . 2,3-DI-PHYTANYL-GLYCEROL '1,2-DI-1-(3,7,11,15-TETRAMETHYL-HEXADECANE)-SN-GLYCEROL' 'C43 H88 O3' 653.157 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MYS non-polymer . PENTADECANE ? 'C15 H32' 212.415 OCT non-polymer . N-OCTANE ? 'C8 H18' 114.229 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRD non-polymer . TRIDECANE 'LIPID FRAGMENT' 'C13 H28' 184.361 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UND non-polymer . UNDECANE 'LIPID FRAGMENT' 'C11 H24' 156.308 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GAI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.15 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '32% (w/v) PEG 2000, 0.1 M K2HPO4 /NaH2PO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'CS-PAD CXI-2' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.26 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'FREE ELECTRON LASER' _diffrn_source.target ? _diffrn_source.type 'SLAC LCLS BEAMLINE CXI' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.26 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline CXI _diffrn_source.pdbx_synchrotron_site 'SLAC LCLS' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6GAI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8 _reflns.d_resolution_low 21 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22397 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 133 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split 0.122 # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.9 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split 0.858 # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ;A MOLECULE IS THE DARK STATE B MOLECULE WAS REAL-SPACE REFINED AGAINST MAP CALCULATED FROM EXTRAPOLATED STRUCTURE FACTORS (AT 15% OCCUPANCY) MODEL/MAP FIT (CCmask)=0.8398 ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GAI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8 _refine.ls_d_res_low 20 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22397 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2126 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2044 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1787 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 227 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 2052 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 20 # _struct.entry_id 6GAI _struct.title 'BACTERIORHODOPSIN, 740 FS STATE, REAL-SPACE REFINED AGAINST 15% EXTRAPOLATED STRUCTURE FACTORS' _struct.pdbx_descriptor Bacteriorhodopsin _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GAI _struct_keywords.text 'Membrane protein, proton pump, time-resolved crystallography, free-electron laser' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 7 ? H N N 7 ? I N N 8 ? J N N 9 ? K N N 3 ? L N N 3 ? M N N 10 ? N N N 11 ? O N N 7 ? P N N 9 ? Q N N 12 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 9 ? GLY A 31 ? GLU A 9 GLY A 31 1 ? 