data_6GBA # _entry.id 6GBA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6GBA pdb_00006gba 10.2210/pdb6gba/pdb WWPDB D_1200009685 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-07-18 2 'Structure model' 1 1 2018-08-22 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GBA _pdbx_database_status.recvd_initial_deposition_date 2018-04-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Granzin, J.' 1 ? 'Batra-Safferling, R.' 2 ? 'Roellen, K.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 1520-4995 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 57 _citation.language ? _citation.page_first 4833 _citation.page_last 4847 _citation.title 'Mechanistic Basis of the Fast Dark Recovery of the Short LOV Protein DsLOV from Dinoroseobacter shibae.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.8b00645 _citation.pdbx_database_id_PubMed 29989797 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fettweiss, T.' 1 ? primary 'Rollen, K.' 2 ? primary 'Granzin, J.' 3 ? primary 'Reiners, O.' 4 ? primary 'Endres, S.' 5 ? primary 'Drepper, T.' 6 ? primary 'Willbold, D.' 7 0000-0002-0065-7366 primary 'Jaeger, K.E.' 8 0000-0002-6036-0708 primary 'Batra-Safferling, R.' 9 ? primary 'Krauss, U.' 10 0000-0003-2219-7388 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative blue-light photoreceptor' 16800.803 1 ? M49A ? 'C-terminal hexa-histidine-tagged fusion proteins (tag sequence: LEHHHHHH) in E. coli BL21(DE3)' 2 non-polymer syn 'FLAVIN MONONUCLEOTIDE' 456.344 1 ? ? ? ? 3 water nat water 18.015 51 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRRHYRDLIRNTPMPDTPQDIADLRALLDEDEAEMSVVFSDPSQPDNPAIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDT NPHAVEAIRQGLKAETRFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRRHYRDLIRNTPMPDTPQDIADLRALLDEDEAEMSVVFSDPSQPDNPAIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDT NPHAVEAIRQGLKAETRFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FLAVIN MONONUCLEOTIDE' FMN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ARG n 1 4 HIS n 1 5 TYR n 1 6 ARG n 1 7 ASP n 1 8 LEU n 1 9 ILE n 1 10 ARG n 1 11 ASN n 1 12 THR n 1 13 PRO n 1 14 MET n 1 15 PRO n 1 16 ASP n 1 17 THR n 1 18 PRO n 1 19 GLN n 1 20 ASP n 1 21 ILE n 1 22 ALA n 1 23 ASP n 1 24 LEU n 1 25 ARG n 1 26 ALA n 1 27 LEU n 1 28 LEU n 1 29 ASP n 1 30 GLU n 1 31 ASP n 1 32 GLU n 1 33 ALA n 1 34 GLU n 1 35 MET n 1 36 SER n 1 37 VAL n 1 38 VAL n 1 39 PHE n 1 40 SER n 1 41 ASP n 1 42 PRO n 1 43 SER n 1 44 GLN n 1 45 PRO n 1 46 ASP n 1 47 ASN n 1 48 PRO n 1 49 ALA n 1 50 ILE n 1 51 TYR n 1 52 VAL n 1 53 SER n 1 54 ASP n 1 55 ALA n 1 56 PHE n 1 57 LEU n 1 58 VAL n 1 59 GLN n 1 60 THR n 1 61 GLY n 1 62 TYR n 1 63 THR n 1 64 LEU n 1 65 GLU n 1 66 GLU n 1 67 VAL n 1 68 LEU n 1 69 GLY n 1 70 ARG n 1 71 ASN n 1 72 CYS n 1 73 ARG n 1 74 PHE n 1 75 LEU n 1 76 GLN n 1 77 GLY n 1 78 PRO n 1 79 ASP n 1 80 THR n 1 81 ASN n 1 82 PRO n 1 83 HIS n 1 84 ALA n 1 85 VAL n 1 86 GLU n 1 87 ALA n 1 88 ILE n 1 89 ARG n 1 90 GLN n 1 91 GLY n 1 92 LEU n 1 93 LYS n 1 94 ALA n 1 95 GLU n 1 96 THR n 1 97 ARG n 1 98 PHE n 1 99 THR n 1 100 ILE n 1 101 ASP n 1 102 ILE n 1 103 LEU n 1 104 ASN n 1 105 TYR n 1 106 ARG n 1 107 LYS n 1 108 ASP n 1 109 GLY n 1 110 SER n 1 111 ALA n 1 112 PHE n 1 113 VAL n 1 114 ASN n 1 115 ARG n 1 116 LEU n 1 117 ARG n 1 118 ILE n 1 119 ARG n 1 120 PRO n 1 121 ILE n 1 122 TYR n 1 123 ASP n 1 124 PRO n 1 125 GLU n 1 126 GLY n 1 127 ASN n 1 128 LEU n 1 129 MET n 1 130 PHE n 1 131 PHE n 1 132 ALA n 1 133 GLY n 1 134 ALA n 1 135 GLN n 1 136 ASN n 1 137 PRO n 1 138 VAL n 1 139 LEU n 1 140 GLU n 1 141 HIS n 1 142 HIS n 1 143 HIS n 1 144 HIS n 1 145 HIS n 1 146 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 146 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Dshi_2006 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 398580 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMN non-polymer . 