data_6GF7 # _entry.id 6GF7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6GF7 WWPDB D_1200009792 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'High-resolution native' 6GF6 unspecified PDB 'Orthorhombic crystal form of the same protein, fully glycosylated' 6GF8 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GF7 _pdbx_database_status.recvd_initial_deposition_date 2018-04-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nishimura, K.' 1 ? 'Jovine, L.' 2 0000-0002-2679-6946 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Nat Commun' ? ? 2041-1723 ? ? 10 ? 3086 3086 'Molecular basis of egg coat cross-linking sheds light on ZP1-associated female infertility.' 2019 ? 10.1038/s41467-019-10931-5 31300655 ? ? ? ? ? ? ? ? UK ? ? 1 'J. Mol. Biol.' JMOBAK 0070 0022-2836 ? ? 181 ? 253 264 'Mouse egg extracellular coat is a matrix of interconnected filaments possessing a structural repeat.' 1985 ? ? 3845123 ? ? ? ? ? ? ? ? UK ? ? 2 Development ? ? 0950-1991 ? ? 126 ? 3847 3855 'Abnormal zonae pellucidae in mice lacking ZP1 result in early embryonic loss.' 1999 ? ? 10433913 ? ? ? ? ? ? ? ? ? ? ? 3 'Biol. Reprod.' ? ? 0006-3363 ? ? 64 ? 822 830 ;Morphological and biochemical changes of isolated chicken egg-envelope during sperm penetration: degradation of the 97-kilodalton glycoprotein is involved in sperm-driven hole formation on the egg-envelope. ; 2001 ? ? 11207197 ? ? ? ? ? ? ? ? UK ? ? 4 'Biochem. J.' BIJOAK 0043 1470-8728 ? ? 384 ? 191 199 ;A newly identified zona pellucida glycoprotein, ZPD, and dimeric ZP1 of chicken egg envelope are involved in sperm activation on sperm-egg interaction. ; 2004 ? 10.1042/BJ20040299 15264999 ? ? ? ? ? ? ? ? US ? ? 5 'N. Engl. J. Med.' ? ? 1533-4406 ? ? 370 ? 1220 1226 'Mutant ZP1 in familial infertility.' 2014 ? 10.1056/NEJMoa1308851 24670168 ? ? ? ? ? ? ? ? NE ? ? 6 'FEBS Open Bio' ? ? 2211-5463 ? ? 5 ? 454 465 ;Identification of distinctive interdomain interactions among ZP-N, ZP-C and other domains of zona pellucida glycoproteins underlying association of chicken egg-coat matrix. ; 2015 ? 10.1016/j.fob.2015.05.005 26106520 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nishimura, K.' 1 ? primary 'Dioguardi, E.' 2 ? primary 'Nishio, S.' 3 ? primary 'Villa, A.' 4 ? primary 'Han, L.' 5 ? primary 'Matsuda, T.' 6 ? primary 'Jovine, L.' 7 ? 1 'Greve, J.M.' 8 ? 1 'Wassarman, P.M.' 9 ? 2 'Rankin, T.' 10 ? 2 'Talbot, P.' 11 ? 2 'Lee, E.' 12 ? 2 'Dean, J.' 13 ? 3 'Takeuchi, Y.' 14 ? 3 'Cho, R.' 15 ? 3 'Iwata, Y.' 16 ? 3 'Nishimura, K.' 17 ? 3 'Kato, T.' 18 ? 3 'Aoki, N.' 19 ? 3 'Kitajima, K.' 20 ? 3 'Matsuda, T.' 21 ? 4 'Okumura, H.' 22 ? 4 'Kohno, Y.' 23 ? 4 'Iwata, Y.' 24 ? 4 'Mori, H.' 25 ? 4 'Aoki, N.' 26 ? 4 'Sato, C.' 27 ? 4 'Kitajima, K.' 28 ? 4 'Nadano, D.' 29 ? 4 'Matsuda, T.' 30 ? 5 'Huang, H.L.' 31 ? 5 'Lv, C.' 32 ? 5 'Zhao, Y.C.' 33 ? 5 'Li, W.' 34 ? 5 'He, X.M.' 35 ? 5 'Li, P.' 36 ? 5 'Sha, A.G.' 37 ? 5 'Tian, X.' 38 ? 5 'Papasian, C.J.' 39 ? 5 'Deng, H.W.' 40 ? 5 'Lu, G.X.' 41 ? 5 'Xiao, H.M.' 42 ? 6 'Okumura, H.' 43 ? 6 'Sato, T.' 44 ? 6 'Sakuma, R.' 45 ? 6 'Fukushima, H.' 46 ? 6 'Matsuda, T.' 47 ? 6 'Ujita, M.' 48 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6GF7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.410 _cell.length_a_esd ? _cell.length_b 75.410 _cell.length_b_esd ? _cell.length_c 100.780 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GF7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zona pellucida sperm-binding protein 1,Zona pellucida sperm-binding protein 1' 15485.485 2 ? 'N121Q, G140H(6), G149S' ? ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 9 ? ? ? ? 4 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DAAQPALLQYHYDCGDFGMQLLAYPTRGRTVHFKVLDEFGTRFEVANCSICMHWLNTGEDGGLIFSAGYEGCHVLVKDGR YVLRVQLEEMLLSGVVAASYEVQMTCPRPAGYEILRDEKVHHHHHHHHQRPDRGNS ; _entity_poly.pdbx_seq_one_letter_code_can ;DAAQPALLQYHYDCGDFGMQLLAYPTRGRTVHFKVLDEFGTRFEVANCSICMHWLNTGEDGGLIFSAGYEGCHVLVKDGR YVLRVQLEEMLLSGVVAASYEVQMTCPRPAGYEILRDEKVHHHHHHHHQRPDRGNS ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 ALA n 1 4 GLN n 1 5 PRO n 1 6 ALA n 1 7 LEU n 1 8 LEU n 1 9 GLN n 1 10 TYR n 1 11 HIS n 1 12 TYR n 1 13 ASP n 1 14 CYS n 1 15 GLY n 1 16 ASP n 1 17 PHE n 1 18 GLY n 1 19 MET n 1 20 GLN n 1 21 LEU n 1 22 LEU n 1 23 ALA n 1 24 TYR n 1 25 PRO n 1 26 THR n 1 27 ARG n 1 28 GLY n 1 29 ARG n 1 30 THR n 1 31 VAL n 1 32 HIS n 1 33 PHE n 1 34 LYS n 1 35 VAL n 1 36 LEU n 1 37 ASP n 1 38 GLU n 1 39 PHE n 1 40 GLY n 1 41 THR n 1 42 ARG n 1 43 PHE n 1 44 GLU n 1 45 VAL n 1 46 ALA n 1 47 ASN n 1 48 CYS n 1 49 SER n 1 50 ILE n 1 51 CYS n 1 52 MET n 1 53 HIS n 1 54 TRP n 1 55 LEU n 1 56 ASN n 1 57 THR n 1 58 GLY n 1 59 GLU n 1 60 ASP n 1 61 GLY n 1 62 GLY n 1 63 LEU n 1 64 ILE n 1 65 PHE n 1 66 SER n 1 67 ALA n 1 68 GLY n 1 69 TYR n 1 70 GLU n 1 71 GLY n 1 72 CYS n 1 73 HIS n 1 74 VAL n 1 75 LEU n 1 76 VAL n 1 77 LYS n 1 78 ASP n 1 79 GLY n 1 80 ARG n 1 81 TYR n 1 82 VAL n 1 83 LEU n 1 84 ARG n 1 85 VAL n 1 86 GLN n 1 87 LEU n 1 88 GLU n 1 89 GLU n 1 90 MET n 1 91 LEU n 1 92 LEU n 1 93 SER n 1 94 GLY n 1 95 VAL n 1 96 VAL n 1 97 ALA n 1 98 ALA n 1 99 SER n 1 100 TYR n 1 101 GLU n 1 102 VAL n 1 103 GLN n 1 104 MET n 1 105 THR n 1 106 CYS n 1 107 PRO n 1 108 ARG n 1 109 PRO n 1 110 ALA n 1 111 GLY n 1 112 TYR n 1 113 GLU n 1 114 ILE n 1 115 LEU n 1 116 ARG n 1 117 ASP n 1 118 GLU n 1 119 LYS n 1 120 VAL n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 GLN n 1 130 ARG n 1 131 PRO n 1 132 ASP n 1 133 ARG n 1 134 GLY n 1 135 ASN n 1 136 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 120 Chicken ? ZP1 ? ? ? ? ? ? 