data_6GE2
#
_entry.id 6GE2
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.308
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
PDB 6GE2
WWPDB D_1200009812
BMRB 34266
#
_pdbx_database_related.db_name BMRB
_pdbx_database_related.details 'exendin-4 based dual GLP-1/glucagon receptor agonist'
_pdbx_database_related.db_id 34266
_pdbx_database_related.content_type unspecified
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf ?
_pdbx_database_status.status_code_mr REL
_pdbx_database_status.entry_id 6GE2
_pdbx_database_status.recvd_initial_deposition_date 2018-04-25
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site PDBE
_pdbx_database_status.process_site PDBE
_pdbx_database_status.status_code_cs REL
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Evers, A.' 1 ?
'Kurz, M.' 2 ?
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country US
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev 'J. Med. Chem.'
_citation.journal_id_ASTM JMCMAR
_citation.journal_id_CSD 0151
_citation.journal_id_ISSN 1520-4804
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 61
_citation.language ?
_citation.page_first 5580
_citation.page_last 5593
_citation.title
'Dual Glucagon-like Peptide 1 (GLP-1)/Glucagon Receptor Agonists Specifically Optimized for Multidose Formulations.'
_citation.year 2018
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.8b00292
_citation.pdbx_database_id_PubMed 29879354
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Evers, A.' 1 ?
primary 'Bossart, M.' 2 ?
primary 'Pfeiffer-Marek, S.' 3 ?
primary 'Elvert, R.' 4 ?
primary 'Schreuder, H.' 5 ?
primary 'Kurz, M.' 6 ?
primary 'Stengelin, S.' 7 ?
primary 'Lorenz, M.' 8 ?
primary 'Herling, A.' 9 ?
primary 'Konkar, A.' 10 ?
primary 'Lukasczyk, U.' 11 ?
primary 'Pfenninger, A.' 12 ?
primary 'Lorenz, K.' 13 ?
primary 'Haack, T.' 14 ?
primary 'Kadereit, D.' 15 ?
primary 'Wagner, M.' 16 ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer syn Exendin-4
4280.880 1 ? ? ? ?
2 non-polymer syn '(2~{S})-2-[[(4~{S})-4-(hexadecanoylamino)-5-oxidanyl-5-oxidanylidene-pentanoyl]amino]pentanedioic acid' 514.652
1 ? ? ? ?
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer yes
_entity_poly.pdbx_seq_one_letter_code 'H(AIB)QGTFTSDLSKQKDEQRAKLFIEWL(AIB)AGGPPS(AIB)KPPPK(NH2)'
_entity_poly.pdbx_seq_one_letter_code_can HAQGTFTSDLSKQKDEQRAKLFIEWLAAGGPPSAKPPPKX
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 HIS n
1 2 AIB n
1 3 GLN n
1 4 GLY n
1 5 THR n
1 6 PHE n
1 7 THR n
1 8 SER n
1 9 ASP n
1 10 LEU n
1 11 SER n
1 12 LYS n
1 13 GLN n
1 14 LYS n
1 15 ASP n
1 16 GLU n
1 17 GLN n
1 18 ARG n
1 19 ALA n
1 20 LYS n
1 21 LEU n
1 22 PHE n
1 23 ILE n
1 24 GLU n
1 25 TRP n
1 26 LEU n
1 27 AIB n
1 28 ALA n
1 29 GLY n
1 30 GLY n
1 31 PRO n
1 32 PRO n
1 33 SER n
1 34 AIB n
1 35 LYS n
1 36 PRO n
1 37 PRO n
1 38 PRO n
1 39 LYS n
1 40 NH2 n
#
_pdbx_entity_src_syn.entity_id 1
_pdbx_entity_src_syn.pdbx_src_id 1
_pdbx_entity_src_syn.pdbx_alt_source_flag sample
_pdbx_entity_src_syn.pdbx_beg_seq_num 1
_pdbx_entity_src_syn.pdbx_end_seq_num 40
_pdbx_entity_src_syn.organism_scientific 'Heloderma suspectum'
_pdbx_entity_src_syn.organism_common_name 'Gila monster'
_pdbx_entity_src_syn.ncbi_taxonomy_id 8554
_pdbx_entity_src_syn.details ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code EXE4_HELSU
_struct_ref.pdbx_db_accession P26349
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
_struct_ref.pdbx_align_begin 48
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 6GE2
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 1
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 39
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession P26349
_struct_ref_seq.db_align_beg 48
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 86
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 1
_struct_ref_seq.pdbx_auth_seq_align_end 39
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 6GE2 AIB A 2 ? UNP P26349 GLY 49 conflict 2 1
1 6GE2 GLN A 3 ? UNP P26349 GLU 50 conflict 3 2
1 6GE2 LYS A 14 ? UNP P26349 MET 61 conflict 14 3
1 6GE2 ASP A 15 ? UNP P26349 GLU 62 conflict 15 4
1 6GE2 GLN A 17 ? UNP P26349 GLU 64 conflict 17 5
1 6GE2 ARG A 18 ? UNP P26349 ALA 65 conflict 18 6
1 6GE2 ALA A 19 ? UNP P26349 VAL 66 conflict 19 7
1 6GE2 LYS A 20 ? UNP P26349 ARG 67 conflict 20 8
1 6GE2 AIB A 27 ? UNP P26349 LYS 74 conflict 27 9
1 6GE2 ALA A 28 ? UNP P26349 ASN 75 conflict 28 10
1 6GE2 PRO A 32 ? UNP P26349 SER 79 conflict 32 11
1 6GE2 AIB A 34 ? UNP P26349 GLY 81 conflict 34 12
1 6GE2 LYS A 35 ? UNP P26349 ALA 82 conflict 35 13
1 6GE2 LYS A 39 ? UNP P26349 SER 86 conflict 39 14
1 6GE2 NH2 A 40 ? UNP P26349 ? ? amidation 40 15
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
AIB 'L-peptide linking' n 'ALPHA-AMINOISOBUTYRIC ACID'
? 'C4 H9 N O2' 103.120
ALA 'L-peptide linking' y ALANINE
? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE
? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE
? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID'
? 'C4 H7 N O4' 133.103
EVT non-polymer . '(2~{S})-2-[[(4~{S})-4-(hexadecanoylamino)-5-oxidanyl-5-oxidanylidene-pentanoyl]amino]pentanedioic acid'
? 'C26 H46 N2 O8' 514.652
GLN 'L-peptide linking' y GLUTAMINE
? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID'
? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE
? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE
? 'C6 H10 N3 O2 1' 156.162
ILE 'L-peptide linking' y ISOLEUCINE
? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE
? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE
? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE
? 'C5 H11 N O2 S' 149.211
NH2 non-polymer . 'AMINO GROUP'
? 'H2 N' 16.023
PHE 'L-peptide linking' y PHENYLALANINE
? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE
? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE
? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE
? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN
? 'C11 H12 N2 O2' 204.225
VAL 'L-peptide linking' y VALINE
? 'C5 H11 N O2' 117.146
#
loop_
_pdbx_nmr_exptl.experiment_id
_pdbx_nmr_exptl.conditions_id
_pdbx_nmr_exptl.solution_id
_pdbx_nmr_exptl.type
_pdbx_nmr_exptl.spectrometer_id
_pdbx_nmr_exptl.sample_state
1 1 1 '2D 1H-1H COSY' 1 isotropic
2 1 1 '2D 1H-1H TOCSY' 1 isotropic
3 1 1 '2D 1H-1H NOESY' 1 isotropic
4 1 1 '2D 1H-13C HSQC' 2 isotropic
#
_pdbx_nmr_exptl_sample_conditions.conditions_id 1
_pdbx_nmr_exptl_sample_conditions.temperature 310
_pdbx_nmr_exptl_sample_conditions.pressure_units Pa
_pdbx_nmr_exptl_sample_conditions.pressure 1
_pdbx_nmr_exptl_sample_conditions.pH 5.0
_pdbx_nmr_exptl_sample_conditions.ionic_strength '35mM sodium phosphate'
_pdbx_nmr_exptl_sample_conditions.details ?
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.2
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units M
_pdbx_nmr_exptl_sample_conditions.label conditions_1
_pdbx_nmr_exptl_sample_conditions.pH_err 0.05
_pdbx_nmr_exptl_sample_conditions.pH_units pH
_pdbx_nmr_exptl_sample_conditions.pressure_err 0.01
_pdbx_nmr_exptl_sample_conditions.temperature_err 0.2
_pdbx_nmr_exptl_sample_conditions.temperature_units K
#
_pdbx_nmr_sample_details.solution_id 1
_pdbx_nmr_sample_details.contents '5 mg/mL Peptide 12, trifluoroethanol/water'
_pdbx_nmr_sample_details.solvent_system trifluoroethanol/water
_pdbx_nmr_sample_details.label 'Model 1'
_pdbx_nmr_sample_details.type solution
_pdbx_nmr_sample_details.details ?
#
loop_
_pdbx_nmr_spectrometer.spectrometer_id
_pdbx_nmr_spectrometer.model
_pdbx_nmr_spectrometer.type
_pdbx_nmr_spectrometer.manufacturer
_pdbx_nmr_spectrometer.field_strength
_pdbx_nmr_spectrometer.details
1 1 ? Bruker 700 'AVANCE I'
2 2 ? Bruker 500 'AVANCE II'
#
_pdbx_nmr_refine.entry_id 6GE2
_pdbx_nmr_refine.method 'molecular dynamics'
_pdbx_nmr_refine.details ?
_pdbx_nmr_refine.software_ordinal 2
#
_pdbx_nmr_ensemble.entry_id 6GE2
_pdbx_nmr_ensemble.conformers_calculated_total_number 20
_pdbx_nmr_ensemble.conformers_submitted_total_number 10
_pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations'
_pdbx_nmr_ensemble.representative_conformer ?
_pdbx_nmr_ensemble.average_constraints_per_residue ?
_pdbx_nmr_ensemble.average_constraint_violations_per_residue ?
_pdbx_nmr_ensemble.maximum_distance_constraint_violation ?
_pdbx_nmr_ensemble.average_distance_constraint_violation ?
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ?
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ?
_pdbx_nmr_ensemble.distance_constraint_violation_method ?
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ?
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ?
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ?
#
_pdbx_nmr_representative.entry_id 6GE2
_pdbx_nmr_representative.conformer_id 1
_pdbx_nmr_representative.selection_criteria 'fewest violations'
#
loop_
_pdbx_nmr_software.ordinal
_pdbx_nmr_software.classification
_pdbx_nmr_software.name
_pdbx_nmr_software.version
_pdbx_nmr_software.authors
1 'chemical shift assignment' TopSpin 3.2 'Bruker Biospin'
2 'structure calculation' SYBYL 2.1.1 Tripos
3 'chemical shift assignment' CARA 1.8.4.2 'Keller and Wuthrich'
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 6GE2
_exptl.crystals_number ?
_exptl.details ?
_exptl.method 'SOLUTION NMR'
_exptl.method_details ?
#
_struct.entry_id 6GE2
_struct.title 'exendin-4 based dual GLP-1/glucagon receptor agonist'
_struct.pdbx_descriptor Exendin-4
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 6GE2
_struct_keywords.text HORMONE
_struct_keywords.pdbx_keywords HORMONE
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 GLY A 4 ? GLY A 30 ? GLY A 4 GLY A 30 1 ? 27
HELX_P HELX_P2 AA2 PRO A 31 ? AIB A 34 ? PRO A 31 AIB A 34 5 ? 4
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
covale1 covale both ? A HIS 1 C ? ? ? 1_555 A AIB 2 N ? ? A HIS 1 A AIB 2 1_555 ? ? ? ? ? ? ? 1.354 ?
covale2 covale both ? A AIB 2 C ? ? ? 1_555 A GLN 3 N ? ? A AIB 2 A GLN 3 1_555 ? ? ? ? ? ? ? 1.353 ?
covale3 covale one ? A LYS 14 NZ ? ? ? 1_555 B EVT . C33 ? ? A LYS 14 A EVT 101 1_555 ? ? ? ? ? ? ? 1.353 ?
covale4 covale both ? A LEU 26 C ? ? ? 1_555 A AIB 27 N ? ? A LEU 26 A AIB 27 1_555 ? ? ? ? ? ? ? 1.355 ?
covale5 covale both ? A AIB 27 C ? ? ? 1_555 A ALA 28 N ? ? A AIB 27 A ALA 28 1_555 ? ? ? ? ? ? ? 1.353 ?
covale6 covale both ? A SER 33 C ? ? ? 1_555 A AIB 34 N ? ? A SER 33 A AIB 34 1_555 ? ? ? ? ? ? ? 1.353 ?
covale7 covale both ? A AIB 34 C ? ? ? 1_555 A LYS 35 N ? ? A AIB 34 A LYS 35 1_555 ? ? ? ? ? ? ? 1.356 ?
covale8 covale both ? A LYS 39 C ? ? ? 1_555 A NH2 40 N ? ? A LYS 39 A NH2 40 1_555 ? ? ? ? ? ? ? 1.350 ?
#
_struct_conn_type.id covale
_struct_conn_type.criteria ?
_struct_conn_type.reference ?