'FLAVIN MONONUCLEOTIDE' 'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 TYR 5 5 ? ? ? A . n A 1 6 ARG 6 6 ? ? ? A . n A 1 7 ASP 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 ILE 9 9 ? ? ? A . n A 1 10 ARG 10 10 ? ? ? A . n A 1 11 ASN 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 PRO 13 13 ? ? ? A . n A 1 14 MET 14 14 ? ? ? A . n A 1 15 PRO 15 15 ? ? ? A . n A 1 16 ASP 16 16 ? ? ? A . n A 1 17 THR 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 GLN 19 19 ? ? ? A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLU 140 140 ? ? ? A . n A 1 141 HIS 141 141 ? ? ? A . n A 1 142 HIS 142 142 ? ? ? A . n A 1 143 HIS 143 143 ? ? ? A . n A 1 144 HIS 144 144 ? ? ? A . n A 1 145 HIS 145 145 ? ? ? A . n A 1 146 HIS 146 146 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMN 1 500 500 FMN FMN A . C 3 HOH 1 601 15 HOH HOH A . C 3 HOH 2 602 6 HOH HOH A . C 3 HOH 3 603 49 HOH HOH A . C 3 HOH 4 604 30 HOH HOH A . C 3 HOH 5 605 2 HOH HOH A . C 3 HOH 6 606 8 HOH HOH A . C 3 HOH 7 607 1 HOH HOH A . C 3 HOH 8 608 32 HOH HOH A . C 3 HOH 9 609 17 HOH HOH A . C 3 HOH 10 610 11 HOH HOH A . C 3 HOH 11 611 12 HOH HOH A . C 3 HOH 12 612 28 HOH HOH A . C 3 HOH 13 613 35 HOH HOH A . C 3 HOH 14 614 16 HOH HOH A . C 3 HOH 15 615 39 HOH HOH A . C 3 HOH 16 616 43 HOH HOH A . C 3 HOH 17 617 18 HOH HOH A . C 3 HOH 18 618 21 HOH HOH A . C 3 HOH 19 619 38 HOH HOH A . C 3 HOH 20 620 24 HOH HOH A . C 3 HOH 21 621 51 HOH HOH A . C 3 HOH 22 622 34 HOH HOH A . C 3 HOH 23 623 26 HOH HOH A . C 3 HOH 24 624 5 HOH HOH A . C 3 HOH 25 625 9 HOH HOH A . C 3 HOH 26 626 33 HOH HOH A . C 3 HOH 27 627 42 HOH HOH A . C 3 HOH 28 628 36 HOH HOH A . C 3 HOH 29 629 3 HOH HOH A . C 3 HOH 30 630 14 HOH HOH A . C 3 HOH 31 631 20 HOH HOH A . C 3 HOH 32 632 13 HOH HOH A . C 3 HOH 33 633 40 HOH HOH A . C 3 HOH 34 634 46 HOH HOH A . C 3 HOH 35 635 50 HOH HOH A . C 3 HOH 36 636 19 HOH HOH A . C 3 HOH 37 637 44 HOH HOH A . C 3 HOH 38 638 25 HOH HOH A . C 3 HOH 39 639 10 HOH HOH A . C 3 HOH 40 640 45 HOH HOH A . C 3 HOH 41 641 37 HOH HOH A . C 3 HOH 42 642 22 HOH HOH A . C 3 HOH 43 643 4 HOH HOH A . C 3 HOH 44 644 48 HOH HOH A . C 3 HOH 45 645 23 HOH HOH A . C 3 HOH 46 646 31 HOH HOH A . C 3 HOH 47 647 47 HOH HOH A . C 3 HOH 48 648 7 HOH HOH A . C 3 HOH 49 649 27 HOH HOH A . C 3 HOH 50 650 29 HOH HOH A . C 3 HOH 51 651 41 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 20 ? CG ? A ASP 20 CG 2 1 Y 1 A ASP 20 ? OD1 ? A ASP 20 OD1 3 1 Y 1 A ASP 20 ? OD2 ? A ASP 20 OD2 4 1 Y 1 A ARG 25 ? CG ? A ARG 25 CG 5 1 Y 1 A ARG 25 ? CD ? A ARG 25 CD 6 1 Y 1 A ARG 25 ? NE ? A ARG 25 NE 7 1 Y 1 A ARG 25 ? CZ ? A ARG 25 CZ 8 1 Y 1 A ARG 25 ? NH1 ? A ARG 25 NH1 9 1 Y 1 A ARG 25 ? NH2 ? A ARG 25 NH2 10 1 Y 1 A ASP 29 ? CG ? A ASP 29 CG 11 1 Y 1 A ASP 29 ? OD1 ? A ASP 29 OD1 12 1 Y 1 A ASP 29 ? OD2 ? A ASP 29 OD2 13 1 Y 1 A GLU 30 ? CG ? A GLU 30 CG 14 1 Y 1 A GLU 30 ? CD ? A GLU 30 CD 15 1 Y 1 A GLU 30 ? OE1 ? A GLU 30 OE1 16 1 Y 1 A GLU 30 ? OE2 ? A GLU 30 OE2 17 1 Y 1 A ASP 31 ? CG ? A ASP 31 CG 18 1 Y 1 A ASP 31 ? OD1 ? A ASP 31 OD1 19 1 Y 1 A ASP 31 ? OD2 ? A ASP 31 OD2 20 1 Y 1 A GLU 34 ? CG ? A GLU 34 CG 21 1 Y 1 A GLU 34 ? CD ? A GLU 34 CD 22 1 Y 1 A GLU 34 ? OE1 ? A GLU 34 OE1 23 1 Y 1 A GLU 34 ? OE2 ? A GLU 34 OE2 24 1 Y 1 A ARG 117 ? CG ? A ARG 117 CG 25 1 Y 1 A ARG 117 ? CD ? A ARG 117 CD 26 1 Y 1 A ARG 117 ? NE ? A ARG 117 NE 27 1 Y 1 A ARG 117 ? CZ ? A ARG 117 CZ 28 1 Y 1 A ARG 117 ? NH1 ? A ARG 117 NH1 29 1 Y 1 