23 HELX_P HELX_P2 AA2 ASP A 36 ? LEU A 62 ? ASP A 36 LEU A 62 1 ? 27 HELX_P HELX_P3 AA3 TRP A 80 ? VAL A 101 ? TRP A 80 VAL A 101 1 ? 22 HELX_P HELX_P4 AA4 ASP A 104 ? THR A 128 ? ASP A 104 THR A 128 1 ? 25 HELX_P HELX_P5 AA5 VAL A 130 ? GLY A 155 ? VAL A 130 GLY A 155 1 ? 26 HELX_P HELX_P6 AA6 PHE A 156 ? GLU A 161 ? PHE A 156 GLU A 161 1 ? 6 HELX_P HELX_P7 AA7 ARG A 164 ? GLY A 192 ? ARG A 164 GLY A 192 1 ? 29 HELX_P HELX_P8 AA8 PRO A 200 ? ARG A 225 ? PRO A 200 ARG A 225 1 ? 26 HELX_P HELX_P9 AA9 SER A 226 ? PHE A 230 ? SER A 226 PHE A 230 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale one ? A LYS 216 NZ A ? ? 1_555 B RET . C15 A ? A LYS 216 A RET 301 1_555 ? ? ? ? ? ? ? 1.343 ? covale2 covale one ? A LYS 216 NZ B ? ? 1_555 B RET . C15 B ? A LYS 216 A RET 301 1_555 ? ? ? ? ? ? ? 1.304 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 66 ? PHE A 71 ? LEU A 66 PHE A 71 AA1 2 GLU A 74 ? TYR A 79 ? GLU A 74 TYR A 79 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 67 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 67 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 78 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 78 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A RET 301 ? 11 'binding site for residue RET A 301' AC2 Software A L2P 302 ? 7 'binding site for residue L2P A 302' AC3 Software A TRD 303 ? 4 'binding site for residue TRD A 303' AC4 Software A D10 304 ? 3 'binding site for residue D10 A 304' AC5 Software A HP6 305 ? 1 'binding site for residue HP6 A 305' AC6 Software A OCT 306 ? 2 'binding site for residue OCT A 306' AC7 Software A MYS 308 ? 1 'binding site for residue MYS A 308' AC8 Software A UND 309 ? 1 'binding site for residue UND A 309' AC9 Software A L2P 310 ? 7 'binding site for residue L2P A 310' AD1 Software A L2P 311 ? 11 'binding site for residue L2P A 311' AD2 Software A DD9 312 ? 3 'binding site for residue DD9 A 312' AD3 Software A C14 313 ? 4 'binding site for residue C14 A 313' AD4 Software A OCT 314 ? 2 'binding site for residue OCT A 314' AD5 Software A UND 315 ? 1 'binding site for residue UND A 315' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 TRP A 86 ? TRP A 86 . ? 1_555 ? 2 AC1 11 THR A 90 ? THR A 90 . ? 1_555 ? 3 AC1 11 TRP A 138 ? TRP A 138 . ? 1_555 ? 4 AC1 11 SER A 141 ? SER A 141 . ? 1_555 ? 5 AC1 11 THR A 142 ? THR A 142 . ? 1_555 ? 6 AC1 11 TRP A 182 ? TRP A 182 . ? 1_555 ? 7 AC1 11 TYR A 185 ? TYR A 185 . ? 1_555 ? 8 AC1 11 PRO A 186 ? PRO A 186 . ? 1_555 ? 9 AC1 11 TRP A 189 ? TRP A 189 . ? 1_555 ? 10 AC1 11 ASP A 212 ? ASP A 212 . ? 1_555 ? 11 AC1 11 LYS A 216 ? LYS A 216 . ? 