#
loop_
_struct_site.id
_struct_site.pdbx_evidence_code
_struct_site.pdbx_auth_asym_id
_struct_site.pdbx_auth_comp_id
_struct_site.pdbx_auth_seq_id
_struct_site.pdbx_auth_ins_code
_struct_site.pdbx_num_residues
_struct_site.details
AC1 Software A EVT 101 ? 4 'binding site for residue EVT A 101'
AC2 Software A AIB 34 ? 5 'binding site for Ligand residues AIB A 34 through LYS A 35 bound to SER A 33'
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 4 LEU A 10 ? LEU A 10 . ? 1_555 ?
2 AC1 4 SER A 11 ? SER A 11 . ? 1_555 ?
3 AC1 4 LYS A 14 ? LYS A 14 . ? 1_555 ?
4 AC1 4 ARG A 18 ? ARG A 18 . ? 1_555 ?
5 AC2 5 TRP A 25 ? TRP A 25 . ? 1_555 ?
6 AC2 5 PRO A 31 ? PRO A 31 . ? 1_555 ?
7 AC2 5 PRO A 32 ? PRO A 32 . ? 1_555 ?
8 AC2 5 SER A 33 ? SER A 33 . ? 1_555 ?
9 AC2 5 PRO A 36 ? PRO A 36 . ? 1_555 ?
#
_atom_sites.entry_id 6GE2
_atom_sites.fract_transf_matrix[1][1] 1.000000
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 1.000000
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 1.000000
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
#
loop_
_atom_type.symbol
C
H
N
O
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 HIS 1 1 1 HIS HIS A . n
A 1 2 AIB 2 2 2 AIB AIB A . n
A 1 3 GLN 3 3 3 GLN GLN A . n
A 1 4 GLY 4 4 4 GLY GLY A . n
A 1 5 THR 5 5 5 THR THR A . n
A 1 6 PHE 6 6 6 PHE PHE A . n
A 1 7 THR 7 7 7 THR THR A . n
A 1 8 SER 8 8 8 SER SER A . n
A 1 9 ASP 9 9 9 ASP ASP A . n
A 1 10 LEU 10 10 10 LEU LEU A . n
A 1 11 SER 11 11 11 SER SER A . n
A 1 12 LYS 12 12 12 LYS LYS A . n
A 1 13 GLN 13 13 13 GLN GLN A . n
A 1 14 LYS 14 14 14 LYS LYS A . n
A 1 15 ASP 15 15 15 ASP ASP A . n
A 1 16 GLU 16 16 16 GLU GLU A . n
A 1 17 GLN 17 17 17 GLN GLN A . n
A 1 18 ARG 18 18 18 ARG ARG A . n
A 1 19 ALA 19 19 19 ALA ALA A . n
A 1 20 LYS 20 20 20 LYS LYS A . n
A 1 21 LEU 21 21 21 LEU LEU A . n
A 1 22 PHE 22 22 22 PHE PHE A . n
A 1 23 ILE 23 23 23 ILE ILE A . n
A 1 24 GLU 24 24 24 GLU GLU A . n
A 1 25 TRP 25 25 25 TRP TRP A . n
A 1 26 LEU 26 26 26 LEU LEU A . n
A 1 27 AIB 27 27 27 AIB ALA A . n
A 1 28 ALA 28 28 28 ALA ALA A . n
A 1 29 GLY 29 29 29 GLY GLY A . n
A 1 30 GLY 30 30 30 GLY GLY A . n
A 1 31 PRO 31 31 31 PRO PRO A . n
A 1 32 PRO 32 32 32 PRO PRO A . n
A 1 33 SER 33 33 33 SER SER A . n
A 1 34 AIB 34 34 34 AIB AIB A . n
A 1 35 LYS 35 35 35 LYS LYS A . n
A 1 36 PRO 36 36 36 PRO PRO A . n
A 1 37 PRO 37 37 37 PRO PRO A . n
A 1 38 PRO 38 38 38 PRO PRO A . n
A 1 39 LYS 39 39 39 LYS LYS A . n
A 1 40 NH2 40 40 39 NH2 LYS A . n
#
_pdbx_nonpoly_scheme.asym_id B
_pdbx_nonpoly_scheme.entity_id 2
_pdbx_nonpoly_scheme.mon_id EVT
_pdbx_nonpoly_scheme.ndb_seq_num 1
_pdbx_nonpoly_scheme.pdb_seq_num 101
_pdbx_nonpoly_scheme.auth_seq_num 40
_pdbx_nonpoly_scheme.pdb_mon_id EVT
_pdbx_nonpoly_scheme.auth_mon_id XXX
_pdbx_nonpoly_scheme.pdb_strand_id A
_pdbx_nonpoly_scheme.pdb_ins_code .
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_and_software_defined_assembly
_pdbx_struct_assembly.method_details PISA
_pdbx_struct_assembly.oligomeric_details monomeric
_pdbx_struct_assembly.oligomeric_count 1
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 120 ?
1 MORE 1 ?
1 'SSA (A^2)' 3870 ?
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation ?
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2018-06-20
2 'Structure model' 1 1 2018-07-25
3 'Structure model' 1 2 2019-05-08
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Data collection'
2 2 'Structure model' 'Database references'
3 3 'Structure model' 'Data collection'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' citation
2 2 'Structure model' citation_author
3 3 'Structure model' pdbx_nmr_software
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.journal_volume'
2 2 'Structure model' '_citation.page_first'
3 2 'Structure model' '_citation.page_last'
4 2 'Structure model' '_citation.title'
5 2 'Structure model' '_citation_author.name'
6 3 'Structure model' '_pdbx_nmr_software.name'
#
_pdbx_nmr_exptl_sample.solution_id 1
_pdbx_nmr_exptl_sample.component 'Peptide 12'
_pdbx_nmr_exptl_sample.concentration 5
_pdbx_nmr_exptl_sample.concentration_range ?
_pdbx_nmr_exptl_sample.concentration_units mg/mL
_pdbx_nmr_exptl_sample.isotopic_labeling none
#
loop_
_pdbx_validate_rmsd_angle.id
_pdbx_validate_rmsd_angle.PDB_model_num
_pdbx_validate_rmsd_angle.auth_atom_id_1
_pdbx_validate_rmsd_angle.auth_asym_id_1
_pdbx_validate_rmsd_angle.auth_comp_id_1
_pdbx_validate_rmsd_angle.auth_seq_id_1
_pdbx_validate_rmsd_angle.PDB_ins_code_1
_pdbx_validate_rmsd_angle.label_alt_id_1
_pdbx_validate_rmsd_angle.auth_atom_id_2
_pdbx_validate_rmsd_angle.auth_asym_id_2
_pdbx_validate_rmsd_angle.auth_comp_id_2
_pdbx_validate_rmsd_angle.auth_seq_id_2
_pdbx_validate_rmsd_angle.PDB_ins_code_2
_pdbx_validate_rmsd_angle.label_alt_id_2
_pdbx_validate_rmsd_angle.auth_atom_id_3
_pdbx_validate_rmsd_angle.auth_asym_id_3
_pdbx_validate_rmsd_angle.auth_comp_id_3
_pdbx_validate_rmsd_angle.auth_seq_id_3
_pdbx_validate_rmsd_angle.PDB_ins_code_3
_pdbx_validate_rmsd_angle.label_alt_id_3
_pdbx_validate_rmsd_angle.angle_value
_pdbx_validate_rmsd_angle.angle_target_value
_pdbx_validate_rmsd_angle.angle_deviation
_pdbx_validate_rmsd_angle.angle_standard_deviation
_pdbx_validate_rmsd_angle.linker_flag
1 1 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.15 107.30 -5.15 0.80 N
2 2 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.34 107.30 -4.96 0.80 N
3 3 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.16 107.30 -5.14 0.80 N
4 5 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 101.98 107.30 -5.32 0.80 N
5 6 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 101.84 107.30 -5.46 0.80 N
6 7 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.45 107.30 -4.85 0.80 N
7 8 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.15 107.30 -5.15 0.80 N
8 9 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.27 107.30 -5.03 0.80 N
9 10 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.17 107.30 -5.13 0.80 N
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 4 LEU A 21 ? ? -57.97 -70.30
2 4 PHE A 22 ? ? -26.25 -64.43
3 5 THR A 5 ? ? 60.62 -81.12
4 9 PHE A 22 ? ? -28.08 -62.03
5 10 THR A 5 ? ? -147.81 -61.89
#
_pdbx_entity_nonpoly.entity_id 2
_pdbx_entity_nonpoly.name
'(2~{S})-2-[[(4~{S})-4-(hexadecanoylamino)-5-oxidanyl-5-oxidanylidene-pentanoyl]amino]pentanedioic acid'
_pdbx_entity_nonpoly.comp_id EVT
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support none
_pdbx_struct_assembly_auth_evidence.details ?
#