A ARG 117 ? NH2 ? A ARG 117 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 112.93 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6GBA _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.880 _cell.length_a_esd ? _cell.length_b 30.931 _cell.length_b_esd ? _cell.length_c 49.132 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GBA _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GBA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris-HCl, 30 % PEG 6000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 27.48 _reflns.entry_id 6GBA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 45.25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9733 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.0 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.079 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.94 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 627 _reflns_shell.percent_possible_all 98.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.651 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.746 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.878 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GBA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.900 _refine.ls_d_res_low 28.974 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9724 _refine.ls_number_reflns_R_free 481 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.86 _refine.ls_percent_reflns_R_free 4.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1796 _refine.ls_R_factor_R_free 0.2176 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1774 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4KUK _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 0.90 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.50 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.35 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.21 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 918 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 1000 _refine_hist.d_res_high 1.900 _refine_hist.d_res_low 28.974 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 977 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.833 ? 1338 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.278 ? 580 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 149 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 175 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9002 2.0468 . . 88 1846 97.00 . . . 0.2678 . 0.2197 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0468 2.2527 . . 85 1858 98.00 . . . 0.2260 . 0.1949 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2527 2.5786 . . 105 1828 97.00 . . . 0.2448 . 0.2126 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5786 3.248 . . 83 1784 93.00 . . . 0.2515 . 0.1905 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.248 28.9778 . . 120 1927 99.00 . . . 0.1912 . 0.1504 . . . . . . . . . . # _struct.entry_id 6GBA _struct.title ;A fast recovering full-length LOV protein (DsLOV) from the marine phototrophic bacterium Dinoroseobacter shibae (Dark state) - M49A mutant ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GBA _struct_keywords.text 'LIGHT-OXYGEN-VOLTAGE, LOV, PAS, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A8LP63_DINSH _struct_ref.pdbx_db_accession A8LP63 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRRHYRDLIRNTPMPDTPQDIADLRALLDEDEAEMSVVFSDPSQPDNPMIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDT NPHAVEAIRQGLKAETRFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPV ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GBA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 138 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8LP63 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 139 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 138 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6GBA ALA A 49 ? UNP A8LP63 MET 50 'engineered mutation' 49 1 1 6GBA LEU A 139 ? UNP A8LP63 ? ? 'expression tag' 139 2 1 6GBA GLU A 140 ? UNP A8LP63 ? ? 'expression tag' 140 3 1 6GBA HIS A 141 ? UNP A8LP63 ? ? 'expression tag' 141 4 1 6GBA HIS A 142 ? UNP A8LP63 ? ? 'expression tag' 142 5 1 6GBA HIS A 143 ? UNP A8LP63 ? ? 'expression tag' 143 6 1 6GBA HIS A 144 ? UNP A8LP63 ? ? 'expression tag' 144 7 1 6GBA HIS A 145 ? UNP A8LP63 ? ? 'expression tag' 145 8 1 6GBA HIS A 146 ? UNP A8LP63 ? ? 'expression tag' 146 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3550 ? 1 MORE -25 ? 1 'SSA (A^2)' 11620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_554 -x,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 19.1421332102 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -45.2496647519 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 23 ? LEU A 28 ? ASP A 23 LEU A 28 5 ? 6 HELX_P HELX_P2 AA2 SER A 53 ? GLY A 61 ? SER A 53 GLY A 61 1 ? 9 HELX_P HELX_P3 AA3 THR A 63 ? LEU A 68 ? THR A 63 LEU A 68 1 ? 6 HELX_P HELX_P4 AA4 ASN A 71 ? GLN A 76 ? ASN A 71 GLN A 76 5 ? 6 HELX_P HELX_P5 AA5 ASN A 81 ? GLU A 95 ? ASN A 81 GLU A 95 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 49 ? VAL A 52 ? ALA A 49 VAL A 52 AA1 2 SER A 36 ? SER A 40 ? SER A 36 SER A 40 AA1 3 LEU A 128 ? PRO A 137 ? LEU A 128 PRO A 137 AA1 4 ALA A 111 ? TYR A 122 ? ALA A 111 TYR A 122 AA1 5 PHE A 98 ? TYR A 105 ? PHE A 98 TYR A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 50 ? O ILE A 50 N PHE A 39 ? N PHE A 39 AA1 2 3 N VAL A 38 ? N VAL A 38 O GLY A 133 ? O GLY A 133 AA1 3 4 O ASN A 136 ? O ASN A 136 N ARG A 115 ? N ARG A 115 AA1 4 5 O PHE A 112 ? O PHE A 112 N ASN A 104 ? N ASN A 104 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FMN _struct_site.pdbx_auth_seq_id 500 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 18 _struct_site.details 'binding site for residue FMN A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 18 SER A 40 ? SER A 40 . ? 1_555 ? 2 AC1 18 ASN A 47 ? ASN A 47 . ? 1_555 ? 3 AC1 18 ASN A 71 ? ASN A 71 . ? 1_555 ? 4 AC1 18 CYS A 72 ? CYS A 72 . ? 1_555 ? 5 AC1 18 ARG A 73 ? ARG A 73 . ? 1_555 ? 6 AC1 18 LEU A 75 ? LEU A 75 . ? 1_555 ? 7 AC1 18 GLN A 76 ? GLN A 76 . ? 1_555 ? 8 AC1 18 VAL A 85 ? VAL A 85 . ? 1_555 ? 9 AC1 18 ILE A 88 ? ILE A 88 . ? 1_555 ? 10 AC1 18 ARG A 89 ? ARG A 89 . ? 1_555 ? 11 AC1 18 LEU A 92 ? LEU A 92 . ? 1_555 ? 12 AC1 18 ILE A 102 ? ILE A 102 . ? 1_555 ? 13 AC1 18 ASN A 104 ? ASN A 104 . ? 1_555 ? 14 AC1 18 ASN A 114 ? ASN A 114 . ? 1_555 ? 15 AC1 18 LEU A 116 ? LEU A 116 . ? 1_555 ? 16 AC1 18 GLY A 133 ? GLY A 133 . ? 1_555 ? 17 AC1 18 GLN A 135 ? GLN A 135 . ? 1_555 ? 18 AC1 18 HOH C . ? HOH A 636 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 34 ? ? -89.53 33.18 2 1 CYS A 72 ? ? -68.59 1.50 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 11.8916 10.8176 -15.4832 0.4832 0.3970 0.5652 0.0047 0.0187 -0.1192 3.6793 4.3014 5.2243 1.7750 3.4835 -0.8667 0.1280 -0.2155 0.8116 -0.1274 0.1452 0.7196 -1.2394 -0.1218 -0.1535 'X-RAY DIFFRACTION' 2 ? refined 17.4355 1.0341 -10.2064 0.2444 0.3170 0.2063 -0.0087 0.0466 -0.0406 4.3335 3.8660 3.9615 1.8539 2.6046 0.3923 0.0027 0.3384 -0.0303 -0.2815 0.0910 -0.0556 0.1741 0.3060 -0.0941 'X-RAY DIFFRACTION' 3 ? refined 10.3665 -6.4999 -1.9174 0.2245 0.1701 0.2394 0.0269 0.0182 0.0081 2.8244 1.1610 2.5400 -0.6076 0.3438 0.0472 0.0465 -0.0702 -0.4730 0.0349 0.0278 0.0293 0.3378 0.2304 -0.0618 'X-RAY DIFFRACTION' 4 ? refined 9.3466 1.8800 -1.3832 0.1779 0.2372 0.2014 0.0039 -0.0137 -0.0099 2.7375 1.0861 1.4498 0.8233 0.1451 0.3410 -0.1069 0.2987 0.1233 -0.0425 0.0788 0.0469 -0.0922 0.0708 0.0910 'X-RAY DIFFRACTION' 5 ? refined 5.4032 2.4698 -12.7777 0.2176 0.4071 0.2653 -0.0648 -0.0193 0.0411 2.7605 2.5001 5.3179 -0.2866 0.7782 -0.1923 -0.0973 0.3388 0.3352 -0.4363 0.0137 0.4016 0.0023 -0.3505 0.1548 'X-RAY DIFFRACTION' 6 ? refined 10.2783 -4.3137 -4.4245 0.4380 0.2892 0.3930 -0.0300 0.0811 -0.1020 3.8610 7.2268 2.9294 2.2408 1.9870 -1.2634 -0.0873 0.1267 -1.0667 -0.7046 -0.2997 -0.2163 1.7085 0.3047 0.3534 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 20 through 35 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 36 through 66 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 67 through 94 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 95 through 122 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 123 through 139 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 500 through 500 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A TYR 5 ? A TYR 5 6 1 Y 1 A ARG 6 ? A ARG 6 7 1 Y 1 A ASP 7 ? A ASP 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A ILE 9 ? A ILE 9 10 1 Y 1 A ARG 10 ? A ARG 10 11 1 Y 1 A ASN 11 ? A ASN 11 12 1 Y 1 A THR 12 ? A THR 12 13 1 Y 1 A PRO 13 ? A PRO 13 14 1 Y 1 A MET 14 ? A MET 14 15 1 Y 1 A PRO 15 ? A PRO 15 16 1 Y 1 A ASP 16 ? A ASP 16 17 1 Y 1 A THR 17 ? A THR 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A GLN 19 ? A GLN 19 20 1 Y 1 A GLU 140 ? A GLU 140 21 1 Y 1 A HIS 141 ? A HIS 141 22 1 Y 1 A HIS 142 ? A HIS 142 23 1 Y 1 A HIS 143 ? A HIS 143 24 1 Y 1 A HIS 144 ? A HIS 144 25 1 Y 1 A HIS 145 ? A HIS 145 26 1 Y 1 A HIS 146 ? A HIS 146 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FMN N1 N N N 88 FMN C2 C N N 89 FMN O2 O N N 90 FMN N3 N N N 91 FMN C4 C N N 92 FMN O4 O N N 93 FMN C4A C N N 94 FMN N5 N N N 95 FMN C5A C Y N 96 FMN C6 C Y N 97 FMN C7 C Y N 98 FMN C7M C N N 99 FMN C8 C Y N 100 FMN C8M C N N 101 FMN C9 C Y N 102 FMN C9A C Y N 103 FMN N10 N N N 104 FMN C10 C N N 105 FMN "C1'" C N N 106 FMN "C2'" C N S 107 FMN "O2'" O N N 108 FMN "C3'" C N S 109 FMN "O3'" O N N 110 FMN "C4'" C N R 111 FMN "O4'" O N N 112 FMN "C5'" C N N 113 FMN "O5'" O N N 114 FMN P P N N 115 FMN O1P O N N 116 FMN O2P O N N 117 FMN O3P O N N 118 FMN HN3 H N N 119 FMN H6 H N N 120 FMN HM71 H N N 121 FMN HM72 H N N 122 FMN HM73 H N N 123 FMN HM81 H N N 124 FMN HM82 H N N 125 FMN HM83 H N N 126 FMN H9 H N N 127 FMN "H1'1" H N N 128 FMN "H1'2" H N N 129 FMN "H2'" H N N 130 FMN "HO2'" H N N 131 FMN "H3'" H N N 132 FMN "HO3'" H N N 133 FMN "H4'" H N N 134 FMN "HO4'" H N N 135 FMN "H5'1" H N N 136 FMN "H5'2" H N N 137 FMN HOP2 H N N 138 FMN HOP3 H N N 139 GLN N N N N 140 GLN CA C N S 141 GLN C C N N 142 GLN O O N N 143 GLN CB C N N 144 GLN CG C N N 145 GLN CD C N N 146 GLN OE1 O N N 147 GLN NE2 N N N 148 GLN OXT O N N 149 GLN H H N N 150 GLN H2 H N N 151 GLN HA H N N 152 GLN HB2 H N N 153 GLN HB3 H N N 154 GLN HG2 H N N 155 GLN HG3 H N N 156 GLN HE21 H N N 157 GLN HE22 H N N 158 GLN HXT H N N 159 GLU N N N N 160 GLU CA C N S 161 GLU C C N N 162 GLU O O N N 163 GLU CB C N N 164 GLU CG C N N 165 GLU CD C N N 166 GLU OE1 O N N 167 GLU OE2 O N N 168 GLU OXT O N N 169 GLU H H N N 170 GLU H2 H N N 171 GLU HA H N N 172 GLU HB2 H N N 173 GLU HB3 H N N 174 GLU HG2 H N N 175 GLU HG3 H N N 176 GLU HE2 H N N 177 GLU HXT H N N 178 GLY N N N N 179 GLY CA C N N 180 GLY C C N N 181 GLY O O N N 182 GLY OXT O N N 183 GLY H H N N 184 GLY H2 H N N 185 GLY HA2 H N N 186 GLY HA3 H N N 187 GLY HXT H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 HOH O O N N 210 HOH H1 H N N 211 HOH H2 H N N 212 ILE N N N N 213 ILE CA C N S 214 ILE C C N N 215 ILE O O N N 216 ILE CB C N S 217 ILE CG1 C N N 218 ILE CG2 C N N 219 ILE CD1 C N N 220 ILE OXT O N N 221 ILE H H N N 222 ILE H2 H N N 223 ILE HA H N N 224 ILE HB H N N 225 ILE HG12 H N N 226 ILE HG13 H N N 227 ILE HG21 H N N 228 ILE HG22 H N N 229 ILE HG23 H N N 230 ILE HD11 H N N 231 ILE HD12 H N N 232 ILE HD13 H N N 233 ILE HXT H N N 234 LEU N N N N 235 LEU CA C N S 236 LEU C C N N 237 LEU O O N N 238 LEU CB C N N 239 LEU CG C N N 240 LEU CD1 C N N 241 LEU CD2 C N N 242 LEU OXT O N N 243 LEU H H N N 244 LEU H2 H N N 245 LEU HA H N N 246 LEU HB2 H N N 247 LEU HB3 H N N 248 LEU HG H N N 249 LEU HD11 H N N 250 LEU HD12 H N N 251 LEU HD13 H N N 252 LEU HD21 H N N 253 LEU HD22 H N N 254 LEU HD23 H N N 255 LEU HXT H N N 256 LYS N N N N 257 LYS CA C N S 258 LYS C C N N 259 LYS O O N N 260 LYS CB C N N 261 LYS CG C N N 262 LYS CD C N N 263 LYS CE C N N 264 LYS NZ N N N 265 LYS OXT O N N 266 LYS H H N N 267 LYS H2 H N N 268 LYS HA H N N 269 LYS HB2 H N N 270 LYS HB3 H N N 271 LYS HG2 H N N 272 LYS HG3 H N N 273 LYS HD2 H N N 274 LYS HD3 H N N 275 LYS HE2 H N N 276 LYS HE3 H N N 277 LYS HZ1 H N N 278 LYS HZ2 H N N 279 LYS HZ3 H N N 280 LYS HXT H N N 281 MET N N N N 282 MET CA C N S 283 MET C C N N 284 MET O O N N 285 MET CB C N N 286 MET CG C N N 287 MET SD S N N 288 MET CE C N N 289 MET OXT O N N 290 MET H H N N 291 MET H2 H N N 292 MET HA H N N 293 MET HB2 H N N 294 MET HB3 H N N 295 MET HG2 H N N 296 MET HG3 H N N 297 MET HE1 H N N 298 MET HE2 H N N 299 MET HE3 H N N 300 MET HXT H N N 301 PHE N N N N 302 PHE CA C N S 303 PHE C C N N 304 PHE O O N N 305 PHE CB C N N 306 PHE CG C Y N 307 PHE CD1 C Y N 308 PHE CD2 C Y N 309 PHE CE1 C Y N 310 PHE CE2 C Y N 311 PHE CZ C Y N 312 PHE OXT O N N 313 PHE H H N N 314 PHE H2 H N N 315 PHE HA H N N 316 PHE HB2 H N N 317 PHE HB3 H N N 318 PHE HD1 H N N 319 PHE HD2 H N N 320 PHE HE1 H N N 321 PHE HE2 H N N 322 PHE HZ H N N 323 PHE HXT H N N 324 PRO N N N N 325 PRO CA C N S 326 PRO C C N N 327 PRO O O N N 328 PRO CB C N N 329 PRO CG C N N 330 PRO CD C N N 331 PRO OXT O N N 332 PRO H H N N 333 PRO HA H N N 334 PRO HB2 H N N 335 PRO HB3 H N N 336 PRO HG2 H N N 337 PRO HG3 H N N 338 PRO HD2 H N N 339 PRO HD3 H N N 340 PRO HXT H N N 341 SER N N N N 342 SER CA C N S 343 SER C C N N 344 SER O O N N 345 SER CB C N N 346 SER OG O N N 347 SER OXT O N N 348 SER H H N N 349 SER H2 H N N 350 SER HA H N N 351 SER HB2 H N N 352 SER HB3 H N N 353 SER HG H N N 354 SER HXT H N N 355 THR N N N N 356 THR CA C N S 357 THR C C N N 358 THR O O N N 359 THR CB C N R 360 THR OG1 O N N 361 THR CG2 C N N 362 THR OXT O N N 363 THR H H N N 364 THR H2 H N N 365 THR HA H N N 366 THR HB H N N 367 THR HG1 H N N 368 THR HG21 H N N 369 THR HG22 H N N 370 THR HG23 H N N 371 THR HXT H N N 372 TYR N N N N 373 TYR CA C N S 374 TYR C C N N 375 TYR O O N N 376 TYR CB C N N 377 TYR CG C Y N 378 TYR CD1 C Y N 379 TYR CD2 C Y N 380 TYR CE1 C Y N 381 TYR CE2 C Y N 382 TYR CZ C Y N 383 TYR OH O N N 384 TYR OXT O N N 385 TYR H H N N 386 TYR H2 H N N 387 TYR HA H N N 388 TYR HB2 H N N 389 TYR HB3 H N N 390 TYR HD1 H N N 391 TYR HD2 H N N 392 TYR HE1 H N N 393 TYR HE2 H N N 394 TYR HH H N N 395 TYR HXT H N N 396 VAL N N N N 397 VAL CA C N S 398 VAL C C N N 399 VAL O O N N 400 VAL CB C N N 401 VAL CG1 C N N 402 VAL CG2 C N N 403 VAL OXT O N N 404 VAL H H N N 405 VAL H2 H N N 406 VAL HA H N N 407 VAL HB H N N 408 VAL HG11 H N N 409 VAL HG12 H N N 410 VAL HG13 H N N 411 VAL HG21 H N N 412 VAL HG22 H N N 413 VAL HG23 H N N 414 VAL HXT H N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FMN N1 C2 sing N N 83 FMN N1 C10 doub N N 84 FMN C2 O2 doub N N 85 FMN C2 N3 sing N N 86 FMN N3 C4 sing N N 87 FMN N3 HN3 sing N N 88 FMN C4 O4 doub N N 89 FMN C4 C4A sing N N 90 FMN C4A N5 doub N N 91 FMN C4A C10 sing N N 92 FMN N5 C5A sing N N 93 FMN C5A C6 doub Y N 94 FMN C5A C9A sing Y N 95 FMN C6 C7 sing Y N 96 FMN C6 H6 sing N N 97 FMN C7 C7M sing N N 98 FMN C7 C8 doub Y N 99 FMN C7M HM71 sing N N 100 FMN C7M HM72 sing N N 101 FMN C7M HM73 sing N N 102 FMN C8 C8M sing N N 103 FMN C8 C9 sing Y N 104 FMN C8M HM81 sing N N 105 FMN C8M HM82 sing N N 106 FMN C8M HM83 sing N N 107 FMN C9 C9A doub Y N 108 FMN C9 H9 sing N N 109 FMN C9A N10 sing N N 110 FMN N10 C10 sing N N 111 FMN N10 "C1'" sing N N 112 FMN "C1'" "C2'" sing N N 113 FMN "C1'" "H1'1" sing N N 114 FMN "C1'" "H1'2" sing N N 115 FMN "C2'" "O2'" sing N N 116 FMN "C2'" "C3'" sing N N 117 FMN "C2'" "H2'" sing N N 118 FMN "O2'" "HO2'" sing N N 119 FMN "C3'" "O3'" sing N N 120 FMN "C3'" "C4'" sing N N 121 FMN "C3'" "H3'" sing N N 122 FMN "O3'" "HO3'" sing N N 123 FMN "C4'" "O4'" sing N N 124 FMN "C4'" "C5'" sing N N 125 FMN "C4'" "H4'" sing N N 126 FMN "O4'" "HO4'" sing N N 127 FMN "C5'" "O5'" sing N N 128 FMN "C5'" "H5'1" sing N N 129 FMN "C5'" "H5'2" sing N N 130 FMN "O5'" P sing N N 131 FMN P O1P doub N N 132 FMN P O2P sing N N 133 FMN P O3P sing N N 134 FMN O2P HOP2 sing N N 135 FMN O3P HOP3 sing N N 136 GLN N CA sing N N 137 GLN N H sing N N 138 GLN N H2 sing N N 139 GLN CA C sing N N 140 GLN CA CB sing N N 141 GLN CA HA sing N N 142 GLN C O doub N N 143 GLN C OXT sing N N 144 GLN CB CG sing N N 145 GLN CB HB2 sing N N 146 GLN CB HB3 sing N N 147 GLN CG CD sing N N 148 GLN CG HG2 sing N N 149 GLN CG HG3 sing N N 150 GLN CD OE1 doub N N 151 GLN CD NE2 sing N N 152 GLN NE2 HE21 sing N N 153 GLN NE2 HE22 sing N N 154 GLN OXT HXT sing N N 155 GLU N CA sing N N 156 GLU N H sing N N 157 GLU N H2 sing N N 158 GLU CA C sing N N 159 GLU CA CB sing N N 160 GLU CA HA sing N N 161 GLU C O doub N N 162 GLU C OXT sing N N 163 GLU CB CG sing N N 164 GLU CB HB2 sing N N 165 GLU CB HB3 sing N N 166 GLU CG CD sing N N 167 GLU CG HG2 sing N N 168 GLU CG HG3 sing N N 169 GLU CD OE1 doub N N 170 GLU CD OE2 sing N N 171 GLU OE2 HE2 sing N N 172 GLU OXT HXT sing N N 173 GLY N CA sing N N 174 GLY N H sing N N 175 GLY N H2 sing N N 176 GLY CA C sing N N 177 GLY CA HA2 sing N N 178 GLY CA HA3 sing N N 179 GLY C O doub N N 180 GLY C OXT sing N N 181 GLY OXT HXT sing N N 182 HIS N CA sing N N 183 HIS N H sing N N 184 HIS N H2 sing N N 185 HIS CA C sing N N 186 HIS CA CB sing N N 187 HIS CA HA sing N N 188 HIS C O doub N N 189 HIS C OXT sing N N 190 HIS CB CG sing N N 191 HIS CB HB2 sing N N 192 HIS CB HB3 sing N N 193 HIS CG ND1 sing Y N 194 HIS CG CD2 doub Y N 195 HIS ND1 CE1 doub Y N 196 HIS ND1 HD1 sing N N 197 HIS CD2 NE2 sing Y N 198 HIS CD2 HD2 sing N N 199 HIS CE1 NE2 sing Y N 200 HIS CE1 HE1 sing N N 201 HIS NE2 HE2 sing N N 202 HIS OXT HXT sing N N 203 HOH O H1 sing N N 204 HOH O H2 sing N N 205 ILE N CA sing N N 206 ILE N H sing N N 207 ILE N H2 sing N N 208 ILE CA C sing N N 209 ILE CA CB sing N N 210 ILE CA HA sing N N 211 ILE C O doub N N 212 ILE C OXT sing N N 213 ILE CB CG1 sing N N 214 ILE CB CG2 sing N N 215 ILE CB HB sing N N 216 ILE CG1 CD1 sing N N 217 ILE CG1 HG12 sing N N 218 ILE CG1 HG13 sing N N 219 ILE CG2 HG21 sing N N 220 ILE CG2 HG22 sing N N 221 ILE CG2 HG23 sing N N 222 ILE CD1 HD11 sing N N 223 ILE CD1 HD12 sing N N 224 ILE CD1 HD13 sing N N 225 ILE OXT HXT sing N N 226 LEU N CA sing N N 227 LEU N H sing N N 228 LEU N H2 sing N N 229 LEU CA C sing N N 230 LEU CA CB sing N N 231 LEU CA HA sing N N 232 LEU C O doub N N 233 LEU C OXT sing N N 234 LEU CB CG sing N N 235 