1_555 ? 12 AC2 7 LEU A 25 ? LEU A 25 . ? 2_455 ? 13 AC2 7 LYS A 40 ? LYS A 40 . ? 2_455 ? 14 AC2 7 ALA A 44 ? ALA A 44 . ? 2_455 ? 15 AC2 7 THR A 47 ? THR A 47 . ? 2_455 ? 16 AC2 7 LEU A 48 ? LEU A 48 . ? 2_455 ? 17 AC2 7 PHE A 54 ? PHE A 54 . ? 2_455 ? 18 AC2 7 TYR A 147 ? TYR A 147 . ? 1_555 ? 19 AC3 4 MET A 145 ? MET A 145 . ? 1_555 ? 20 AC3 4 LEU A 146 ? LEU A 146 . ? 1_555 ? 21 AC3 4 LEU A 149 ? LEU A 149 . ? 1_555 ? 22 AC3 4 SER A 183 ? SER A 183 . ? 1_555 ? 23 AC4 3 THR A 17 ? THR A 17 . ? 1_555 ? 24 AC4 3 LEU A 22 ? LEU A 22 . ? 1_555 ? 25 AC4 3 HP6 F . ? HP6 A 305 . ? 1_555 ? 26 AC5 1 D10 E . ? D10 A 304 . ? 1_555 ? 27 AC6 2 LYS A 172 ? LYS A 172 . ? 1_555 ? 28 AC6 2 ASN A 176 ? ASN A 176 . ? 1_555 ? 29 AC7 1 HOH Q . ? HOH A 432 . ? 2_555 ? 30 AC8 1 L2P K . ? L2P A 310 . ? 1_555 ? 31 AC9 7 TYR A 131 ? TYR A 131 . ? 1_555 ? 32 AC9 7 PHE A 135 ? PHE A 135 . ? 1_555 ? 33 AC9 7 TRP A 138 ? TRP A 138 . ? 1_555 ? 34 AC9 7 ALA A 139 ? ALA A 139 . ? 1_555 ? 35 AC9 7 ILE A 203 ? ILE A 203 . ? 3_555 ? 36 AC9 7 VAL A 210 ? VAL A 210 . ? 3_555 ? 37 AC9 7 UND J . ? UND A 309 . ? 1_555 ? 38 AD1 11 ILE A 52 ? ILE A 52 . ? 1_555 ? 39 AD1 11 MET A 56 ? MET A 56 . ? 1_555 ? 40 AD1 11 TYR A 64 ? TYR A 64 . ? 1_555 ? 41 AD1 11 TRP A 80 ? TRP A 80 . ? 1_555 ? 42 AD1 11 ALA A 84 ? ALA A 84 . ? 1_555 ? 43 AD1 11 PHE A 88 ? PHE A 88 . ? 1_555 ? 44 AD1 11 GLY A 116 ? GLY A 116 . ? 3_445 ? 45 AD1 11 LEU A 123 ? LEU A 123 . ? 1_555 ? 46 AD1 11 LEU A 123 ? LEU A 123 . ? 3_445 ? 47 AD1 11 VAL A 124 ? VAL A 124 . ? 3_445 ? 48 AD1 11 C14 N . ? C14 A 313 . ? 3_445 ? 49 AD2 3 GLY A 218 ? GLY A 218 . ? 1_555 ? 50 AD2 3 LEU A 221 ? LEU A 221 . ? 1_555 ? 51 AD2 3 ARG A 225 ? ARG A 225 . ? 1_555 ? 52 AD3 4 LEU A 87 ? LEU A 87 . ? 1_555 ? 53 AD3 4 PRO A 91 ? PRO A 91 . ? 1_555 ? 54 AD3 4 LEU A 95 ? LEU A 95 . ? 1_555 ? 55 AD3 4 L2P L . ? L2P A 311 . ? 2_455 ? 56 AD4 2 TYR A 26 ? TYR A 26 . ? 1_555 ? 57 AD4 2 VAL A 29 ? VAL A 29 . ? 1_555 ? 58 AD5 1 TYR A 150 ? TYR A 150 . ? 1_555 ? # _atom_sites.entry_id 6GAI _atom_sites.fract_transf_matrix[1][1] 0.016103 _atom_sites.fract_transf_matrix[1][2] 0.009297 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018594 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009050 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 TRP 182 182 182 TRP TRP A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 TRP 189 189 189 TRP TRP A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 MET 209 209 209 MET MET A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 PHE 230 230 230 PHE PHE A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 ALA 235 235 ? ? ? A . n A 1 236 PRO 236 236 ? ? ? A . n A 1 237 GLU 237 237 ? ? ? A . n A 1 238 PRO 238 238 ? ? ? A . n A 1 239 SER 239 239 ? ? ? A . n A 1 240 ALA 240 240 ? ? ? A . n A 1 241 GLY 241 241 ? ? ? A . n A 1 242 ASP 242 242 ? ? ? A . n A 1 243 GLY 243 243 ? ? ? A . n A 1 244 ALA 244 244 ? ? ? A . n A 1 245 ALA 245 245 ? ? ? A . n A 1 246 ALA 246 246 ? ? ? A . n A 1 247 THR 247 247 ? ? ? A . n A 1 248 SER 248 248 ? ? ? A . n A 1 249 ASP 249 249 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RET 1 301 300 RET RET A . C 3 L2P 1 302 600 L2P L2P A . D 4 TRD 1 303 601 TRD TRD A . E 5 D10 1 304 602 D10 D10 A . F 6 HP6 1 305 603 HP6 HP6 A . G 7 OCT 1 306 604 OCT OCT A . H 7 OCT 1 307 605 OCT OCT A . I 8 MYS 1 308 606 MYS MYS A . J 9 UND 1 309 607 UND UND A . K 3 L2P 1 310 608 L2P L2P A . L 3 L2P 1 311 609 L2P L2P A . M 10 DD9 1 312 611 DD9 DD9 A . N 11 C14 1 313 612 C14 C14 A . O 7 OCT 1 314 613 OCT OCT A . P 9 UND 1 315 614 UND UND A . Q 12 HOH 1 401 636 HOH HOH A . Q 12 HOH 2 402 611 HOH HOH A . Q 12 HOH 3 403 627 HOH HOH A . Q 12 HOH 4 404 618 HOH HOH A . Q 12 HOH 5 405 613 HOH HOH A . Q 12 HOH 6 406 616 HOH HOH A . Q 12 HOH 7 407 610 HOH HOH A . Q 12 HOH 8 408 402 HOH HOH A . Q 12 HOH 9 409 631 HOH HOH A . Q 12 HOH 10 410 617 HOH HOH A . Q 12 HOH 11 411 406 HOH HOH A . Q 12 HOH 12 412 403 HOH HOH A . Q 12 HOH 13 413 401 HOH HOH A . Q 12 HOH 14 414 620 HOH HOH A . Q 12 HOH 15 415 630 HOH HOH A . Q 12 HOH 16 416 633 HOH HOH A . Q 12 HOH 17 417 614 HOH HOH A . Q 12 HOH 18 418 609 HOH HOH A . Q 12 HOH 19 419 606 HOH HOH A . Q 12 HOH 20 420 635 HOH HOH A . Q 12 HOH 21 421 407 HOH HOH A . Q 12 HOH 22 422 612 HOH HOH A . Q 12 HOH 23 423 626 HOH HOH A . Q 12 HOH 24 424 404 HOH HOH A . Q 12 HOH 25 425 501 HOH HOH A . Q 12 HOH 26 426 619 HOH HOH A . Q 12 HOH 27 427 622 HOH HOH A . Q 12 HOH 28 428 615 HOH HOH A . Q 12 HOH 29 429 628 HOH HOH A . Q 12 HOH 30 430 624 HOH HOH A . Q 12 HOH 31 431 621 HOH HOH A . Q 12 HOH 32 432 629 HOH HOH A . Q 12 HOH 33 433 623 HOH HOH A . Q 12 HOH 34 434 634 HOH HOH A . Q 12 HOH 35 435 638 HOH HOH A . Q 12 HOH 36 436 637 HOH HOH A . Q 12 HOH 37 437 632 HOH HOH A . Q 12 HOH 38 438 625 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 25680 ? 1 MORE -102 ? 1 'SSA (A^2)' 26910 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -y-1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 -62.1000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_445 -x+y-1,-x-1,z -0.5000000000 0.8660254038 0.0000000000 -31.0500000000 -0.8660254038 -0.5000000000 0.0000000000 -53.7801775750 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 435 ? Q HOH . 2 1 A HOH 436 ? Q HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-24 2 'Structure model' 1 1 2019-07-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_3063: 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 163 ? B -110.56 -168.87 2 1 LYS A 216 ? B -105.72 -60.33 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 436 ? 