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HEK293S CRL-3022 ? ? ? ? Plasmid ? ATUM/DNA2.0 ? pJ609 ? ? 1 2 sample 'Biological sequence' 129 136 Chicken ? ZP1 ? ? ? ? ? ? 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HEK293S CRL-3022 ? ? ? ? Plasmid ? ATUM/DNA2.0 ? pJ609 ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A140JXP0_CHICK A0A140JXP0 ? 1 ;ALLQYHYDCGDFGMQLLAYPTRGRTVHFKVLDEFGTRFEVANCSICMHWLNTGEDGGLIFSAGYEGCHVLVKDGRYVLRV QLEEMLLSGVVAASYEVNMTCPRPAGYEILRDEKVH ; 24 2 UNP A0A140JXP0_CHICK A0A140JXP0 ? 1 HQRPDRGNG 141 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6GF7 A 6 ? 121 ? A0A140JXP0 24 ? 139 ? 24 139 2 2 6GF7 A 128 ? 136 ? A0A140JXP0 141 ? 149 ? 146 154 3 1 6GF7 B 6 ? 121 ? A0A140JXP0 24 ? 139 ? 24 139 4 2 6GF7 B 128 ? 136 ? A0A140JXP0 141 ? 149 ? 146 154 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6GF7 ASP A 1 ? UNP A0A140JXP0 ? ? 'expression tag' 19 1 1 6GF7 ALA A 2 ? UNP A0A140JXP0 ? ? 'expression tag' 20 2 1 6GF7 ALA A 3 ? UNP A0A140JXP0 ? ? 'expression tag' 21 3 1 6GF7 GLN A 4 ? UNP A0A140JXP0 ? ? 'expression tag' 22 4 1 6GF7 PRO A 5 ? UNP A0A140JXP0 ? ? 'expression tag' 23 5 1 6GF7 GLN A 103 ? UNP A0A140JXP0 ASN 121 'engineered mutation' 121 6 1 6GF7 HIS A 122 ? UNP A0A140JXP0 ? ? 'expression tag' 140 7 1 6GF7 HIS A 123 ? UNP A0A140JXP0 ? ? 'expression tag' 141 8 1 6GF7 HIS A 124 ? UNP A0A140JXP0 ? ? 'expression tag' 142 9 1 6GF7 HIS A 125 ? UNP A0A140JXP0 ? ? 'expression tag' 143 10 1 6GF7 HIS A 126 ? UNP A0A140JXP0 ? ? 'expression tag' 144 11 1 6GF7 HIS A 127 ? UNP A0A140JXP0 ? ? 'expression tag' 145 12 2 6GF7 SER A 136 ? UNP A0A140JXP0 GLY 149 'engineered mutation' 154 13 3 6GF7 ASP B 1 ? UNP A0A140JXP0 ? ? 'expression tag' 19 14 3 6GF7 ALA B 2 ? UNP A0A140JXP0 ? ? 'expression tag' 20 15 3 6GF7 ALA B 3 ? UNP A0A140JXP0 ? ? 'expression tag' 21 16 3 6GF7 GLN B 4 ? UNP A0A140JXP0 ? ? 'expression tag' 22 17 3 6GF7 PRO B 5 ? UNP A0A140JXP0 ? ? 'expression tag' 23 18 3 6GF7 GLN B 103 ? UNP A0A140JXP0 ASN 121 'engineered mutation' 121 19 3 6GF7 HIS B 122 ? UNP A0A140JXP0 ? ? 'expression tag' 140 20 3 6GF7 HIS B 123 ? UNP A0A140JXP0 ? ? 'expression tag' 141 21 3 6GF7 HIS B 124 ? UNP A0A140JXP0 ? ? 'expression tag' 142 22 3 6GF7 HIS B 125 ? UNP A0A140JXP0 ? ? 'expression tag' 143 23 3 6GF7 HIS B 126 ? UNP A0A140JXP0 ? ? 'expression tag' 144 24 3 6GF7 HIS B 127 ? UNP A0A140JXP0 ? ? 'expression tag' 145 25 4 6GF7 SER B 136 ? UNP A0A140JXP0 GLY 149 'engineered mutation' 154 26 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GF7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.6 M LiCl, 0.1 M tri-sodium citrate pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-10-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.2825 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.2825 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 70.95 _reflns.entry_id 6GF7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.70 _reflns.d_resolution_low 53.323 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15254 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.103 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.82 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1896 _reflns_shell.percent_possible_all 99.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.627 _reflns_shell.pdbx_Rpim_I_all 0.852 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.51 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GF7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.700 _refine.ls_d_res_low 53.323 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15247 _refine.ls_number_reflns_R_free 1528 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 10.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2270 _refine.ls_R_factor_R_free 0.2718 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2218 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.70 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.97 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.41 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 53.323 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1699 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1638 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1730 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.723 ? 2349 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 9.929 ? 1015 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 257 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 302 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7001 2.8230 . . 188 1703 99.00 . . . 0.4309 . 0.3696 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8230 2.9718 . . 194 1720 100.00 . . . 0.3509 . 0.3273 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9718 3.1580 . . 187 1727 100.00 . . . 0.3569 . 0.2654 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1580 3.4018 . . 191 1718 100.00 . . . 0.2874 . 0.2530 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4018 3.7441 . . 186 1715 100.00 . . . 0.2688 . 0.2151 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7441 4.2856 . . 195 1713 100.00 . . . 0.2672 . 0.2017 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2856 5.3986 . . 193 1710 100.00 . . . 0.2097 . 0.1815 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.3986 53.3333 . . 194 1713 100.00 . . . 0.2745 . 0.2141 . . . . . . . . . . # _struct.entry_id 6GF7 _struct.title 'Molecular basis of egg coat filament cross-linking: Zn-SAD structure of the partially deglycosylated ZP1 ZP-N1 domain homodimer' _struct.pdbx_descriptor 'Zona pellucida sperm-binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GF7 _struct_keywords.text ;Zona pellucida, ZP1, ZP-N domain, ZP module, ZP domain, egg coat filament cross-linking, egg coat penetration by sperm, cell adhesion ; _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 2 ? J N N 3 ? K N N 3 ? L N N 3 ? M N N 3 ? N N N 4 ? O N N 4 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 106 SG ? ? A CYS 32 A CYS 124 1_555 ? ? ? ? ? ? ? 2.043 ? ? disulf2 disulf ? ? A CYS 48 SG ? ? ? 1_555 B CYS 48 SG ? ? A CYS 66 B CYS 66 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 51 SG B ? ? 1_555 A CYS 72 SG B ? A CYS 69 A CYS 90 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? B CYS 14 SG ? ? ? 1_555 B CYS 106 SG ? ? B CYS 32 B CYS 124 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf5 disulf ? ? B CYS 51 SG ? ? ? 1_555 B CYS 72 SG ? ? B CYS 69 B CYS 90 1_555 ? ? ? ? ? ? ? 2.036 ? ? covale1 covale one ? A ASN 47 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 65 A NAG 201 1_555 ? ? ? ? ? ? ? 1.373 ? N-Glycosylation covale2 covale one ? B ASN 47 ND2 ? ? ? 1_555 I NAG . C1 ? ? B ASN 65 B NAG 201 1_555 ? ? ? ? ? ? ? 1.461 ? N-Glycosylation metalc1 metalc ? ? A HIS 11 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 29 A ZN 203 1_555 ? ? ? ? ? ? ? 2.033 ? ? metalc2 metalc ? ? A ASP 13 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 31 A ZN 203 1_555 ? ? ? ? ? ? ? 2.017 ? ? metalc3 metalc ? ? A ASP 16 OD2 ? ? ? 1_555 H ZN . ZN ? ? A ASP 34 A ZN 206 1_555 ? ? ? ? ? ? ? 2.381 ? ? metalc4 metalc ? ? A HIS 32 ND1 ? ? ? 1_555 F ZN . ZN ? ? A HIS 50 A ZN 204 1_555 ? ? ? ? ? ? ? 2.078 ? ? metalc5 metalc ? ? A LYS 34 NZ ? ? ? 1_555 G ZN . ZN ? ? A LYS 52 A ZN 205 1_555 ? ? ? ? ? ? ? 2.295 ? ? metalc6 metalc ? ? A GLU 44 OE2 ? ? ? 1_555 F ZN . ZN ? ? A GLU 62 A ZN 204 1_555 ? ? ? ? ? ? ? 2.118 ? ? metalc7 metalc ? ? A HIS 53 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 71 A ZN 202 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc8 metalc ? ? A HIS 73 NE2 A ? ? 1_555 D ZN . ZN ? ? A HIS 91 A ZN 202 1_555 ? ? ? ? ? ? ? 2.191 ? ? metalc9 metalc ? ? A GLU 88 OE1 ? ? ? 1_555 G ZN . ZN ? ? A GLU 106 A ZN 205 1_555 ? ? ? ? ? ? ? 2.172 ? ? metalc10 metalc ? ? A GLU 88 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 106 A ZN 205 1_555 ? ? ? ? ? ? ? 2.177 ? ? metalc11 metalc ? ? A GLU 101 OE1 ? ? ? 1_555 M ZN . ZN ? ? A GLU 119 B ZN 205 4_564 ? ? ? ? ? ? ? 2.069 ? ? metalc12 metalc ? ? D ZN . ZN ? ? ? 1_555 N HOH . O B ? A ZN 202 A HOH 305 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc13 metalc ? ? D ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 202 A HOH 312 1_555 ? ? ? ? ? ? ? 2.184 ? ? metalc14 metalc ? ? E ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 203 A HOH 314 1_555 ? ? ? ? ? ? ? 2.197 ? ? metalc15 metalc ? ? E ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 203 A HOH 315 1_555 ? ? ? ? ? ? ? 2.196 ? ? metalc16 metalc ? ? F ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 204 A HOH 304 1_555 ? ? ? ? ? ? ? 2.191 ? ? metalc17 metalc ? ? F ZN . ZN ? ? ? 1_555 N HOH . O A ? A ZN 204 A HOH 306 1_555 ? ? ? ? ? ? ? 2.186 ? ? metalc18 metalc ? ? G ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 205 A HOH 303 1_555 ? ? ? ? ? ? ? 2.186 ? ? metalc19 metalc ? ? G ZN . ZN ? ? ? 1_555 N HOH . O B ? A ZN 205 A HOH 306 1_555 ? ? ? ? ? ? ? 2.182 ? ? metalc20 metalc ? ? H ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 206 A HOH 308 1_555 ? ? ? ? ? ? ? 2.184 ? ? metalc21 metalc ? ? H ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 206 A HOH 309 1_555 ? ? ? ? ? ? ? 2.185 ? ? metalc22 metalc ? ? H ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 206 A HOH 316 1_555 ? ? ? ? ? ? ? 2.185 ? ? metalc23 metalc ? ? N HOH . O ? ? ? 3_645 M ZN . ZN ? ? A HOH 302 B ZN 205 1_555 ? ? ? ? ? ? ? 2.227 ? ? metalc24 metalc ? ? B HIS 11 NE2 ? ? ? 1_555 K ZN . ZN ? ? B HIS 29 B ZN 203 1_555 ? ? ? ? ? ? ? 2.204 ? ? metalc25 metalc ? ? B ASP 13 OD1 ? ? ? 1_555 K ZN . ZN ? ? B ASP 31 B ZN 203 1_555 ? ? ? ? ? ? ? 1.950 ? ? metalc26 metalc ? ? B HIS 32 ND1 ? ? ? 1_555 M ZN . ZN ? ? B HIS 50 B ZN 205 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc27 metalc ? ? B ASP 37 OD2 ? ? ? 1_555 K ZN . ZN ? ? B ASP 55 B ZN 203 3_645 ? ? ? ? ? ? ? 2.067 ? ? metalc28 metalc ? ? B HIS 53 ND1 ? ? ? 1_555 J ZN . ZN ? ? B HIS 71 B ZN 202 1_555 ? ? ? ? ? ? ? 2.250 ? ? metalc29 metalc ? ? B GLU 88 OE1 ? ? ? 1_555 M ZN . ZN ? ? B GLU 106 B ZN 205 1_555 ? ? ? ? ? ? ? 2.197 ? ? metalc30 metalc ? ? K ZN . ZN ? ? ? 1_555 O HOH . O ? ? B ZN 203 B HOH 306 1_555 ? ? ? ? ? ? ? 2.184 ? ? metalc31 metalc ? ? L ZN . ZN ? ? ? 1_555 O HOH . O ? ? B ZN 204 B HOH 304 4_564 ? ? ? ? ? ? ? 2.188 ? ? metalc32 metalc ? ? L ZN . ZN ? ? ? 1_555 O HOH . O ? ? B ZN 204 B HOH 306 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc33 metalc ? ? L ZN . ZN ? ? ? 1_555 O HOH . O ? ? B ZN 204 B HOH 307 4_564 ? ? ? ? ? ? ? 2.190 ? ? metalc34 metalc ? ? L ZN . ZN ? ? ? 1_555 O HOH . O ? ? B ZN 204 B HOH 308 4_564 ? ? ? ? ? ? ? 2.184 ? ? metalc35 metalc ? ? M ZN . ZN ? ? ? 1_555 O HOH . O ? ? B ZN 205 B HOH 303 1_555 ? ? ? ? ? ? ? 2.177 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id CYS _struct_mon_prot_cis.label_seq_id 106 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id CYS _struct_mon_prot_cis.auth_seq_id 124 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 107 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 125 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.37 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 4 ? AA6 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 9 ? CYS A 14 ? GLN A 27 CYS A 32 AA1 2 GLY A 18 ? TYR A 24 ? GLY A 36 TYR A 42 AA1 3 LEU A 63 ? GLY A 68 ? LEU A 81 GLY A 86 AA1 4 HIS A 53 ? THR A 57 ? HIS A 71 THR A 75 AA2 1 ARG A 42 ? GLU A 44 ? ARG A 60 GLU A 62 AA2 2 THR A 30 ? LEU A 36 ? THR A 48 LEU A 54 AA2 3 ARG A 80 ? MET A 90 ? ARG A 98 MET A 108 AA2 4 LEU A 75 ? LYS A 77 ? LEU A 93 LYS A 95 AA3 1 ARG A 42 ? GLU A 44 ? ARG A 60 GLU A 62 AA3 2 THR A 30 ? LEU A 36 ? THR A 48 LEU A 54 AA3 3 ARG A 80 ? MET A 90 ? ARG A 98 MET A 108 AA3 4 VAL A 96 ? CYS A 106 ? VAL A 114 CYS A 124 AA4 1 GLN B 9 ? CYS B 14 ? GLN B 27 CYS B 32 AA4 2 GLY B 18 ? TYR B 24 ? GLY B 36 TYR B 42 AA4 3 LEU B 63 ? GLY B 68 ? LEU B 81 GLY B 86 AA4 4 HIS B 53 ? THR B 57 ? HIS B 71 THR B 75 AA5 1 ARG B 42 ? GLU B 44 ? ARG B 60 GLU B 62 AA5 2 THR B 30 ? LEU B 36 ? THR B 48 LEU B 54 AA5 3 ARG B 80 ? MET B 90 ? ARG B 98 MET B 108 AA5 4 LEU B 75 ? LYS B 77 ? LEU B 93 LYS B 95 AA6 1 ARG B 42 ? GLU B 44 ? ARG B 60 GLU B 62 AA6 2 THR B 30 ? LEU B 36 ? THR B 48 LEU B 54 AA6 3 ARG B 80 ? MET B 90 ? ARG B 98 MET B 108 AA6 4 VAL B 96 ? PRO B 107 ? VAL B 114 PRO B 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 11 ? N HIS A 29 O LEU A 22 ? O LEU A 40 AA1 2 3 N ALA A 23 ? N ALA A 41 O LEU A 63 ? O LEU A 81 AA1 3 4 O ILE A 64 ? O ILE A 82 N ASN A 56 ? N ASN A 74 AA2 1 2 O PHE A 43 ? O PHE A 61 N VAL A 35 ? N VAL A 53 AA2 2 3 N THR A 30 ? N THR A 48 O MET A 90 ? O MET A 108 AA2 3 4 O ARG A 80 ? O ARG A 98 N LYS A 77 ? N LYS A 95 AA3 1 2 O PHE A 43 ? O PHE A 61 N VAL A 35 ? N VAL A 53 AA3 2 3 N THR A 30 ? N THR A 48 O MET A 90 ? O MET A 108 AA3 3 4 N LEU A 87 ? N LEU A 105 O TYR A 100 ? O TYR A 118 AA4 1 2 N HIS B 11 ? N HIS B 29 O LEU B 22 ? O LEU B 40 AA4 2 3 N MET B 19 ? N MET B 37 O ALA B 67 ? O ALA B 85 AA4 3 4 O ILE B 64 ? O ILE B 82 N ASN B 56 ? N ASN B 74 AA5 1 2 O PHE B 43 ? O PHE B 61 N VAL B 35 ? N VAL B 53 AA5 2 3 N THR B 30 ? N THR B 48 O MET B 90 ? O MET B 108 AA5 3 4 O VAL B 82 ? O VAL B 100 N LEU B 75 ? N LEU B 93 AA6 1 2 O PHE B 43 ? O PHE B 61 N VAL B 35 ? N VAL B 53 AA6 2 3 N THR B 30 ? N THR B 48 O MET B 90 ? O MET B 108 AA6 3 4 N LEU B 87 ? N LEU B 105 O TYR B 100 ? O TYR B 118 # _atom_sites.entry_id 6GF7 _atom_sites.fract_transf_matrix[1][1] 0.013261 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013261 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009923 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 19 ? ? ? A . n A 1 2 ALA 2 20 ? ? ? A . n A 1 3 ALA 3 21 ? ? ? A . n A 1 4 GLN 4 22 ? ? ? A . n A 1 5 PRO 5 23 23 PRO PRO A . n A 1 6 ALA 6 24 24 ALA ALA A . n A 1 7 LEU 7 25 25 LEU LEU A . n A 1 8 LEU 8 26 26 LEU LEU A . n A 1 9 GLN 9 27 27 GLN GLN A . n A 1 10 TYR 10 28 28 TYR TYR A . n A 1 11 HIS 11 29 29 HIS HIS A . n A 1 12 TYR 12 30 30 TYR TYR A . n A 1 13 ASP 13 31 31 ASP ASP A . n A 1 14 CYS 14 32 32 CYS CYS A . n A 1 15 GLY 15 33 33 GLY GLY A . n A 1 16 ASP 16 34 34 ASP ASP A . n A 1 17 PHE 17 35 35 PHE PHE A . n A 1 18 GLY 18 36 36 GLY GLY A . n A 1 19 MET 19 37 37 MET MET A . n A 1 20 GLN 20 38 38 GLN GLN A . n A 1 21 LEU 21 39 39 LEU LEU A . n A 1 22 LEU 22 40 40 LEU LEU A . n A 1 23 ALA 23 41 41 ALA ALA A . n A 1 24 TYR 24 42 42 TYR TYR A . n A 1 25 PRO 25 43 43 PRO PRO A . n A 1 26 THR 26 44 44 THR THR A . n A 1 27 ARG 27 45 45 ARG ARG A . n A 1 28 GLY 28 46 46 GLY GLY A . n A 1 29 ARG 29 47 47 ARG ARG A . n A 1 30 THR 30 48 48 THR THR A . n A 1 31 VAL 31 49 49 VAL VAL A . n A 1 32 HIS 32 50 50 HIS HIS A . n A 1 33 PHE 33 51 51 PHE PHE A . n A 1 34 LYS 34 52 52 LYS LYS A . n A 1 35 VAL 35 53 53 VAL VAL A . n A 1 36 LEU 36 54 54 LEU LEU A . n A 1 37 ASP 37 55 55 ASP ASP A . n A 1 38 GLU 38 56 56 GLU GLU A . n A 1 39 PHE 39 57 57 PHE PHE A . n A 1 40 GLY 40 58 58 GLY GLY A . n A 1 41 THR 41 59 59 THR THR A . n A 1 42 ARG 42 60 60 ARG ARG A . n A 1 43 PHE 43 61 61 PHE PHE A . n A 1 44 GLU 44 62 62 GLU GLU A . n A 1 45 VAL 45 63 63 VAL VAL A . n A 1 46 ALA 46 64 64 ALA ALA A . n A 1 47 ASN 47 65 65 ASN ASN A . n A 1 48 CYS 48 66 66 CYS CYS A . n A 1 49 SER 49 67 67 SER SER A . n A 1 50 ILE 50 68 68 ILE ILE A . n A 1 51 CYS 51 69 69 CYS CYS A . n A 1 52 MET 52 70 70 MET MET A . n A 1 53 HIS 53 71 71 HIS HIS A . n A 1 54 TRP 54 72 72 TRP TRP A . n A 1 55 LEU 55 73 73 LEU LEU A . n A 1 56 ASN 56 74 74 ASN ASN A . n A 1 57 THR 57 75 75 THR THR A . n A 1 58 GLY 58 76 76 GLY GLY A . n A 1 59 GLU 59 77 77 GLU GLU A . n A 1 60 ASP 60 78 78 ASP ASP A . n A 1 61 GLY 61 79 79 GLY GLY A . n A 1 62 GLY 62 80 80 GLY GLY A . n A 1 63 LEU 63 81 81 LEU LEU A . n A 1 64 ILE 64 82 82 ILE ILE A . n A 1 65 PHE 65 83 83 PHE PHE A . n A 1 66 SER 66 84 84 SER SER A . n A 1 67 ALA 67 85 85 ALA ALA A . n A 1 68 GLY 68 86 86 GLY GLY A . n A 1 69 TYR 69 87 87 TYR TYR A . n A 1 70 GLU 70 88 88 GLU GLU A . n A 1 71 GLY 71 89 89 GLY GLY A . n A 1 72 CYS 72 90 90 CYS CYS A . n A 1 73 HIS 73 91 91 HIS HIS A . n A 1 74 VAL 74 92 92 VAL VAL A . n A 1 75 LEU 75 93 93 LEU LEU A . n A 1 76 VAL 76 94 94 VAL VAL A . n A 1 77 LYS 77 95 95 LYS LYS A . n A 1 78 ASP 78 96 96 ASP ASP A . n A 1 79 GLY 79 97 97 GLY GLY A . n A 1 80 ARG 80 98 98 ARG ARG A . n A 1 81 TYR 81 99 99 TYR TYR A . n A 1 82 VAL 82 100 100 VAL VAL A . n A 1 83 LEU 83 101 101 LEU LEU A . n A 1 84 ARG 84 102 102 ARG ARG A . n A 1 85 VAL 85 103 103 VAL VAL A . n A 1 86 GLN 86 104 104 GLN GLN A . n A 1 87 LEU 87 105 105 LEU LEU A . n A 1 88 GLU 88 106 106 GLU GLU A . n A 1 89 GLU 89 107 107 GLU GLU A . n A 1 90 MET 90 108 108 MET MET A . n A 1 91 LEU 91 109 109 LEU LEU A . n A 1 92 LEU 92 110 110 LEU LEU A . n A 1 93 SER 93 111 111 SER SER A . n A 1 94 GLY 94 112 112 GLY GLY A . n A 1 95 VAL 95 113 113 VAL VAL A . n A 1 96 VAL 96 114 114 VAL VAL A . n A 1 97 ALA 97 115 115 ALA ALA A . n A 1 98 ALA 98 116 116 ALA ALA A . n A 1 99 SER 99 117 117 SER SER A . n A 1 100 TYR 100 118 118 TYR TYR A . n A 1 101 GLU 101 119 119 GLU GLU A . n A 1 102 VAL 102 120 120 VAL VAL A . n A 1 103 GLN 103 121 121 GLN GLN A . n A 1 104 MET 104 122 122 MET MET A . n A 1 105 THR 105 123 123 THR THR A . n A 1 106 CYS 106 124 124 CYS CYS A . n A 1 107 PRO 107 125 125 PRO PRO A . n A 1 108 ARG 108 126 126 ARG ARG A . n A 1 109 PRO 109 127 127 PRO PRO A . n A 1 110 ALA 110 128 ? ? ? A . n A 1 111 GLY 111 129 ? ? ? A . n A 1 112 TYR 112 130 ? ? ? A . n A 1 113 GLU 113 131 ? ? ? A . n A 1 114 ILE 114 132 ? ? ? A . n A 1 115 LEU 115 133 ? ? ? A . n A 1 116 ARG 116 134 ? ? ? A . n A 1 117 ASP 117 135 ? ? ? A . n A 1 118 GLU 118 136 ? ? ? A . n A 1 119 LYS 119 137 ? ? ? A . n A 1 120 VAL 120 138 ? ? ? A . n A 1 121 HIS 121 139 ? ? ? A . n A 1 122 HIS 122 140 ? ? ? A . n A 1 123 HIS 123 141 ? ? ? A . n A 1 124 HIS 124 142 ? ? ? A . n A 1 125 HIS 125 143 ? ? ? A . n A 1 126 HIS 126 144 ? ? ? A . n A 1 127 HIS 127 145 ? ? ? A . n A 1 128 HIS 128 146 ? ? ? A . n A 1 129 GLN 129 147 ? ? ? A . n A 1 130 ARG 130 148 ? ? ? A . n A 1 131 PRO 131 149 ? ? ? A . n A 1 132 ASP 132 150 ? ? ? A . n A 1 133 ARG 133 151 ? ? ? A . n A 1 134 GLY 134 152 ? ? ? A . n A 1 135 ASN 135 153 ? ? ? A . n A 1 136 SER 136 154 ? ? ? A . n B 1 1 ASP 1 19 ? ? ? B . n B 1 2 ALA 2 20 ? ? ? B . n B 1 3 ALA 3 21 ? ? ? B . n B 1 4 GLN 4 22 ? ? ? B . n B 1 5 PRO 5 23 ? ? ? B . n B 1 6 ALA 6 24 ? ? ? B . n B 1 7 LEU 7 25 25 LEU LEU B . n B 1 8 LEU 8 26 26 LEU LEU B . n B 1 9 GLN 9 27 27 GLN GLN B . n B 1 10 TYR 10 28 28 TYR TYR B . n B 1 11 HIS 11 29 29 HIS HIS B . n B 1 12 TYR 12 30 30 TYR TYR B . n B 1 13 ASP 13 31 31 ASP ASP B . n B 1 14 CYS 14 32 32 CYS CYS B . n B 1 15 GLY 15 33 33 GLY GLY B . n B 1 16 ASP 16 34 34 ASP ASP B . n B 1 17 PHE 17 35 35 PHE PHE B . n B 1 18 GLY 18 36 36 GLY GLY B . n B 1 19 MET 19 37 37 MET MET B . n B 1 20 GLN 20 38 38 GLN GLN B . n B 1 21 LEU 21 39 39 LEU LEU B . n B 1 22 LEU 22 40 40 LEU LEU B . n B 1 23 ALA 23 41 41 ALA ALA B . n B 1 24 TYR 24 42 42 TYR TYR B . n B 1 25 PRO 25 43 43 PRO PRO B . n B 1 26 THR 26 44 44 THR THR B . n B 1 27 ARG 27 45 45 ARG ARG B . n B 1 28 GLY 28 46 46 GLY GLY B . n B 1 29 ARG 29 47 47 ARG ARG B . n B 1 30 THR 30 48 48 THR THR B . n B 1 31 VAL 31 49 49 VAL VAL B . n B 1 32 HIS 32 50 50 HIS HIS B . n B 1 33 PHE 33 51 51 PHE PHE B . n B 1 34 LYS 34 52 52 LYS LYS B . n B 1 35 VAL 35 53 53 VAL VAL B . n B 1 36 LEU 36 54 54 LEU LEU B . n B 1 37 ASP 37 55 55 ASP ASP B . n B 1 38 GLU 38 56 56 GLU GLU B . n B 1 39 PHE 39 57 57 PHE PHE B . n B 1 40 GLY 40 58 58 GLY GLY B . n B 1 41 THR 41 59 59 THR THR B . n B 1 42 ARG 42 60 60 ARG ARG B . n B 1 43 PHE 43 61 61 PHE PHE B . n B 1 44 GLU 44 62 62 GLU GLU B . n B 1 45 VAL 45 63 63 VAL VAL B . n B 1 46 ALA 46 64 64 ALA ALA B . n B 1 47 ASN 47 65 65 ASN ASN B . n B 1 48 CYS 48 66 66 CYS CYS B . n B 1 49 SER 49 67 67 SER SER B . n B 1 50 ILE 50 68 68 ILE ILE B . n B 1 51 CYS 51 69 69 CYS CYS B . n B 1 52 MET 52 70 70 MET MET B . n B 1 53 HIS 53 71 71 HIS HIS B . n B 1 54 TRP 54 72 72 TRP TRP B . n B 1 55 LEU 55 73 73 LEU LEU B . n B 1 56 ASN 56 74 74 ASN ASN B . n B 1 57 THR 57 75 75 THR THR B . n B 1 58 GLY 58 76 76 GLY GLY B . n B 1 59 GLU 59 77 77 GLU GLU B . n B 1 60 ASP 60 78 78 ASP ASP B . n B 1 61 GLY 61 79 79 GLY GLY B . n B 1 62 GLY 62 80 80 GLY GLY B . n B 1 63 LEU 63 81 81 LEU LEU B . n B 1 64 ILE 64 82 82 ILE ILE B . n B 1 65 PHE 65 83 83 PHE PHE B . n B 1 66 SER 66 84 84 SER SER B . n B 1 67 ALA 67 85 85 ALA ALA B . n B 1 68 GLY 68 86 86 GLY GLY B . n B 1 69 TYR 69 87 87 TYR TYR B . n B 1 70 GLU 70 88 88 GLU GLU B . n B 1 71 GLY 71 89 89 GLY GLY B . n B 1 72 CYS 72 90 90 CYS CYS B . n B 1 73 HIS 73 91 91 HIS HIS B . n B 1 74 VAL 74 92 92 VAL VAL B . n B 1 75 LEU 75 93 93 LEU LEU B . n B 1 76 VAL 76 94 94 VAL VAL B . n B 1 77 LYS 77 95 95 LYS LYS B . n B 1 78 ASP 78 96 96 ASP ASP B . n B 1 79 GLY 79 97 97 GLY GLY B . n B 1 80 ARG 80 98 98 ARG ARG B . n B 1 81 TYR 81 99 99 TYR TYR B . n B 1 82 VAL 82 100 100 VAL VAL B . n B 1 83 LEU 83 101 101 LEU LEU B . n B 1 84 ARG 84 102 102 ARG ARG B . n B 1 85 VAL 85 103 103 VAL VAL B . n B 1 86 GLN 86 104 104 GLN GLN B . n B 1 87 LEU 87 105 105 LEU LEU B . n B 1 88 GLU 88 106 106 GLU GLU B . n B 1 89 GLU 89 107 107 GLU GLU B . n B 1 90 MET 90 108 108 MET MET B . n B 1 91 LEU 91 109 109 LEU LEU B . n B 1 92 LEU 92 110 110 LEU LEU B . n B 1 93 SER 93 111 111 SER SER B . n B 1 94 GLY 94 112 112 GLY GLY B . n B 1 95 VAL 95 113 113 VAL VAL B . n B 1 96 VAL 96 114 114 VAL VAL B . n B 1 97 ALA 97 115 115 ALA ALA B . n B 1 98 ALA 98 116 116 ALA ALA B . n B 1 99 SER 99 117 117 SER SER B . n B 1 100 TYR 100 118 118 TYR TYR B . n B 1 101 GLU 101 119 119 GLU GLU B . n B 1 102 VAL 102 120 120 VAL VAL B . n B 1 103 GLN 103 121 121 GLN GLN B . n B 1 104 MET 104 122 122 MET MET B . n B 1 105 THR 105 123 123 THR THR B . n B 1 106 CYS 106 124 124 CYS CYS B . n B 1 107 PRO 107 125 125 PRO PRO B . n B 1 108 ARG 108 126 126 ARG ARG B . n B 1 109 PRO 109 127 127 PRO PRO B . n B 1 110 ALA 110 128 ? ? ? B . n B 1 111 GLY 111 129 ? ? ? B . n B 1 112 TYR 112 130 ? ? ? B . n B 1 113 GLU 113 131 ? ? ? B . n B 1 114 ILE 114 132 ? ? ? B . n B 1 115 LEU 115 133 ? ? ? B . n B 1 116 ARG 116 134 ? ? ? B . n B 1 117 ASP 117 135 ? ? ? B . n B 1 118 GLU 118 136 ? ? ? B . n B 1 119 LYS 119 137 ? ? ? B . n B 1 120 VAL 120 138 ? ? ? B . n B 1 121 HIS 121 139 ? ? ? B . n B 1 122 HIS 122 140 ? ? ? B . n B 1 123 HIS 123 141 ? ? ? B . n B 1 124 HIS 124 142 ? ? ? B . n B 1 125 HIS 125 143 ? ? ? B . n B 1 126 HIS 126 144 ? ? ? B . n B 1 127 HIS 127 145 ? ? ? B . n B 1 128 HIS 128 146 ? ? ? B . n B 1 129 GLN 129 147 ? ? ? B . n B 1 130 ARG 130 148 ? ? ? B . n B 1 131 PRO 131 149 ? ? ? B . n B 1 132 ASP 132 150 ? ? ? B . n B 1 133 ARG 133 151 ? ? ? B . n B 1 134 GLY 134 152 ? ? ? B . n B 1 135 ASN 135 153 ? ? ? B . n B 1 136 SER 136 154 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 NAG 1 201 900 NAG NAG A . D 3 ZN 1 202 910 ZN ZN A . E 3 ZN 1 203 911 ZN ZN A . F 3 ZN 1 204 912 ZN ZN A . G 3 ZN 1 205 913 ZN ZN A . H 3 ZN 1 206 914 ZN ZN A . I 2 NAG 1 201 900 NAG NAG B . J 3 ZN 1 202 910 ZN ZN B . K 3 ZN 1 203 911 ZN ZN B . L 3 ZN 1 204 912 ZN ZN B . M 3 ZN 1 205 913 ZN ZN B . N 4 HOH 1 301 19 HOH HOH A . N 4 HOH 2 302 16 HOH HOH A . N 4 HOH 3 303 8 HOH HOH A . N 4 HOH 4 304 7 HOH HOH A . N 4 HOH 5 305 3 HOH HOH A . N 4 HOH 6 306 6 HOH HOH A . N 4 HOH 7 307 21 HOH HOH A . N 4 HOH 8 308 11 HOH HOH A . N 4 HOH 9 309 10 HOH HOH A . N 4 HOH 10 310 23 HOH HOH A . N 4 HOH 11 311 20 HOH HOH A . N 4 HOH 12 312 1 HOH HOH A . N 4 HOH 13 313 2 HOH HOH A . N 4 HOH 14 314 4 HOH HOH A . N 4 HOH 15 315 5 HOH HOH A . N 4 HOH 16 316 9 HOH HOH A . O 4 HOH 1 301 18 HOH HOH B . O 4 HOH 2 302 24 HOH HOH B . O 4 HOH 3 303 17 HOH HOH B . O 4 HOH 4 304 15 HOH HOH B . O 4 HOH 5 305 22 HOH HOH B . O 4 HOH 6 306 12 HOH HOH B . O 4 HOH 7 307 14 HOH HOH B . O 4 HOH 8 308 13 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2470 ? 1 MORE -249 ? 1 'SSA (A^2)' 12210 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 11 ? A HIS 29 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 OD2 ? A ASP 13 ? A ASP 31 ? 1_555 119.4 ? 2 NE2 ? A HIS 11 ? A HIS 29 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 O ? N HOH . ? A HOH 314 ? 1_555 108.6 ? 3 OD2 ? A ASP 13 ? A ASP 31 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 O ? N HOH . ? A HOH 314 ? 1_555 106.2 ? 4 NE2 ? A HIS 11 ? A HIS 29 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 O ? N HOH . ? A HOH 315 ? 1_555 112.1 ? 5 OD2 ? A ASP 13 ? A ASP 31 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 O ? N HOH . ? A HOH 315 ? 1_555 111.9 ? 6 O ? N HOH . ? A HOH 314 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 O ? N HOH . ? A HOH 315 ? 1_555 95.6 ? 7 OD2 ? A ASP 16 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? N HOH . ? A HOH 308 ? 1_555 83.3 ? 8 OD2 ? A ASP 16 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? N HOH . ? A HOH 309 ? 1_555 84.8 ? 9 O ? N HOH . ? A HOH 308 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? N HOH . ? A HOH 309 ? 1_555 123.3 ? 10 OD2 ? A ASP 16 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? N HOH . ? A HOH 316 ? 1_555 127.4 ? 11 O ? N HOH . ? A HOH 308 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? N HOH . ? A HOH 316 ? 1_555 118.3 ? 12 O ? N HOH . ? A HOH 309 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? N HOH . ? A HOH 316 ? 1_555 112.7 ? 13 ND1 ? A HIS 32 ? A HIS 50 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 OE2 ? A GLU 44 ? A GLU 62 ? 1_555 89.9 ? 14 ND1 ? A HIS 32 ? A HIS 50 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 O ? N HOH . ? A HOH 304 ? 1_555 94.1 ? 15 OE2 ? A GLU 44 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 O ? N HOH . ? A HOH 304 ? 1_555 76.0 ? 16 ND1 ? A HIS 32 ? A HIS 50 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 O A N HOH . ? A HOH 306 ? 1_555 124.0 ? 17 OE2 ? A GLU 44 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 O A N HOH . ? A HOH 306 ? 1_555 133.9 ? 18 O ? N HOH . ? A HOH 304 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 O A N HOH . ? A HOH 306 ? 1_555 124.6 ? 19 NZ ? A LYS 34 ? A LYS 52 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 OE1 ? A GLU 88 ? A GLU 106 ? 1_555 94.9 ? 20 NZ ? A LYS 34 ? A LYS 52 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 OE2 ? A GLU 88 ? A GLU 106 ? 1_555 92.6 ? 21 OE1 ? A GLU 88 ? A GLU 106 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 OE2 ? A GLU 88 ? A GLU 106 ? 1_555 60.6 ? 22 NZ ? A LYS 34 ? A LYS 52 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 O ? N HOH . ? A HOH 303 ? 1_555 108.0 ? 23 OE1 ? A GLU 88 ? A GLU 106 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 O ? N HOH . ? A HOH 303 ? 1_555 121.1 ? 24 OE2 ? A GLU 88 ? A GLU 106 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 O ? N HOH . ? A HOH 303 ? 1_555 64.8 ? 25 NZ ? A LYS 34 ? A LYS 52 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 O B N HOH . ? A HOH 306 ? 1_555 90.6 ? 26 OE1 ? A GLU 88 ? A GLU 106 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 O B N HOH . ? A HOH 306 ? 1_555 65.6 ? 27 OE2 ? A GLU 88 ? A GLU 106 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 O B N HOH . ? A HOH 306 ? 1_555 126.1 ? 28 O ? N HOH . ? A HOH 303 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 O B N HOH . ? A HOH 306 ? 1_555 158.8 ? 29 NE2 ? A HIS 53 ? A HIS 71 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 NE2 A A HIS 73 ? A HIS 91 ? 1_555 90.2 ? 30 NE2 ? A HIS 53 ? A HIS 71 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O B N HOH . ? A HOH 305 ? 1_555 85.7 ? 31 NE2 A A HIS 73 ? A HIS 91 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O B N HOH . ? A HOH 305 ? 1_555 5.4 ? 32 NE2 ? A HIS 53 ? A HIS 71 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? N HOH . ? A HOH 312 ? 1_555 92.6 ? 33 NE2 A A HIS 73 ? A HIS 91 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? N HOH . ? A HOH 312 ? 1_555 95.7 ? 34 O B N HOH . ? A HOH 305 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? N HOH . ? A HOH 312 ? 1_555 93.0 ? 35 OE1 ? A GLU 101 ? A GLU 119 ? 1_555 ZN ? M ZN . ? B ZN 205 ? 4_564 O ? N HOH . ? A HOH 302 ? 3_645 92.4 ? 36 OE1 ? A GLU 101 ? A GLU 119 ? 1_555 ZN ? M ZN . ? B ZN 205 ? 4_564 ND1 ? B HIS 32 ? B HIS 50 ? 1_555 90.1 ? 37 O ? N HOH . ? A HOH 302 ? 3_645 ZN ? M ZN . ? B ZN 205 ? 4_564 ND1 ? B HIS 32 ? B HIS 50 ? 1_555 5.3 ? 38 OE1 ? A GLU 101 ? A GLU 119 ? 1_555 ZN ? M ZN . ? B ZN 205 ? 4_564 OE1 ? B GLU 88 ? B GLU 106 ? 1_555 95.1 ? 39 O ? N HOH . ? A HOH 302 ? 3_645 ZN ? M ZN . ? B ZN 205 ? 4_564 OE1 ? B GLU 88 ? B GLU 106 ? 1_555 4.3 ? 40 ND1 ? B HIS 32 ? B HIS 50 ? 1_555 ZN ? M ZN . ? B ZN 205 ? 4_564 OE1 ? B GLU 88 ? B GLU 106 ? 1_555 5.2 ? 41 OE1 ? A GLU 101 ? A GLU 119 ? 1_555 ZN ? M ZN . ? B ZN 205 ? 4_564 O ? O HOH . ? B HOH 303 ? 1_555 89.5 ? 42 O ? N HOH . ? A HOH 302 ? 3_645 ZN ? M ZN . ? B ZN 205 ? 4_564 O ? O HOH . ? B HOH 303 ? 1_555 3.0 ? 43 ND1 ? B HIS 32 ? B HIS 50 ? 1_555 ZN ? M ZN . ? B ZN 205 ? 4_564 O ? O HOH . ? B HOH 303 ? 1_555 4.1 ? 44 OE1 ? B GLU 88 ? B GLU 106 ? 1_555 ZN ? M ZN . ? B ZN 205 ? 4_564 O ? O HOH . ? B HOH 303 ? 1_555 6.2 ? 45 NE2 ? B HIS 11 ? B HIS 29 ? 1_555 ZN ? K ZN . ? B ZN 203 ? 1_555 OD1 ? B ASP 13 ? B ASP 31 ? 1_555 75.3 ? 46 NE2 ? B HIS 11 ? B HIS 29 ? 1_555 ZN ? K ZN . ? B ZN 203 ? 1_555 OD2 ? B ASP 37 ? B ASP 55 ? 1_555 60.0 ? 47 OD1 ? B ASP 13 ? B ASP 31 ? 1_555 ZN ? K ZN . ? B ZN 203 ? 1_555 OD2 ? B ASP 37 ? B ASP 55 ? 1_555 16.9 ? 48 NE2 ? B HIS 11 ? B HIS 29 ? 1_555 ZN ? K ZN . ? B ZN 203 ? 1_555 O ? O HOH . ? B HOH 306 ? 1_555 108.8 ? 49 OD1 ? B ASP 13 ? B ASP 31 ? 1_555 ZN ? K ZN . ? B ZN 203 ? 1_555 O ? O HOH . ? B HOH 306 ? 1_555 107.6 ? 50 OD2 ? B ASP 37 ? B ASP 55 ? 1_555 ZN ? K ZN . ? B ZN 203 ? 1_555 O ? O HOH . ? B HOH 306 ? 1_555 104.4 ? 51 O ? O HOH . ? B HOH 304 ? 4_564 ZN ? L ZN . ? B ZN 204 ? 1_555 O ? O HOH . ? B HOH 306 ? 1_555 97.9 ? 52 O ? O HOH . ? B HOH 304 ? 4_564 ZN ? L ZN . ? B ZN 204 ? 1_555 O ? O HOH . ? B HOH 307 ? 4_564 115.8 ? 53 O ? O HOH . ? B HOH 306 ? 1_555 ZN ? L ZN . ? B ZN 204 ? 1_555 O ? O HOH . ? B HOH 307 ? 4_564 88.4 ? 54 O ? O HOH . ? B HOH 304 ? 4_564 ZN ? L ZN . ? B ZN 204 ? 1_555 O ? O HOH . ? B HOH 308 ? 4_564 115.1 ? 55 O ? O HOH . ? B HOH 306 ? 1_555 ZN ? L ZN . ? B ZN 204 ? 1_555 O ? O HOH . ? B HOH 308 ? 4_564 115.6 ? 56 O ? O HOH . ? B HOH 307 ? 4_564 ZN ? L ZN . ? B ZN 204 ? 1_555 O ? O HOH . ? B HOH 308 ? 4_564 118.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-19 2 'Structure model' 1 1 2019-07-17 3 'Structure model' 1 2 2019-07-24 4 'Structure model' 1 3 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Refinement description' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' diffrn_source 3 3 'Structure model' citation 4 4 'Structure model' chem_comp 5 4 'Structure model' entity 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_entity_nonpoly 8 4 'Structure model' pdbx_struct_conn_angle 9 4 'Structure model' refine 10 4 'Structure model' struct_conn 11 4 'Structure model' struct_conn_type 12 4 'Structure model' struct_site 13 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.year' 7 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 4 'Structure model' '_chem_comp.name' 14 4 'Structure model' '_chem_comp.type' 15 4 'Structure model' '_entity.pdbx_description' 16 4 'Structure model' '_pdbx_entity_nonpoly.name' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 32 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id' 33 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 34 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 35 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 36 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 37 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 38 4 'Structure model' '_pdbx_struct_conn_angle.value' 39 4 'Structure model' '_refine.pdbx_diffrn_id' 40 4 'Structure model' '_struct_conn.conn_type_id' 41 4 'Structure model' '_struct_conn.id' 42 4 'Structure model' '_struct_conn.pdbx_dist_value' 43 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 44 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 45 4 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id' 46 4 'Structure model' '_struct_conn.pdbx_role' 47 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 48 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 49 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 50 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 51 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 52 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 53 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 54 4 'Structure model' '_struct_conn.ptnr1_symmetry' 55 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 56 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 57 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 58 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 59 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 60 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 61 4 'Structure model' '_struct_conn.ptnr2_symmetry' 62 4 'Structure model' '_struct_conn_type.id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_3409: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 91 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id B _pdbx_validate_torsion.phi 67.76 _pdbx_validate_torsion.psi -5.79 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 19 ? A ASP 1 2 1 Y 1 A ALA 20 ? A ALA 2 3 1 Y 1 A ALA 21 ? A ALA 3 4 1 Y 1 A GLN 22 ? A GLN 4 5 1 Y 1 A ALA 128 ? A ALA 110 6 1 Y 1 A GLY 129 ? A GLY 111 7 1 Y 1 A TYR 130 ? A TYR 112 8 1 Y 1 A GLU 131 ? A GLU 113 9 1 Y 1 A ILE 132 ? A ILE 114 10 1 Y 1 A LEU 133 ? A LEU 115 11 1 Y 1 A ARG 134 ? A ARG 116 12 1 Y 1 A ASP 135 ? A ASP 117 13 1 Y 1 A GLU 136 ? A GLU 118 14 1 Y 1 A LYS 137 ? A LYS 119 15 1 Y 1 A VAL 138 ? A VAL 120 16 1 Y 1 A HIS 139 ? A HIS 121 17 1 Y 1 A HIS 140 ? A HIS 122 18 1 Y 1 A HIS 141 ? A HIS 123 19 1 Y 1 A HIS 142 ? A HIS 124 20 1 Y 1 A HIS 143 ? A HIS 125 21 1 Y 1 A HIS 144 ? A HIS 126 22 1 Y 1 A HIS 145 ? A HIS 127 23 1 Y 1 A HIS 146 ? A HIS 128 24 1 Y 1 A GLN 147 ? A GLN 129 25 1 Y 1 A ARG 148 ? A ARG 130 26 1 Y 1 A PRO 149 ? A PRO 131 27 1 Y 1 A ASP 150 ? A ASP 132 28 1 Y 1 A ARG 151 ? A ARG 133 29 1 Y 1 A GLY 152 ? A GLY 134 30 1 Y 1 A ASN 153 ? A ASN 135 31 1 Y 1 A SER 154 ? A SER 136 32 1 Y 1 B ASP 19 ? B ASP 1 33 1 Y 1 B ALA 20 ? B ALA 2 34 1 Y 1 B ALA 21 ? B ALA 3 35 1 Y 1 B GLN 22 ? B GLN 4 36 1 Y 1 B PRO 23 ? B PRO 5 37 1 Y 1 B ALA 24 ? B ALA 6 38 1 Y 1 B ALA 128 ? B ALA 110 39 1 Y 1 B GLY 129 ? B GLY 111 40 1 Y 1 B TYR 130 ? B TYR 112 41 1 Y 1 B GLU 131 ? B GLU 113 42 1 Y 1 B ILE 132 ? B ILE 114 43 1 Y 1 B LEU 133 ? B LEU 115 44 1 Y 1 B ARG 134 ? B ARG 116 45 1 Y 1 B ASP 135 ? B ASP 117 46 1 Y 1 B GLU 136 ? B GLU 118 47 1 Y 1 B LYS 137 ? B LYS 119 48 1 Y 1 B VAL 138 ? B VAL 120 49 1 Y 1 B HIS 139 ? B HIS 121 50 1 Y 1 B HIS 140 ? B HIS 122 51 1 Y 1 B HIS 141 ? B HIS 123 52 1 Y 1 B HIS 142 ? B HIS 124 53 1 Y 1 B HIS 143 ? B HIS 125 54 1 Y 1 B HIS 144 ? B HIS 126 55 1 Y 1 B HIS 145 ? B HIS 127 56 1 Y 1 B HIS 146 ? B HIS 128 57 1 Y 1 B GLN 147 ? B GLN 129 58 1 Y 1 B ARG 148 ? B ARG 130 59 1 Y 1 B PRO 149 ? B PRO 131 60 1 Y 1 B ASP 150 ? B ASP 132 61 1 Y 1 B ARG 151 ? B ARG 133 62 1 Y 1 B GLY 152 ? B GLY 134 63 1 Y 1 B ASN 153 ? B ASN 135 64 1 Y 1 B SER 154 ? B SER 136 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Swedish Research Council' Sweden 2012-5093 1 'Swedish Research Council' Sweden 2016-03999 2 'European Molecular Biology Organization' ? 'EMBO Young Investigator Programme' 3 'European Research Council' ? 'ERC 260759' 4 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 'ZINC ION' ZN 4 water HOH # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 cross-linking 'Dimer in non-reducing SDS-PAGE' 2 1 'gel filtration' ? #