LEU CB HB2 sing N N 236 LEU CB HB3 sing N N 237 LEU CG CD1 sing N N 238 LEU CG CD2 sing N N 239 LEU CG HG sing N N 240 LEU CD1 HD11 sing N N 241 LEU CD1 HD12 sing N N 242 LEU CD1 HD13 sing N N 243 LEU CD2 HD21 sing N N 244 LEU CD2 HD22 sing N N 245 LEU CD2 HD23 sing N N 246 LEU OXT HXT sing N N 247 LYS N CA sing N N 248 LYS N H sing N N 249 LYS N H2 sing N N 250 LYS CA C sing N N 251 LYS CA CB sing N N 252 LYS CA HA sing N N 253 LYS C O doub N N 254 LYS C OXT sing N N 255 LYS CB CG sing N N 256 LYS CB HB2 sing N N 257 LYS CB HB3 sing N N 258 LYS CG CD sing N N 259 LYS CG HG2 sing N N 260 LYS CG HG3 sing N N 261 LYS CD CE sing N N 262 LYS CD HD2 sing N N 263 LYS CD HD3 sing N N 264 LYS CE NZ sing N N 265 LYS CE HE2 sing N N 266 LYS CE HE3 sing N N 267 LYS NZ HZ1 sing N N 268 LYS NZ HZ2 sing N N 269 LYS NZ HZ3 sing N N 270 LYS OXT HXT sing N N 271 MET N CA sing N N 272 MET N H sing N N 273 MET N H2 sing N N 274 MET CA C sing N N 275 MET CA CB sing N N 276 MET CA HA sing N N 277 MET C O doub N N 278 MET C OXT sing N N 279 MET CB CG sing N N 280 MET CB HB2 sing N N 281 MET CB HB3 sing N N 282 MET CG SD sing N N 283 MET CG HG2 sing N N 284 MET CG HG3 sing N N 285 MET SD CE sing N N 286 MET CE HE1 sing N N 287 MET CE HE2 sing N N 288 MET CE HE3 sing N N 289 MET OXT HXT sing N N 290 PHE N CA sing N N 291 PHE N H sing N N 292 PHE N H2 sing N N 293 PHE CA C sing N N 294 PHE CA CB sing N N 295 PHE CA HA sing N N 296 PHE C O doub N N 297 PHE C OXT sing N N 298 PHE CB CG sing N N 299 PHE CB HB2 sing N N 300 PHE CB HB3 sing N N 301 PHE CG CD1 doub Y N 302 PHE CG CD2 sing Y N 303 PHE CD1 CE1 sing Y N 304 PHE CD1 HD1 sing N N 305 PHE CD2 CE2 doub Y N 306 PHE CD2 HD2 sing N N 307 PHE CE1 CZ doub Y N 308 PHE CE1 HE1 sing N N 309 PHE CE2 CZ sing Y N 310 PHE CE2 HE2 sing N N 311 PHE CZ HZ sing N N 312 PHE OXT HXT sing N N 313 PRO N CA sing N N 314 PRO N CD sing N N 315 PRO N H sing N N 316 PRO CA C sing N N 317 PRO CA CB sing N N 318 PRO CA HA sing N N 319 PRO C O doub N N 320 PRO C OXT sing N N 321 PRO CB CG sing N N 322 PRO CB HB2 sing N N 323 PRO CB HB3 sing N N 324 PRO CG CD sing N N 325 PRO CG HG2 sing N N 326 PRO CG HG3 sing N N 327 PRO CD HD2 sing N N 328 PRO CD HD3 sing N N 329 PRO OXT HXT sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TYR N CA sing N N 360 TYR N H sing N N 361 TYR N H2 sing N N 362 TYR CA C sing N N 363 TYR CA CB sing N N 364 TYR CA HA sing N N 365 TYR C O doub N N 366 TYR C OXT sing N N 367 TYR CB CG sing N N 368 TYR CB HB2 sing N N 369 TYR CB HB3 sing N N 370 TYR CG CD1 doub Y N 371 TYR CG CD2 sing Y N 372 TYR CD1 CE1 sing Y N 373 TYR CD1 HD1 sing N N 374 TYR CD2 CE2 doub Y N 375 TYR CD2 HD2 sing N N 376 TYR CE1 CZ doub Y N 377 TYR CE1 HE1 sing N N 378 TYR CE2 CZ sing Y N 379 TYR CE2 HE2 sing N N 380 TYR CZ OH sing N N 381 TYR OH HH sing N N 382 TYR OXT HXT sing N N 383 VAL N CA sing N N 384 VAL N H sing N N 385 VAL N H2 sing N N 386 VAL CA C sing N N 387 VAL CA CB sing N N 388 VAL CA HA sing N N 389 VAL C O doub N N 390 VAL C OXT sing N N 391 VAL CB CG1 sing N N 392 VAL CB CG2 sing N N 393 VAL CB HB sing N N 394 VAL CG1 HG11 sing N N 395 VAL CG1 HG12 sing N N 396 VAL CG1 HG13 sing N N 397 VAL CG2 HG21 sing N N 398 VAL CG2 HG22 sing N N 399 VAL CG2 HG23 sing N N 400 VAL OXT HXT sing N N 401 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4KUK _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6GBA _atom_sites.fract_transf_matrix[1][1] 0.011126 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004707 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032330 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022100 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_