6.28 . 2 1 O A A HOH 437 ? 8.38 . 3 1 O A A HOH 438 ? 8.83 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A L2P 302 ? C3 ? C L2P 1 C3 2 1 N 1 A L2P 302 ? O3 ? C L2P 1 O3 3 1 N 1 A L2P 302 ? C12 ? C L2P 1 C12 4 1 N 1 A L2P 302 ? C13 ? C L2P 1 C13 5 1 N 1 A L2P 302 ? C14 ? C L2P 1 C14 6 1 N 1 A L2P 302 ? C15 ? C L2P 1 C15 7 1 N 1 A L2P 302 ? C16 ? C L2P 1 C16 8 1 N 1 A L2P 302 ? C17 ? C L2P 1 C17 9 1 N 1 A L2P 302 ? C18 ? C L2P 1 C18 10 1 N 1 A L2P 302 ? C19 ? C L2P 1 C19 11 1 N 1 A L2P 302 ? C20 ? C L2P 1 C20 12 1 N 1 A L2P 302 ? C21 ? C L2P 1 C21 13 1 N 1 A L2P 302 ? C22 ? C L2P 1 C22 14 1 N 1 A L2P 302 ? C23 ? C L2P 1 C23 15 1 N 1 A L2P 302 ? C24 ? C L2P 1 C24 16 1 N 1 A L2P 302 ? C25 ? C L2P 1 C25 17 1 N 1 A L2P 302 ? C26 ? C L2P 1 C26 18 1 N 1 A L2P 302 ? C27 ? C L2P 1 C27 19 1 N 1 A L2P 302 ? C28 ? C L2P 1 C28 20 1 N 1 A L2P 302 ? C29 ? C L2P 1 C29 21 1 N 1 A L2P 302 ? C30 ? C L2P 1 C30 22 1 N 1 A L2P 310 ? C2 ? K L2P 1 C2 23 1 N 1 A L2P 310 ? O2 ? K L2P 1 O2 24 1 N 1 A L2P 310 ? C3 ? K L2P 1 C3 25 1 N 1 A L2P 310 ? O3 ? K L2P 1 O3 26 1 N 1 A L2P 310 ? C41 ? K L2P 1 C41 27 1 N 1 A L2P 310 ? C42 ? K L2P 1 C42 28 1 N 1 A L2P 310 ? C43 ? K L2P 1 C43 29 1 N 1 A L2P 310 ? C44 ? K L2P 1 C44 30 1 N 1 A L2P 310 ? C45 ? K L2P 1 C45 31 1 N 1 A L2P 310 ? C46 ? K L2P 1 C46 32 1 N 1 A L2P 310 ? C47 ? K L2P 1 C47 33 1 N 1 A L2P 310 ? C48 ? K L2P 1 C48 34 1 N 1 A L2P 310 ? C49 ? K L2P 1 C49 35 1 N 1 A L2P 310 ? C50 ? K L2P 1 C50 36 1 N 1 A L2P 310 ? C51 ? K L2P 1 C51 37 1 N 1 A L2P 310 ? C52 ? K L2P 1 C52 38 1 N 1 A L2P 310 ? C53 ? K L2P 1 C53 39 1 N 1 A L2P 310 ? C54 ? K L2P 1 C54 40 1 N 1 A L2P 310 ? C55 ? K L2P 1 C55 41 1 N 1 A L2P 310 ? C56 ? K L2P 1 C56 42 1 N 1 A L2P 310 ? C57 ? K L2P 1 C57 43 1 N 1 A L2P 310 ? C58 ? K L2P 1 C58 44 1 N 1 A L2P 310 ? C59 ? K L2P 1 C59 45 1 N 1 A L2P 310 ? C60 ? K L2P 1 C60 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 1 ? A GLN 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A ALA 235 ? A ALA 235 5 1 Y 1 A PRO 236 ? A PRO 236 6 1 Y 1 A GLU 237 ? A GLU 237 7 1 Y 1 A PRO 238 ? A PRO 238 8 1 Y 1 A SER 239 ? A SER 239 9 1 Y 1 A ALA 240 ? A ALA 240 10 1 Y 1 A GLY 241 ? A GLY 241 11 1 Y 1 A ASP 242 ? A ASP 242 12 1 Y 1 A GLY 243 ? A GLY 243 13 1 Y 1 A ALA 244 ? A ALA 244 14 1 Y 1 A ALA 245 ? A ALA 245 15 1 Y 1 A ALA 246 ? A ALA 246 16 1 Y 1 A THR 247 ? A THR 247 17 1 Y 1 A SER 248 ? A SER 248 18 1 Y 1 A ASP 249 ? A ASP 249 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ANR-17-CE11-0018-01 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 RETINAL RET 3 2,3-DI-PHYTANYL-GLYCEROL L2P 4 TRIDECANE TRD 5 DECANE D10 6 HEPTANE HP6 7 N-OCTANE OCT 8 PENTADECANE MYS 9 UNDECANE UND 10 nonane DD9 11 TETRADECANE C14 12 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #